Protein Family IF03515

Metagenome Isolate
171 Members
73 Samples
137 Scaffolds
222.09 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10148444|Ga0123354_101484442
Length
222 aa
Sequence
MEIIQLENVHKVYRTKEIETIALENVNLTVGKGEFLSVMGPSGCGKSTLLNIIGLLDTPNQGVVTINGTNTSTLRDTPAAEFRNKTAGFIFQSFHLINSLNVLDNVQLPLLYRSGSFNRSQRAKEVLEKVGLSHRMKHFPTQLSGGQCQRVAIARAIVGNPEIILADEPTGNLDSKMGMEIIELLFDLNREGVTIIMVTHDENVAKKTKRIVRFFDGRQVE*

📊 Sample Types

Isolate 19.9%
Metagenome 80.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 32.9%
Termitidae 24.7%
Kalotermitidae 19.2%
Unclassified 6.8%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Passalidae 4.1%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 162
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2923982719 Parabacteroides sp. 52 Isolate Blattidae
3 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
4 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
5 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
15 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
16 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
17 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
18 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
19 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
20 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
21 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
22 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
23 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2910926975 Dysgonomonas sp. 25 Isolate Blattidae
34 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
35 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
36 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
37 3004667792 Bacteroides sp. 519 Isolate Blattidae
38 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
42 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
43 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
44 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
45 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
46 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
47 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
48 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
49 3004672520 Bacteroides sp. 51 Isolate Blattidae
50 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
51 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
52 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
53 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
54 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
58 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
59 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
60 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
61 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
62 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
63 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
64 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
65 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
66 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
67 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
68 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
69 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
70 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
71 3004677695 Bacteroides sp. 214 Isolate Blattidae
72 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
73 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_155136 3300042659 Bacteria 14358
2 IMNBL1DRAFT_c0003711 3300000062 Bacteria 9590
3 Ga0068305_10074349 3300005083 Unclassified 17325
4 Ga0466729_199094 3300042621 Bacteria 2234
5 Ga0466704_377608 3300042643 Unclassified 9656
6 Ga0466709_262467 3300042648 Bacteria 7076
7 Ga0466727_042357 3300042655 Bacteria 8786
8 Ga0466727_132978 3300042655 Bacteria 6759
9 Ga0466727_196859 3300042655 Bacteria 2325
10 Ga0466711_089286 3300042615 Bacteria 2945
11 Ga0466711_233629 3300042615 Bacteria 2282
12 Ga0466728_228057 3300042620 Bacteria 7878
13 Ga0123356_10844438 3300010049 Bacteria 1087
14 Ga0123354_10004434 3300010882 Bacteria 19900
15 Ga0466706_222667 3300042599 Bacteria 8630
16 Ga0466700_124418 3300042600 Bacteria 8391
17 Ga0466707_351627 3300042601 Bacteria 6157
18 Ga0466713_102098 3300042602 Bacteria 100663
19 Ga0466717_282481 3300042604 Bacteria 1088
20 Ga0466719_388947 3300042606 Bacteria 7195
21 Ga0466691_042749 3300042593 Bacteria 8949
22 Ga0466694_364137 3300042594 Bacteria 1113
23 Ga0466696_394022 3300042596 Bacteria 212291
24 Ga0466697_095834 3300042611 Bacteria 1422
25 2227303015 2225789004 Bacteria 6605
26 2227466301 2225789004 Bacteria 24591
27 IMNBL1DRAFT_c0018301 3300000062 Bacteria 2917
28 Ga0068302_10075093 3300005071 Bacteria 5270
29 Ga0466729_232625 3300042621 Bacteria 9552
30 Ga0466703_125567 3300042636 Bacteria 8716
31 Ga0466703_225493 3300042636 Bacteria 10266
32 Ga0466704_090031 3300042643 Bacteria 1918
33 Ga0466704_570593 3300042643 Bacteria 1387
34 Ga0466726_302114 3300042619 Bacteria 1165
35 Ga0466728_175052 3300042620 Bacteria 2156
36 Ga0123356_10865816 3300010049 Bacteria 1075
37 Ga0466707_219787 3300042601 Bacteria 3842
38 Ga0466690_086675 3300042590 Bacteria 50714
39 2227008147 2225789003 Bacteria 23542
40 JGI24702J35022_10007072 3300002462 Bacteria 6449
41 JGI24699J35502_11133920 3300002509 Bacteria 19407
42 JGI24699J35502_11134201 3300002509 Bacteria 54341
43 Ga0123357_10001792 3300009784 Bacteria 23272
44 Ga0466703_303147 3300042636 Bacteria 2764
45 Ga0466709_400885 3300042648 Bacteria 3787
46 Ga0466725_426273 3300042654 Bacteria 2494
47 Ga0466711_130521 3300042615 Bacteria 23973
48 Ga0466729_011082 3300042621 Bacteria 13295
49 Ga0466729_033027 3300042621 Bacteria 11980
50 Ga0123357_10094686 3300009784 Bacteria 3876
51 Ga0466716_274265 3300042605 Bacteria 11797
52 Ga0466722_174102 3300042609 Bacteria 10210
53 Ga0466697_056567 3300042611 Bacteria 485126
54 Ga0466657_323072 3300042582 Bacteria 1073
55 Ga0466704_088764 3300042643 Bacteria 47132
56 Ga0466709_255031 3300042648 Bacteria 12701
57 Ga0466727_237063 3300042655 Bacteria 1379
58 Ga0466711_092050 3300042615 Bacteria 33984
59 Ga0466711_376535 3300042615 Bacteria 2680
60 Ga0466728_052165 3300042620 Bacteria 25989
61 Ga0466706_045905 3300042599 Bacteria 2098
62 Ga0466713_139646 3300042602 Bacteria 516516
63 Ga0466719_218399 3300042606 Bacteria 1371
64 Ga0466722_031675 3300042609 Bacteria 4839
65 Ga0466696_069317 3300042596 Bacteria 14105
66 Ga0466696_304714 3300042596 Bacteria 4826
67 Ga0466705_119745 3300042612 Bacteria 31799
68 Ga0466705_316947 3300042612 Bacteria 39498
69 Ga0466733_101223 3300042659 Bacteria 57262
70 Ga0466733_216697 3300042659 Bacteria 189231
71 Ga0466731_139217 3300042622 Bacteria 5709
72 Ga0466731_227089 3300042622 Bacteria 1373
73 Ga0466727_136124 3300042655 Unclassified 5040
74 Ga0466715_422122 3300042616 Bacteria 4668
75 Ga0466726_186909 3300042619 Bacteria 4069
76 Ga0466706_097294 3300042599 Bacteria 8262
77 Ga0466707_078559 3300042601 Bacteria 10096
78 Ga0466722_014428 3300042609 Bacteria 7860
79 Ga0466696_019214 3300042596 Unclassified 1600
80 Ga0466696_281419 3300042596 Bacteria 25670
81 Ga0466705_334520 3300042612 Bacteria 18573
82 Ga0466705_346162 3300042612 Bacteria 13356
83 Ga0466733_115414 3300042659 Bacteria 30521
84 Ga0466733_118149 3300042659 Bacteria 6747
85 IMNBL1DRAFT_c0005146 3300000062 Unclassified 7594
86 JGI24702J35022_10014375 3300002462 Bacteria 4366
87 JGI24696J40584_12847856 3300002834 Bacteria 972
88 Ga0466704_354080 3300042643 Bacteria 2357
89 Ga0466704_443184 3300042643 Bacteria 15005
90 Ga0466709_047096 3300042648 Bacteria 173163
91 Ga0466708_275929 3300042652 Bacteria 19874
92 Ga0466710_150335 3300042613 Bacteria 1703
93 Ga0466711_309338 3300042615 Unclassified 2667
94 Ga0466715_513291 3300042616 Bacteria 19275
95 Ga0466726_062025 3300042619 Bacteria 12997
96 Ga0466726_363206 3300042619 Bacteria 4815
97 Ga0466701_033084 3300042598 Bacteria 19683
98 Ga0466706_106819 3300042599 Bacteria 16267
99 Ga0466691_042241 3300042593 Bacteria 7707
100 Ga0466705_180601 3300042612 Bacteria 15876
101 Ga0466733_092492 3300042659 Bacteria 17976
102 IMNBL1DRAFT_c0002489 3300000062 Bacteria 12781
103 IMNBL1DRAFT_c0029342 3300000062 Bacteria 2037
104 Ga0466735_159902 3300042624 Bacteria 3900
105 Ga0466735_196657 3300042624 Bacteria 2462
106 Ga0466703_075843 3300042636 Bacteria 8094
107 Ga0466704_091217 3300042643 Bacteria 4917
108 Ga0466727_002343 3300042655 Bacteria 10308
109 Ga0466710_255321 3300042613 Bacteria 1628
110 Ga0466715_115457 3300042616 Bacteria 36939
111 Ga0466723_016493 3300042618 Bacteria 15588
112 Ga0466726_040474 3300042619 Bacteria 6781
113 Ga0466726_195635 3300042619 Bacteria 6124
114 Ga0123354_10148444 3300010882 Bacteria 2855
115 Ga0466701_081600 3300042598 Bacteria 6902
116 Ga0466706_052927 3300042599 Bacteria 2034
117 Ga0466706_207157 3300042599 Bacteria 1877
118 Ga0466707_058300 3300042601 Bacteria 1351
119 Ga0466713_038764 3300042602 Bacteria 16332
120 Ga0466713_137234 3300042602 Bacteria 24707
121 Ga0466698_325518 3300042610 Bacteria 2438
122 Ga0466692_005818 3300042591 Bacteria 74984
123 Ga0466692_149579 3300042591 Bacteria 83669
124 Ga0466696_368253 3300042596 Bacteria 8484
125 Ga0466733_038409 3300042659 Bacteria 2906
126 2227275262 2225789004 Bacteria 6851
127 JGI24699J35502_11134195 3300002509 Bacteria 51638
128 Ga0068305_10000798 3300005083 Bacteria 44439
129 Ga0068305_10008764 3300005083 Bacteria 5855
130 Ga0466704_149441 3300042643 Unclassified 10388
131 Ga0466711_017768 3300042615 Unclassified 6339
132 Ga0466711_128742 3300042615 Bacteria 3548
133 Ga0466711_180904 3300042615 Bacteria 8816
134 Ga0123353_10246159 3300010167 Unclassified 2774
135 Ga0466707_047718 3300042601 Bacteria 1599
136 Ga0466716_226225 3300042605 Bacteria 19357
137 Ga0466657_078148 3300042582 Bacteria 6762

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_364137 Ga0466694_364137_21_656 211
2 3300042620 Ga0466728_228057 Ga0466728_228057_4915_5568 217
3 3300042636 Ga0466703_075843 Ga0466703_075843_3014_3667 217
4 3300042604 Ga0466717_282481 Ga0466717_282481_398_1060 220
5 2225789003 2227008147 2227365289 221
6 2225789004 2227303015 2227753304 221
7 2225789004 2227466301 2227905596 221
8 3300010049 Ga0123356_10844438 Ga0123356_108444382 221
9 3300010049 Ga0123356_10865816 Ga0123356_108658162 221
10 3300042590 Ga0466690_086675 Ga0466690_086675_16348_17013 221
11 3300042591 Ga0466692_005818 Ga0466692_005818_45081_45746 221
12 3300042591 Ga0466692_149579 Ga0466692_149579_75013_75678 221
13 3300042593 Ga0466691_042241 Ga0466691_042241_2857_3522 221
14 3300042593 Ga0466691_042749 Ga0466691_042749_5502_6167 221
15 3300042596 Ga0466696_069317 Ga0466696_069317_9883_10548 221
16 3300042596 Ga0466696_368253 Ga0466696_368253_1943_2608 221
17 3300042598 Ga0466701_033084 Ga0466701_033084_7025_7690 221
18 3300042598 Ga0466701_081600 Ga0466701_081600_3434_4099 221
19 3300042599 Ga0466706_097294 Ga0466706_097294_4345_5010 221
20 3300042599 Ga0466706_106819 Ga0466706_106819_14416_15081 221
21 3300042599 Ga0466706_207157 Ga0466706_207157_420_1085 221
22 3300042599 Ga0466706_222667 Ga0466706_222667_3442_4107 221
23 3300042601 Ga0466707_047718 Ga0466707_047718_506_1171 221
24 3300042601 Ga0466707_058300 Ga0466707_058300_16_681 221
25 3300042601 Ga0466707_078559 Ga0466707_078559_8324_8989 221
26 3300042601 Ga0466707_219787 Ga0466707_219787_3019_3684 221
27 3300042601 Ga0466707_351627 Ga0466707_351627_4653_5318 221
28 3300042605 Ga0466716_226225 Ga0466716_226225_13384_14049 221
29 3300042606 Ga0466719_218399 Ga0466719_218399_164_829 221
30 3300042606 Ga0466719_388947 Ga0466719_388947_1665_2330 221
31 3300042612 Ga0466705_119745 Ga0466705_119745_16518_17183 221
32 3300042612 Ga0466705_180601 Ga0466705_180601_1382_2047 221
33 3300042612 Ga0466705_334520 Ga0466705_334520_1841_2506 221
34 3300042612 Ga0466705_346162 Ga0466705_346162_5011_5676 221
35 3300042615 Ga0466711_017768 Ga0466711_017768_4988_5653 221
36 3300042615 Ga0466711_089286 Ga0466711_089286_1952_2617 221
37 3300042615 Ga0466711_092050 Ga0466711_092050_24509_25174 221
38 3300042615 Ga0466711_128742 Ga0466711_128742_335_1000 221
39 3300042615 Ga0466711_130521 Ga0466711_130521_15969_16634 221
40 3300042615 Ga0466711_180904 Ga0466711_180904_7523_8188 221
41 3300042615 Ga0466711_233629 Ga0466711_233629_1576_2241 221
42 3300042615 Ga0466711_309338 Ga0466711_309338_806_1471 221
43 3300042615 Ga0466711_376535 Ga0466711_376535_69_734 221
44 3300042618 Ga0466723_016493 Ga0466723_016493_7015_7680 221
45 3300042619 Ga0466726_040474 Ga0466726_040474_3163_3828 221
46 3300042619 Ga0466726_186909 Ga0466726_186909_613_1278 221
47 3300042619 Ga0466726_195635 Ga0466726_195635_87_752 221
48 3300042619 Ga0466726_302114 Ga0466726_302114_442_1107 221
49 3300042619 Ga0466726_363206 Ga0466726_363206_1584_2249 221
50 3300042620 Ga0466728_052165 Ga0466728_052165_8142_8807 221
51 3300042621 Ga0466729_011082 Ga0466729_011082_4925_5590 221
52 3300042621 Ga0466729_033027 Ga0466729_033027_9539_10204 221
53 3300042621 Ga0466729_199094 Ga0466729_199094_782_1447 221
54 3300042621 Ga0466729_232625 Ga0466729_232625_4577_5242 221
55 3300042622 Ga0466731_139217 Ga0466731_139217_228_893 221
56 3300042624 Ga0466735_159902 Ga0466735_159902_1559_2224 221
57 3300042636 Ga0466703_125567 Ga0466703_125567_5914_6579 221
58 3300042636 Ga0466703_303147 Ga0466703_303147_1039_1704 221
59 3300042643 Ga0466704_088764 Ga0466704_088764_33526_34191 221
60 3300042643 Ga0466704_090031 Ga0466704_090031_16_681 221
61 3300042643 Ga0466704_091217 Ga0466704_091217_4103_4768 221
62 3300042643 Ga0466704_149441 Ga0466704_149441_7526_8191 221
63 3300042643 Ga0466704_377608 Ga0466704_377608_673_1338 221
64 3300042643 Ga0466704_443184 Ga0466704_443184_2976_3641 221
65 3300042643 Ga0466704_570593 Ga0466704_570593_440_1105 221
66 3300042648 Ga0466709_262467 Ga0466709_262467_1353_2018 221
67 3300042648 Ga0466709_400885 Ga0466709_400885_2819_3484 221
68 3300042652 Ga0466708_275929 Ga0466708_275929_15180_15845 221
69 3300042655 Ga0466727_002343 Ga0466727_002343_1439_2104 221
70 3300042655 Ga0466727_042357 Ga0466727_042357_5507_6172 221
71 3300042655 Ga0466727_132978 Ga0466727_132978_3004_3669 221
72 3300042655 Ga0466727_136124 Ga0466727_136124_4360_5025 221
73 3300042655 Ga0466727_237063 Ga0466727_237063_360_1025 221
74 3300042659 Ga0466733_101223 Ga0466733_101223_38232_38897 221
75 3300042659 Ga0466733_115414 Ga0466733_115414_19401_20066 221
76 3300042659 Ga0466733_118149 Ga0466733_118149_5870_6535 221
77 iso_pr_bacteria 2923982719 2923983422 221
78 iso_pr_bacteria 2940195863 2940196614 221
79 iso_pr_bacteria 2940199050 2940200547 221
80 iso_pr_bacteria 2940202316 2940204021 221
81 iso_pr_bacteria 2940205530 2940207914 221
82 iso_pr_bacteria 2940209341 2940211442 221
83 iso_pr_bacteria 2940212447 2940214829 221
84 iso_pr_bacteria 2940298504 2940300883 221
85 iso_pr_bacteria 2940302308 2940304685 221
86 iso_pr_bacteria 2940306115 2940308308 221
87 iso_pr_bacteria 2940309933 2940312148 221
88 iso_pr_bacteria 2940313741 2940315898 221
89 iso_pr_bacteria 2940317558 2940319776 221
90 iso_pr_bacteria 2940321370 2940323319 221
91 iso_pr_bacteria 2940325180 2940327616 221
92 iso_pr_bacteria 2940328985 2940331421 221
93 iso_pr_bacteria 2940332795 2940334950 221
94 iso_pr_bacteria 2940346213 2940348971 221
95 iso_pr_bacteria 2940371297 2940371352 221
96 iso_pr_bacteria 3004667792 3004668911 221
97 iso_pr_bacteria 3004672520 3004677252 221
98 iso_pr_bacteria 3004677695 3004679949 221
99 2225789004 2227275262 2227726280 222
100 3300000062 IMNBL1DRAFT_c0005146 IMNBL1DRAFT_00051463 222
101 3300000062 IMNBL1DRAFT_c0029342 IMNBL1DRAFT_00293422 222
102 3300002462 JGI24702J35022_10007072 JGI24702J35022_100070724 222
103 3300002462 JGI24702J35022_10014375 JGI24702J35022_100143754 222
104 3300002834 JGI24696J40584_12847856 JGI24696J40584_128478562 222
105 3300005071 Ga0068302_10075093 Ga0068302_100750932 222
106 3300005083 Ga0068305_10000798 Ga0068305_1000079814 222
107 3300010167 Ga0123353_10246159 Ga0123353_102461592 222
108 3300010882 Ga0123354_10148444 Ga0123354_101484442 222
109 3300042582 Ga0466657_078148 Ga0466657_078148_5869_6537 222
110 3300042596 Ga0466696_281419 Ga0466696_281419_15021_15689 222
111 3300042596 Ga0466696_394022 Ga0466696_394022_117394_118062 222
112 3300042600 Ga0466700_124418 Ga0466700_124418_7658_8326 222
113 3300042602 Ga0466713_102098 Ga0466713_102098_32793_33461 222
114 3300042602 Ga0466713_139646 Ga0466713_139646_22364_23032 222
115 3300042610 Ga0466698_325518 Ga0466698_325518_727_1395 222
116 3300042611 Ga0466697_056567 Ga0466697_056567_47304_47972 222
117 3300042611 Ga0466697_095834 Ga0466697_095834_434_1102 222
118 3300042612 Ga0466705_316947 Ga0466705_316947_6796_7464 222
119 3300042616 Ga0466715_422122 Ga0466715_422122_2833_3501 222
120 3300042616 Ga0466715_513291 Ga0466715_513291_14776_15444 222
121 3300042620 Ga0466728_175052 Ga0466728_175052_948_1616 222
122 3300042636 Ga0466703_225493 Ga0466703_225493_89_757 222
123 3300042643 Ga0466704_354080 Ga0466704_354080_697_1365 222
124 3300042648 Ga0466709_047096 Ga0466709_047096_141999_142667 222
125 3300042648 Ga0466709_255031 Ga0466709_255031_1318_1986 222
126 3300042654 Ga0466725_426273 Ga0466725_426273_1560_2228 222
127 3300042655 Ga0466727_196859 Ga0466727_196859_1321_1989 222
128 3300042659 Ga0466733_038409 Ga0466733_038409_227_895 222
129 3300042659 Ga0466733_092492 Ga0466733_092492_7248_7916 222
130 3300042659 Ga0466733_155136 Ga0466733_155136_12921_13589 222
131 3300042659 Ga0466733_216697 Ga0466733_216697_144034_144702 222
132 iso_pr_bacteria 2820759988 2820761234 222
133 iso_pr_bacteria 2820762746 2820764740 222
134 iso_pr_bacteria 2910926975 2910928027 222
135 iso_pr_bacteria 2940195863 2940198678 222
136 iso_pr_bacteria 2940199050 2940200751 222
137 iso_pr_bacteria 2940202316 2940204159 222
138 iso_pr_bacteria 2940209341 2940211290 222
139 iso_pr_bacteria 3004667792 3004669833 222
140 iso_pr_bacteria 3004672520 3004674846 222
141 iso_pr_bacteria 3004677695 3004678886 222
142 iso_pr_bacteria 8100166142 8100167355 222
143 3300000062 IMNBL1DRAFT_c0002489 IMNBL1DRAFT_00024898 223
144 3300000062 IMNBL1DRAFT_c0003711 IMNBL1DRAFT_00037113 223
145 3300000062 IMNBL1DRAFT_c0018301 IMNBL1DRAFT_00183012 223
146 3300002509 JGI24699J35502_11133920 JGI24699J35502_111339202 223
147 3300002509 JGI24699J35502_11134195 JGI24699J35502_1113419539 223
148 3300002509 JGI24699J35502_11134201 JGI24699J35502_1113420147 223
149 3300005083 Ga0068305_10008764 Ga0068305_100087642 223
150 3300009784 Ga0123357_10001792 Ga0123357_1000179210 223
151 3300009784 Ga0123357_10094686 Ga0123357_100946864 223
152 3300010882 Ga0123354_10004434 Ga0123354_100044344 223
153 iso_pr_bacteria 2910942425 2910943999 223
154 3300042596 Ga0466696_019214 Ga0466696_019214_899_1573 224
155 3300042599 Ga0466706_045905 Ga0466706_045905_1399_2073 224
156 3300042599 Ga0466706_052927 Ga0466706_052927_1335_2009 224
157 3300042605 Ga0466716_274265 Ga0466716_274265_9666_10340 224
158 3300042582 Ga0466657_323072 Ga0466657_323072_57_734 225
159 3300042602 Ga0466713_137234 Ga0466713_137234_8617_9294 225
160 3300042613 Ga0466710_150335 Ga0466710_150335_82_759 225
161 3300042613 Ga0466710_255321 Ga0466710_255321_828_1505 225
162 3300042624 Ga0466735_196657 Ga0466735_196657_220_969 225
163 3300042609 Ga0466722_014428 Ga0466722_014428_2848_3528 226
164 3300042602 Ga0466713_038764 Ga0466713_038764_5973_6656 227
165 3300042609 Ga0466722_174102 Ga0466722_174102_683_1366 227
166 3300005083 Ga0068305_10074349 Ga0068305_100743498 228
167 3300042596 Ga0466696_304714 Ga0466696_304714_1000_1689 229
168 3300042619 Ga0466726_062025 Ga0466726_062025_9055_9747 230
169 3300042609 Ga0466722_031675 Ga0466722_031675_3205_3903 232
170 3300042622 Ga0466731_227089 Ga0466731_227089_608_1342 244
171 3300042616 Ga0466715_115457 Ga0466715_115457_12480_13244 254

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 23 170 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.93 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.