Protein Family IF03516

Metagenome Isolate
208 Members
81 Samples
159 Scaffolds
207.65 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10150065|Ga0123354_101500655
Length
234 aa
Sequence
VCNHRKDIKIIFINQFKNKVVMARKLPVYLVLDTSGSMMGEPIAAVETGVQTLVSALRQDPYALETAYLSVITFDSSAKQLVPLTELTAFQPPSIQASGTTALGEALSLLAKKIDAEVTKTTSEVKGDWKPLVFIMTDGGPTDNWQSGLAEFRKRKTGMVIACAAGQGADLNVLKQITECVVQLDTADSSTIKAFFKWVSASVSTGSQKVDSGNEMVGLGELPPXXXEVNIVV*

📊 Sample Types

Isolate 17.8%
Metagenome 82.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 23.4%
Kalotermitidae 18.2%
Unclassified 13.0%
Coreidae 7.8%
Apidae 6.5%
Termopsidae 5.2%
Rhinotermitidae 5.2%
Curculionidae 5.2%
Hydrophilidae 2.6%
Formicidae 2.6%
Passalidae 2.6%
Culicidae 2.6%
Ceratophyllidae 1.3%
Blattidae 1.3%
Cerambycidae 1.3%
Tenebrionidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 191
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
2 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
3 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
4 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
5 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
6 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
10 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
11 8006199443 Yersinia pestis M-1763 Isolate Ceratophyllidae
12 8024025509 Caballeronia grimmiae Lep1A1 Isolate Coreidae
13 8025723035 Caballeronia grimmiae LZ025 Isolate Coreidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
18 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
23 2515154034 Frischella perrara PEB0191 Isolate Apidae
24 2630968947 Frischella perrara PEB0191 Isolate Apidae
25 2695420931 Dysgonomonas macrotermitis DSM 27370 Isolate Unclassified
26 2978102237 Serratia fonticola AeS1 Isolate Culicidae
27 8100181737 Kosakonia sp. S58 Isolate Curculionidae
28 3000861951 Budvicia diplopodorum D9 Isolate
29 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
31 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
32 8102094248 Caballeronia sp. GaOx3 Isolate Coreidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 2820042117 Unclassified Proteobacteria Th196P4bin58 Isolate Unclassified
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
39 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
40 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
41 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
42 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
43 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
44 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2684622926 Gilliamella apicola Ga_182 Isolate Unclassified
47 2765235945 Kosakonia cowanii Esp_Z Isolate Culicidae
48 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
49 2876019154 Gilliamella apicola ESL0182 Isolate Apidae
50 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
51 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
52 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
53 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
54 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
57 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
58 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
59 8100176769 Kosakonia sp. S57 Isolate Curculionidae
60 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
61 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
62 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
63 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
64 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
65 2971189173 Yersinia pestis A-1249 Isolate Unclassified
66 3300000462 Honey bee gut microbial communities from West Haven, Conneticut, USA - Frischia SCG AB-598-I22 Metagenome Apidae
67 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
68 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
69 8025708040 Caballeronia jiangsuensis LZ029 Isolate Coreidae
70 8100171289 Kosakonia sp. S42 Isolate Curculionidae
71 8102193924 Caballeronia sp. LZ029 Isolate Coreidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
76 2859315706 Serratia sp. 3ACOL1 Isolate Cerambycidae
77 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
78 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
79 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
80 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
81 8102181083 Caballeronia sp. LZ025 Isolate Coreidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_172980 3300042612 Bacteria 40831
2 Ga0466733_033287 3300042659 Bacteria 8977
3 Ga0466696_024151 3300042596 Bacteria 5642
4 Ga0466714_054700 3300042603 Bacteria 7581
5 Ga0466722_103565 3300042609 Bacteria 17455
6 Ga0466722_227673 3300042609 Bacteria 3490
7 Ga0466705_517287 3300042612 Bacteria 3543
8 Ga0466711_269463 3300042615 Bacteria 35185
9 Ga0466711_406034 3300042615 Bacteria 13555
10 Ga0466723_127926 3300042618 Bacteria 5961
11 Ga0466726_135252 3300042619 Bacteria 11272
12 Ga0466729_070847 3300042621 Bacteria 3045
13 Ga0466703_065898 3300042636 Unclassified 7807
14 Ga0466708_129698 3300042652 Bacteria 22151
15 JGI24702J35022_10005921 3300002462 Bacteria 7104
16 Ga0068302_10226715 3300005071 Unclassified 2152
17 Ga0466705_025667 3300042612 Bacteria 7922
18 Ga0466705_066055 3300042612 Bacteria 1129
19 Ga0466690_359734 3300042590 Bacteria 1900
20 Ga0466692_047101 3300042591 Bacteria 2685
21 Ga0466693_216543 3300042592 Bacteria 6240
22 Ga0466691_068333 3300042593 Bacteria 5614
23 Ga0466696_241125 3300042596 Bacteria 14650
24 Ga0466700_451162 3300042600 Bacteria 1710
25 Ga0466713_030772 3300042602 Bacteria 37715
26 Ga0466719_177981 3300042606 Bacteria 1223
27 Ga0466703_053004 3300042636 Bacteria 8941
28 Ga0466704_523685 3300042643 Unclassified 4455
29 Ga0466704_567469 3300042643 Bacteria 18060
30 Ga0466709_031136 3300042648 Bacteria 13543
31 Ga0466708_085582 3300042652 Bacteria 26065
32 2227488524 2225789004 Bacteria 20954
33 SCG598I22_11348 3300000462 Unclassified 56222
34 Ga0415639_240727 3300038395 Bacteria 1380
35 Ga0466690_157732 3300042590 Bacteria 7711
36 Ga0466690_359889 3300042590 Bacteria 16085
37 Ga0466692_173446 3300042591 Bacteria 3630
38 Ga0466696_121934 3300042596 Bacteria 12773
39 Ga0466696_181247 3300042596 Bacteria 2432
40 Ga0466696_371169 3300042596 Bacteria 1198
41 Ga0466696_440328 3300042596 Bacteria 13966
42 Ga0123353_10050580 3300010167 Bacteria 6626
43 Ga0123353_10647953 3300010167 Bacteria 1496
44 Ga0123354_10150065 3300010882 Bacteria 2829
45 Ga0123354_10252681 3300010882 Bacteria 1781
46 Ga0466716_078868 3300042605 Bacteria 1333
47 Ga0466716_130689 3300042605 Bacteria 4078
48 Ga0466698_166538 3300042610 Bacteria 1619
49 Ga0466723_252759 3300042618 Bacteria 2545
50 Ga0466726_119999 3300042619 Bacteria 1301
51 Ga0466728_227686 3300042620 Bacteria 1740
52 Ga0466728_442736 3300042620 Bacteria 1598
53 Ga0466735_061818 3300042624 Bacteria 1896
54 Ga0466704_469331 3300042643 Bacteria 1400
55 Ga0466708_322972 3300042652 Bacteria 10051
56 Ga0466727_124598 3300042655 Bacteria 5005
57 JGI24705J35276_11930322 3300002504 Bacteria 776
58 Ga0466705_267018 3300042612 Bacteria 2077
59 Ga0265387_1007895 3300024582 Bacteria 1428
60 Ga0466691_166176 3300042593 Unclassified 3816
61 Ga0123353_10029456 3300010167 Bacteria 8461
62 Ga0466716_079548 3300042605 Bacteria 1036
63 Ga0466719_114801 3300042606 Bacteria 2448
64 Ga0466722_083330 3300042609 Bacteria 2368
65 Ga0466722_111476 3300042609 Bacteria 56871
66 Ga0466698_342721 3300042610 Bacteria 1968
67 Ga0466723_115152 3300042618 Unclassified 9405
68 Ga0466703_093762 3300042636 Bacteria 11192
69 Ga0466703_327247 3300042636 Bacteria 27627
70 Ga0466725_114107 3300042654 Bacteria 39880
71 Ga0466727_172825 3300042655 Unclassified 7554
72 gam1t_NODE_328496_length=20177_GC=32_9_Contigs=4 2189573031 Bacteria 20207
73 JGI24698J34947_10108168 3300002449 Bacteria 1233
74 Ga0102735_1000212 3300007080 Bacteria 15005
75 Ga0466705_255339 3300042612 Unclassified 1953
76 Ga0562377_0004 3300056842 Bacteria 3525959
77 Ga0160452_100219 3300012834 Bacteria 59804
78 Ga0466692_130465 3300042591 Bacteria 2975
79 Ga0466691_017847 3300042593 Bacteria 44068
80 Ga0466696_352895 3300042596 Bacteria 1687
81 Ga0466696_363236 3300042596 Bacteria 1251
82 Ga0466701_092879 3300042598 Bacteria 8782
83 Ga0466707_185685 3300042601 Bacteria 20469
84 Ga0466716_134867 3300042605 Bacteria 3527
85 Ga0466719_084517 3300042606 Bacteria 1396
86 Ga0466719_219709 3300042606 Bacteria 16892
87 Ga0466719_252720 3300042606 Bacteria 1031
88 Ga0466711_146986 3300042615 Bacteria 3449
89 Ga0466715_015949 3300042616 Bacteria 7310
90 Ga0466723_361650 3300042618 Bacteria 13087
91 Ga0466726_110470 3300042619 Bacteria 3513
92 Ga0466726_403968 3300042619 Bacteria 4744
93 Ga0466728_282227 3300042620 Bacteria 28133
94 Ga0466708_193749 3300042652 Bacteria 3318
95 Ga0063521_1047054 3300003973 Bacteria 938
96 Ga0072941_1003524 3300005201 Bacteria 1667
97 Ga0466693_245282 3300042592 Bacteria 1539
98 Ga0466713_134526 3300042602 Bacteria 4914
99 Ga0466716_011834 3300042605 Bacteria 1394
100 Ga0466698_294476 3300042610 Bacteria 2136
101 Ga0466711_081776 3300042615 Bacteria 5792
102 Ga0466711_260102 3300042615 Bacteria 9495
103 Ga0466715_133283 3300042616 Unclassified 6070
104 Ga0466723_119704 3300042618 Unclassified 3798
105 Ga0466726_424796 3300042619 Bacteria 2157
106 Ga0466703_351823 3300042636 Bacteria 9738
107 Ga0466708_045140 3300042652 Bacteria 8754
108 Ga0466725_174045 3300042654 Bacteria 27264
109 Ga0466727_009467 3300042655 Bacteria 6884
110 gam1t_NODE_248298_length=35038_GC=33_7_Contigs=2 2189573031 Bacteria 35048
111 Ga0466656_190801 3300042550 Bacteria 2231
112 Ga0466690_350264 3300042590 Bacteria 11301
113 Ga0466692_043899 3300042591 Bacteria 67267
114 Ga0466693_068384 3300042592 Unclassified 3216
115 Ga0123356_10504107 3300010049 Bacteria 1367
116 Ga0466713_092176 3300042602 Bacteria 1266
117 Ga0466719_166455 3300042606 Bacteria 2101
118 Ga0466719_400543 3300042606 Bacteria 5476
119 Ga0466719_419689 3300042606 Bacteria 6279
120 Ga0466722_015822 3300042609 Bacteria 18783
121 Ga0466722_182659 3300042609 Bacteria 26051
122 Ga0466705_410446 3300042612 Bacteria 3579
123 Ga0466711_199870 3300042615 Bacteria 28300
124 Ga0466715_031419 3300042616 Bacteria 10947
125 Ga0466715_557312 3300042616 Bacteria 2004
126 Ga0466723_106278 3300042618 Bacteria 2638
127 Ga0466728_191431 3300042620 Unclassified 5314
128 Ga0466709_063590 3300042648 Bacteria 58332
129 Ga0466708_125079 3300042652 Bacteria 2633
130 Ga0466727_306226 3300042655 Bacteria 7497
131 IMNBL1DRAFT_c0000546 3300000062 Bacteria 30663
132 JGI24702J35022_10000159 3300002462 Bacteria 35048
133 Ga0103263_100255 3300007042 Bacteria 7737
134 Ga0466705_063283 3300042612 Bacteria 2379
135 Ga0466732_146434 3300042656 Bacteria 41117
136 Ga0466690_022101 3300042590 Unclassified 12839
137 Ga0466690_339476 3300042590 Bacteria 22176
138 Ga0466691_047475 3300042593 Bacteria 16186
139 Ga0466691_124429 3300042593 Bacteria 12355
140 Ga0466691_228609 3300042593 Bacteria 15455
141 Ga0123353_10504316 3300010167 Bacteria 1762
142 Ga0123354_10004791 3300010882 Bacteria 19341
143 Ga0466707_106928 3300042601 Bacteria 18647
144 Ga0466713_077082 3300042602 Unclassified 1210
145 Ga0466719_148403 3300042606 Bacteria 9045
146 Ga0466722_172558 3300042609 Bacteria 14918
147 Ga0466722_241799 3300042609 Bacteria 9410
148 Ga0466723_049715 3300042618 Bacteria 5387
149 Ga0466728_197250 3300042620 Bacteria 4511
150 Ga0466703_044201 3300042636 Bacteria 1726
151 Ga0466703_052722 3300042636 Unclassified 2709
152 Ga0466703_129232 3300042636 Bacteria 3357
153 Ga0466703_307474 3300042636 Bacteria 9453
154 Ga0466704_261484 3300042643 Unclassified 4443
155 Ga0466709_195820 3300042648 Bacteria 1937
156 Ga0466709_319293 3300042648 Bacteria 8514
157 JGI24699J35502_11129406 3300002509 Bacteria 4700
158 JGI24699J35502_11132846 3300002509 Bacteria 7764
159 JGI24696J40584_12951784 3300002834 Bacteria 2277

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042618 Ga0466723_119704 Ga0466723_119704_965_1555 185
2 3300042618 Ga0466723_361650 Ga0466723_361650_466_1056 186
3 3300042612 Ga0466705_025667 Ga0466705_025667_2238_2828 188
4 3300042612 Ga0466705_066055 Ga0466705_066055_293_883 188
5 3300042618 Ga0466723_049715 Ga0466723_049715_1188_1778 189
6 3300042612 Ga0466705_172980 Ga0466705_172980_15916_16506 190
7 3300042609 Ga0466722_103565 Ga0466722_103565_11082_11675 192
8 3300042606 Ga0466719_252720 Ga0466719_252720_69_650 193
9 3300042590 Ga0466690_022101 Ga0466690_022101_3330_3920 196
10 3300042590 Ga0466690_359889 Ga0466690_359889_1618_2208 196
11 3300042592 Ga0466693_068384 Ga0466693_068384_2393_2983 196
12 3300042593 Ga0466691_166176 Ga0466691_166176_2479_3069 196
13 3300042596 Ga0466696_241125 Ga0466696_241125_11605_12195 196
14 3300042605 Ga0466716_130689 Ga0466716_130689_431_1021 196
15 3300042605 Ga0466716_134867 Ga0466716_134867_89_679 196
16 3300042606 Ga0466719_166455 Ga0466719_166455_1346_1936 196
17 3300042606 Ga0466719_400543 Ga0466719_400543_3014_3604 196
18 3300042609 Ga0466722_111476 Ga0466722_111476_14715_15305 196
19 3300042610 Ga0466698_342721 Ga0466698_342721_944_1534 196
20 3300042612 Ga0466705_025667 Ga0466705_025667_1122_1712 196
21 3300042612 Ga0466705_267018 Ga0466705_267018_1141_1731 196
22 3300042615 Ga0466711_269463 Ga0466711_269463_25839_26429 196
23 3300042618 Ga0466723_115152 Ga0466723_115152_5837_6427 196
24 3300042619 Ga0466726_403968 Ga0466726_403968_2734_3324 196
25 3300042620 Ga0466728_227686 Ga0466728_227686_370_960 196
26 3300042624 Ga0466735_061818 Ga0466735_061818_151_741 196
27 3300042643 Ga0466704_261484 Ga0466704_261484_3669_4259 196
28 3300042648 Ga0466709_319293 Ga0466709_319293_6995_7585 196
29 3300042652 Ga0466708_125079 Ga0466708_125079_1363_1953 196
30 3300042652 Ga0466708_193749 Ga0466708_193749_2141_2731 196
31 3300042659 Ga0466733_033287 Ga0466733_033287_3527_4117 196
32 2189573031 gam1t_NODE_248298_length=35038_GC=33_7_Contigs=2 gam1t_00064480 197
33 2189573031 gam1t_NODE_328496_length=20177_GC=32_9_Contigs=4 gam1t_00085030 197
34 3300042591 Ga0466692_173446 Ga0466692_173446_2178_2771 197
35 3300042593 Ga0466691_017847 Ga0466691_017847_11519_12112 197
36 3300042615 Ga0466711_146986 Ga0466711_146986_2055_2648 197
37 3300042615 Ga0466711_199870 Ga0466711_199870_12044_12637 197
38 3300042616 Ga0466715_031419 Ga0466715_031419_9051_9644 197
39 3300042618 Ga0466723_106278 Ga0466723_106278_107_700 197
40 3300042636 Ga0466703_351823 Ga0466703_351823_7243_7836 197
41 3300042643 Ga0466704_523685 Ga0466704_523685_2899_3492 197
42 3300042643 Ga0466704_567469 Ga0466704_567469_14836_15429 197
43 3300042648 Ga0466709_063590 Ga0466709_063590_1758_2351 197
44 3300042654 Ga0466725_174045 Ga0466725_174045_21019_21612 197
45 3300002462 JGI24702J35022_10000159 JGI24702J35022_1000015920 198
46 3300042602 Ga0466713_134526 Ga0466713_134526_3145_3780 199
47 3300042652 Ga0466708_125079 Ga0466708_125079_541_1176 201
48 3300042636 Ga0466703_065898 Ga0466703_065898_6528_7166 202
49 3300000062 IMNBL1DRAFT_c0000546 IMNBL1DRAFT_000054610 203
50 3300005201 Ga0072941_1003524 Ga0072941_10035241 203
51 3300042592 Ga0466693_245282 Ga0466693_245282_340_972 203
52 3300042596 Ga0466696_371169 Ga0466696_371169_410_1048 203
53 3300042605 Ga0466716_130689 Ga0466716_130689_1212_1847 203
54 3300042618 Ga0466723_252759 Ga0466723_252759_877_1512 203
55 3300042652 Ga0466708_045140 Ga0466708_045140_3757_4395 203
56 3300010167 Ga0123353_10029456 Ga0123353_100294567 204
57 3300010167 Ga0123353_10504316 Ga0123353_105043162 204
58 3300010167 Ga0123353_10647953 Ga0123353_106479532 204
59 3300010882 Ga0123354_10150065 Ga0123354_101500654 204
60 3300042606 Ga0466719_177981 Ga0466719_177981_56_670 204
61 3300042596 Ga0466696_121934 Ga0466696_121934_7562_8203 207
62 3300042609 Ga0466722_172558 Ga0466722_172558_2392_3024 210
63 3300042655 Ga0466727_306226 Ga0466727_306226_6761_7393 210
64 2225789004 2227488524 2227957564 211
65 3300042591 Ga0466692_130465 Ga0466692_130465_1065_1700 211
66 3300042593 Ga0466691_124429 Ga0466691_124429_5694_6329 211
67 3300042593 Ga0466691_228609 Ga0466691_228609_7847_8482 211
68 3300042596 Ga0466696_352895 Ga0466696_352895_574_1209 211
69 3300042602 Ga0466713_030772 Ga0466713_030772_36234_36869 211
70 3300042606 Ga0466719_419689 Ga0466719_419689_5274_5909 211
71 3300042609 Ga0466722_182659 Ga0466722_182659_2810_3445 211
72 3300042612 Ga0466705_255339 Ga0466705_255339_685_1320 211
73 3300042615 Ga0466711_081776 Ga0466711_081776_872_1507 211
74 3300042615 Ga0466711_199870 Ga0466711_199870_11406_12041 211
75 3300042615 Ga0466711_260102 Ga0466711_260102_2392_3027 211
76 3300042618 Ga0466723_127926 Ga0466723_127926_4891_5526 211
77 3300042618 Ga0466723_252759 Ga0466723_252759_53_688 211
78 3300042619 Ga0466726_110470 Ga0466726_110470_2237_2872 211
79 3300042620 Ga0466728_282227 Ga0466728_282227_5355_5990 211
80 3300042636 Ga0466703_307474 Ga0466703_307474_8386_9021 211
81 3300042648 Ga0466709_031136 Ga0466709_031136_11088_11723 211
82 3300042652 Ga0466708_322972 Ga0466708_322972_4166_4801 211
83 3300042655 Ga0466727_124598 Ga0466727_124598_3676_4311 211
84 3300042655 Ga0466727_172825 Ga0466727_172825_3226_3861 211
85 3300056842 Ga0562377_0004 Ga0562377_0004_1916244_1916879 211
86 iso_pr_bacteria 2695420317 2695484028 211
87 iso_pr_bacteria 2695420931 2698110092 211
88 iso_pr_bacteria 2873600114 2873600453 211
89 iso_pr_bacteria 2873610414 2873610833 211
90 iso_pr_bacteria 2910949487 2910950828 211
91 iso_pr_bacteria 2967483437 2967484356 211
92 iso_pr_bacteria 2967483437 2967486684 211
93 iso_pr_bacteria 2967483437 2967487230 211
94 iso_pr_bacteria 8024025509 8024031394 211
95 iso_pr_bacteria 8025708040 8025711703 211
96 iso_pr_bacteria 8025723035 8025728820 211
97 iso_pr_bacteria 8100157865 8100161571 211
98 iso_pr_bacteria 8102094248 8102100066 211
99 iso_pr_bacteria 8102181083 8102186868 211
100 iso_pr_bacteria 8102193924 8102197585 211
101 3300002834 JGI24696J40584_12951784 JGI24696J40584_129517842 212
102 3300012834 Ga0160452_100219 Ga0160452_10021935 212
103 3300024582 Ga0265387_1007895 Ga0265387_10078952 212
104 3300038395 Ga0415639_240727 Ga0415639_240727_93_731 212
105 3300042550 Ga0466656_190801 Ga0466656_190801_909_1547 212
106 3300042590 Ga0466690_022101 Ga0466690_022101_1876_2514 212
107 3300042590 Ga0466690_157732 Ga0466690_157732_2194_2832 212
108 3300042590 Ga0466690_339476 Ga0466690_339476_7941_8579 212
109 3300042590 Ga0466690_350264 Ga0466690_350264_8015_8653 212
110 3300042590 Ga0466690_359734 Ga0466690_359734_332_970 212
111 3300042591 Ga0466692_043899 Ga0466692_043899_8710_9348 212
112 3300042591 Ga0466692_047101 Ga0466692_047101_1954_2592 212
113 3300042591 Ga0466692_173446 Ga0466692_173446_1299_1937 212
114 3300042592 Ga0466693_216543 Ga0466693_216543_5118_5756 212
115 3300042593 Ga0466691_047475 Ga0466691_047475_13694_14332 212
116 3300042593 Ga0466691_068333 Ga0466691_068333_4083_4721 212
117 3300042596 Ga0466696_024151 Ga0466696_024151_2968_3606 212
118 3300042596 Ga0466696_181247 Ga0466696_181247_736_1374 212
119 3300042596 Ga0466696_363236 Ga0466696_363236_111_749 212
120 3300042596 Ga0466696_440328 Ga0466696_440328_3517_4155 212
121 3300042598 Ga0466701_092879 Ga0466701_092879_261_899 212
122 3300042600 Ga0466700_451162 Ga0466700_451162_1015_1653 212
123 3300042601 Ga0466707_106928 Ga0466707_106928_5830_6468 212
124 3300042601 Ga0466707_185685 Ga0466707_185685_9945_10583 212
125 3300042602 Ga0466713_077082 Ga0466713_077082_272_910 212
126 3300042602 Ga0466713_092176 Ga0466713_092176_117_755 212
127 3300042603 Ga0466714_054700 Ga0466714_054700_3438_4076 212
128 3300042605 Ga0466716_011834 Ga0466716_011834_42_680 212
129 3300042605 Ga0466716_078868 Ga0466716_078868_171_809 212
130 3300042605 Ga0466716_079548 Ga0466716_079548_171_809 212
131 3300042606 Ga0466719_084517 Ga0466719_084517_150_788 212
132 3300042606 Ga0466719_114801 Ga0466719_114801_1202_1840 212
133 3300042606 Ga0466719_148403 Ga0466719_148403_1708_2346 212
134 3300042606 Ga0466719_219709 Ga0466719_219709_3618_4256 212
135 3300042606 Ga0466719_419689 Ga0466719_419689_4634_5272 212
136 3300042609 Ga0466722_015822 Ga0466722_015822_9338_9976 212
137 3300042609 Ga0466722_083330 Ga0466722_083330_965_1603 212
138 3300042609 Ga0466722_227673 Ga0466722_227673_2410_3048 212
139 3300042609 Ga0466722_241799 Ga0466722_241799_3211_3849 212
140 3300042610 Ga0466698_166538 Ga0466698_166538_912_1550 212
141 3300042610 Ga0466698_294476 Ga0466698_294476_217_855 212
142 3300042612 Ga0466705_063283 Ga0466705_063283_956_1594 212
143 3300042612 Ga0466705_410446 Ga0466705_410446_2905_3543 212
144 3300042612 Ga0466705_517287 Ga0466705_517287_431_1069 212
145 3300042615 Ga0466711_269463 Ga0466711_269463_26478_27116 212
146 3300042615 Ga0466711_406034 Ga0466711_406034_9464_10102 212
147 3300042616 Ga0466715_015949 Ga0466715_015949_2228_2866 212
148 3300042616 Ga0466715_133283 Ga0466715_133283_1701_2339 212
149 3300042616 Ga0466715_557312 Ga0466715_557312_1333_1971 212
150 3300042618 Ga0466723_049715 Ga0466723_049715_309_947 212
151 3300042619 Ga0466726_119999 Ga0466726_119999_411_1049 212
152 3300042619 Ga0466726_135252 Ga0466726_135252_890_1528 212
153 3300042619 Ga0466726_424796 Ga0466726_424796_894_1532 212
154 3300042620 Ga0466728_191431 Ga0466728_191431_3140_3778 212
155 3300042620 Ga0466728_197250 Ga0466728_197250_3469_4107 212
156 3300042620 Ga0466728_442736 Ga0466728_442736_405_1043 212
157 3300042621 Ga0466729_070847 Ga0466729_070847_686_1324 212
158 3300042636 Ga0466703_044201 Ga0466703_044201_411_1049 212
159 3300042636 Ga0466703_052722 Ga0466703_052722_1184_1822 212
160 3300042636 Ga0466703_053004 Ga0466703_053004_7980_8618 212
161 3300042636 Ga0466703_093762 Ga0466703_093762_7199_7837 212
162 3300042636 Ga0466703_129232 Ga0466703_129232_173_811 212
163 3300042636 Ga0466703_327247 Ga0466703_327247_16952_17590 212
164 3300042643 Ga0466704_469331 Ga0466704_469331_270_908 212
165 3300042652 Ga0466708_085582 Ga0466708_085582_13938_14576 212
166 3300042652 Ga0466708_129698 Ga0466708_129698_4795_5433 212
167 3300042652 Ga0466708_322972 Ga0466708_322972_3521_4159 212
168 3300042654 Ga0466725_114107 Ga0466725_114107_15872_16510 212
169 3300042655 Ga0466727_009467 Ga0466727_009467_4529_5167 212
170 3300042656 Ga0466732_146434 Ga0466732_146434_7428_8066 212
171 iso_pr_bacteria 2515154034 2515298119 212
172 iso_pr_bacteria 2630968947 2633885906 212
173 iso_pr_bacteria 2684622926 2686103400 212
174 iso_pr_bacteria 2695420317 2695484027 212
175 iso_pr_bacteria 2695420931 2698110091 212
176 iso_pr_bacteria 2756170266 2756754434 212
177 iso_pr_bacteria 2765235945 2766082949 212
178 iso_pr_bacteria 2820042117 2820042284 212
179 iso_pr_bacteria 2820759988 2820760360 212
180 iso_pr_bacteria 2859315706 2859319719 212
181 iso_pr_bacteria 2873600114 2873600452 212
182 iso_pr_bacteria 2873610414 2873610832 212
183 iso_pr_bacteria 2876019154 2876019924 212
184 iso_pr_bacteria 2910949487 2910950829 212
185 iso_pr_bacteria 2971189173 2971192834 212
186 iso_pr_bacteria 2978102237 2978105382 212
187 iso_pr_bacteria 3000861951 3000863827 212
188 iso_pr_bacteria 8006199443 8006202544 212
189 iso_pr_bacteria 8100157865 8100161570 212
190 iso_pr_bacteria 8100171289 8100175993 212
191 iso_pr_bacteria 8100176769 8100180077 212
192 iso_pr_bacteria 8100181737 8100185598 212
193 3300000462 SCG598I22_11348 SCG598I22_1134841 213
194 3300002449 JGI24698J34947_10108168 JGI24698J34947_101081681 213
195 3300002462 JGI24702J35022_10005921 JGI24702J35022_100059214 213
196 3300002509 JGI24699J35502_11129406 JGI24699J35502_111294066 213
197 3300002509 JGI24699J35502_11132846 JGI24699J35502_111328468 213
198 3300005071 Ga0068302_10226715 Ga0068302_102267155 213
199 3300007042 Ga0103263_100255 Ga0103263_1002558 213
200 3300007080 Ga0102735_1000212 Ga0102735_10002127 213
201 3300010049 Ga0123356_10504107 Ga0123356_105041072 213
202 3300010167 Ga0123353_10050580 Ga0123353_100505807 213
203 3300010882 Ga0123354_10004791 Ga0123354_1000479115 213
204 3300010882 Ga0123354_10252681 Ga0123354_102526812 213
205 3300042648 Ga0466709_195820 Ga0466709_195820_715_1356 213
206 3300003973 Ga0063521_1047054 Ga0063521_10470541 214
207 3300002504 JGI24705J35276_11930322 JGI24705J35276_119303221 216
208 3300010882 Ga0123354_10150065 Ga0123354_101500655 234

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00092 VWA von Willebrand factor type A domain 28 179 0.84
PF13519 VWA_2 von Willebrand factor type A domain 28 139 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.