Protein Family IF03506

Metagenome Isolate
230 Members
141 Samples
158 Scaffolds
253.06 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10102567|Ga0123354_101025675
Length
292 aa
Sequence
MSADQPTAPEAAMVTIENLHKSFDNLEVLKGVSLQVGQGDVLCIIGPSGSGKSTLLRCLNQLETPTSGDVWVNGTKLTDPDVDIDAVRAHMGMVFQSFNLFPHLNARQNCMLGQTSVLKRSPADAKQIAEANLVKVGLFDRMDYFPGQLSGGQQQRVAIARALSMDPLLMLFDEPTSALDPELVGDVLSVMRQLADDGMTMIVVTHEMAFARDVADRVIFMDDGLIVEEGPPSQVISAPHEERTQVFLQRVLDPTHVREIGELEPDGVVPSWMSGRSGAPASPGLSDRPRP*

📊 Sample Types

Isolate 31.3%
Metagenome 68.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 19.7%
Termitidae 15.9%
Kalotermitidae 9.1%
Formicidae 7.6%
Apidae 5.3%
Blattidae 5.3%
Pyralidae 4.5%
Curculionidae 3.8%
Scarabaeidae 3.0%
Tenebrionidae 3.0%
Drosophilidae 3.0%
Rhinotermitidae 2.3%
Noctuidae 1.5%
Pentatomidae 1.5%
Culicidae 1.5%
Elmidae 1.5%
Bombycidae 1.5%
Passalidae 1.5%
Hodotermitidae 0.8%
Cerambycidae 0.8%
Eresidae 0.8%
Coreidae 0.8%
Anthocoridae 0.8%
Termopsidae 0.8%
Armadillidiidae 0.8%
Ocypodidae 0.8%
Pyrrhocoridae 0.8%
Siricidae 0.8%
Portunidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 212
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
2 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
3 2684622921 Frischella perrara Fp_167 Isolate Unclassified
4 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
5 2833532623 Frischella perrara ESL0167 Isolate Apidae
6 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
7 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
8 2940419646 Paenibacillus sp. PastF-4 Isolate Blattidae
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
17 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
18 3300002934 Ant worker gut metagenome for colony PL005 Metagenome Formicidae
19 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
20 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
21 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
26 2189573031 Gamma-1 phylotype from Apis mellifera gut collected at the Carl Hayden Bee Research Center, Tucson, AZ. Metagenome Apidae
27 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
28 2588253732 Klebsiella pneumoniae pneumoniae KP5-1 Isolate Pentatomidae
29 2820332331 Unclassified Firmicutes Nt197P3bin75 Isolate Unclassified
30 2821314491 Unclassified Actinobacteria Lab288P4bin49 Isolate Unclassified
31 2840797934 Gilliamella apicola Choc5-1 Isolate Apidae
32 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
33 2940221333 Paenibacillus sp. PastF-3 Isolate Blattidae
34 2940425923 Paenibacillus sp. PastH-4 Isolate Blattidae
35 8022725327 Bacillus sp. SN10 Isolate Eresidae
36 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
37 8102087471 Caballeronia sp. GAWG2-1 Isolate Coreidae
38 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
39 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
40 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
41 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
42 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
43 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
44 2593339125 Clostridium sp. 5 Isolate Termitidae
45 2820829137 Unclassified Actinobacteria Nc150P5bin2 Isolate Unclassified
46 2820939604 Unclassified Actinobacteria Emb289P1bin4 Isolate Unclassified
47 2835335304 Rahnella sp. Larv3_ips Isolate Curculionidae
48 2898991528 Erwinia sp. OLMDLW33 Isolate Anthocoridae
49 2940393498 Paenibacillus sp. PastF-2 Isolate Blattidae
50 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
51 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
52 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
53 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
54 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
55 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
56 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
57 3300007103 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 4 gut Metagenome Drosophilidae
58 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
59 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
60 2820157249 Unclassified Proteobacteria Cu122P4bin11 Isolate Unclassified
61 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
62 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
63 2864937364 Acidovorax soli S00198 Isolate Elmidae
64 2878462549 Gilliamella apicola Occ3-1 Isolate Apidae
65 2940406939 Paenibacillus sp. PastM-3 Isolate Blattidae
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
68 8012112996 Staphylococcus muscae ATCC 49910 Isolate
69 8102982778 Erwinia sp. S63 Isolate Curculionidae
70 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
71 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
72 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
73 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
74 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
75 2978778678 Bacillus cereus 25 Isolate Ocypodidae
76 3300007130 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut Metagenome Drosophilidae
77 8112490586 Staphylococcus muscae CCM 4175 Isolate
78 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
79 2537562000 Bacillus cereus HD73 Isolate Pyralidae
80 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
81 2603880170 Burkholderiales A2 Isolate Unclassified
82 2756170266 Frischella perrara DSM 104328 Isolate Unclassified
83 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
84 2820899690 Unclassified Actinobacteria Emb289P4bin9 Isolate Unclassified
85 2846386538 Rahnella sp. AN3-3W3 Isolate Pentatomidae
86 2917496769 Staphylococcus muscae DSM 7068 Isolate Unclassified
87 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
88 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
89 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
90 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
91 2990166910 Pseudomonas typographi CA3A Isolate Curculionidae
92 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
93 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
94 3300007505 Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut Metagenome Drosophilidae
95 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
96 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
97 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
98 2590828840 Clostridium sp. 2 Isolate Termitidae
99 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
100 2940400224 Paenibacillus sp. PastM-2 Isolate Blattidae
101 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
102 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
103 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
104 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
105 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
106 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
107 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
108 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
109 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
110 2100351016 Sirex noctilio microbial communities from Pennsylvania, USA - adult community Metagenome Siricidae
111 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
112 2515154034 Frischella perrara PEB0191 Isolate Apidae
113 2630968947 Frischella perrara PEB0191 Isolate Apidae
114 2681813507 Insolitispirillum peregrinum integrum DSM 11589 Isolate Unclassified
115 2687453742 Burkholderiales bacterium B_Cag20 Isolate Unclassified
116 2756170277 Enterobacillus tribolii DSM 103736 Isolate Unclassified
117 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
118 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
119 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
120 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
121 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
122 2969145278 Bacillus cereus 29 Isolate Portunidae
123 3007994558 Escherichia alba B35 Isolate Tenebrionidae
124 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
125 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
126 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
127 2820880921 Unclassified Actinobacteria Lab288P1bin60 Isolate Unclassified
128 2820893114 Unclassified Actinobacteria Lab288P1bin125 Isolate Unclassified
129 2820934415 Unclassified Actinobacteria Emb289P1bin68 Isolate Unclassified
130 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
131 2940386776 Paenibacillus sp. PastF-1 Isolate Blattidae
132 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
133 8099192374 Erwinia typographi IC4 Isolate Curculionidae
134 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
135 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
136 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
137 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
138 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
139 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
140 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
141 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10062737 3300010049 Bacteria 3472
2 Ga0123354_10009018 3300010882 Bacteria 15233
3 Ga0466715_282557 3300042616 Bacteria 25426
4 Ga0466709_281782 3300042648 Unclassified 8722
5 Ga0160431_103417 3300012828 Bacteria 3277
6 Ga0160430_116707 3300012852 Bacteria 1082
7 Ga0466692_064291 3300042591 Bacteria 28606
8 Ga0466701_019529 3300042598 Bacteria 146632
9 Ga0466706_255419 3300042599 Bacteria 2921
10 Ga0466722_097367 3300042609 Bacteria 7864
11 IMNBL1DRAFT_c0036919 3300000062 Bacteria 1700
12 JGI24705J35276_12221753 3300002504 Bacteria 2365
13 Ga0072941_1082977 3300005201 Bacteria 16250
14 Ga0105005_1009394 3300007505 Unclassified 16054
15 Ga0123357_10062084 3300009784 Bacteria 5005
16 Ga0123357_10127685 3300009784 Bacteria 3179
17 Ga0123356_10170913 3300010049 Bacteria 2184
18 Ga0123356_10906796 3300010049 Bacteria 1053
19 Ga0123353_10001177 3300010167 Bacteria 31963
20 Ga0466715_247848 3300042616 Bacteria 37102
21 Ga0466734_165861 3300042623 Bacteria 18285
22 Ga0466735_059270 3300042624 Bacteria 1451
23 Ga0466724_34393 3300042649 Bacteria 82826
24 Ga0160453_106904 3300012814 Bacteria 1607
25 Ga0466701_005840 3300042598 Bacteria 1465
26 IMNBL1DRAFT_c0000019 3300000062 Bacteria 170255
27 CVPL010W_10001712 3300002931 Bacteria 26028
28 CVPL010W_10006038 3300002931 Bacteria 12634
29 Ga0074278_149775 3300005721 Bacteria 28572
30 Ga0466697_150587 3300042611 Bacteria 3485
31 Ga0466705_115761 3300042612 Bacteria 15581
32 Ga0466733_201987 3300042659 Bacteria 2520
33 Ga0123355_10211273 3300009826 Bacteria 2812
34 Ga0123356_10224060 3300010049 Bacteria 1939
35 Ga0123353_10089522 3300010167 Bacteria 4956
36 Ga0123353_11192455 3300010167 Bacteria 1000
37 Ga0123354_10327821 3300010882 Bacteria 1401
38 Ga0466711_121812 3300042615 Bacteria 1643
39 Ga0466715_399208 3300042616 Bacteria 2402
40 Ga0466695_370359 3300042595 Bacteria 11680
41 Ga0466701_041623 3300042598 Bacteria 24851
42 Ga0466707_051094 3300042601 Bacteria 2829
43 Ga0466707_188782 3300042601 Bacteria 19023
44 Ga0466707_232510 3300042601 Unclassified 4830
45 Ga0466714_038349 3300042603 Bacteria 6534
46 Ga0466714_052766 3300042603 Bacteria 1823
47 Ga0466720_040719 3300042607 Bacteria 10757
48 FGTW_contig00223 2065487013 Unclassified 20213
49 2227591312 2225789004 Bacteria 12864
50 JGI24705J35276_12208130 3300002504 Bacteria 1764
51 Ga0063521_1000879 3300003973 Bacteria 10141
52 Ga0104049_1004399 3300007103 Bacteria 1081
53 Ga0102734_1008961 3300007129 Bacteria 2295
54 Ga0123356_10172922 3300010049 Bacteria 2173
55 Ga0123356_10499069 3300010049 Bacteria 1373
56 Ga0123354_10292800 3300010882 Unclassified 1556
57 Ga0466715_060527 3300042616 Bacteria 60092
58 Ga0466715_483723 3300042616 Bacteria 20509
59 Ga0466724_35576 3300042649 Bacteria 195054
60 Ga0160446_100056 3300012835 Bacteria 117140
61 Ga0466692_198067 3300042591 Bacteria 1984
62 Ga0466691_098498 3300042593 Unclassified 1407
63 Ga0466713_024159 3300042602 Bacteria 12757
64 Ga0466714_124349 3300042603 Bacteria 7338
65 SWWA_contig31653__length_27474___numreads_1390 2100351016 Bacteria 27474
66 IMNBL1DRAFT_c0000883 3300000062 Bacteria 23389
67 Ga0063521_1000198 3300003973 Bacteria 43640
68 Ga0063521_1001566 3300003973 Unclassified 6078
69 Ga0068305_10001799 3300005083 Bacteria 51560
70 Ga0103261_1003891 3300007083 Unclassified 4170
71 Ga0104042_1130400 3300007130 Unclassified 993
72 Ga0103264_1000277 3300007188 Bacteria 39968
73 Ga0103264_1000454 3300007188 Bacteria 21532
74 Ga0123357_10002876 3300009784 Bacteria 19414
75 Ga0562379_0013 3300056790 Bacteria 1548004
76 Ga0562379_1315 3300056790 Bacteria 29549
77 Ga0562377_0281 3300056842 Bacteria 109788
78 Ga0123357_10179115 3300009784 Bacteria 2481
79 Ga0123357_10518389 3300009784 Bacteria 976
80 Ga0123355_10000027 3300009826 Bacteria 144961
81 Ga0123353_10598219 3300010167 Bacteria 1577
82 Ga0466705_448079 3300042612 Bacteria 7723
83 Ga0466729_093415 3300042621 Bacteria 1968
84 Ga0466730_087517 3300042625 Bacteria 3381
85 Ga0466709_314127 3300042648 Bacteria 22341
86 Ga0264413_106800 3300024493 Bacteria 8688
87 Ga0466713_045251 3300042602 Bacteria 1567
88 Ga0466716_264385 3300042605 Bacteria 4624
89 CVPL010W_10003672 3300002931 Unclassified 17512
90 Ga0063521_1000041 3300003973 Bacteria 111439
91 Ga0104041_1000226 3300007106 Bacteria 4873
92 Ga0102737_1000401 3300007142 Unclassified 14620
93 Ga0123357_10001398 3300009784 Bacteria 25552
94 Ga0123357_10109615 3300009784 Bacteria 3526
95 Ga0466705_531714 3300042612 Bacteria 1076
96 Ga0466711_296921 3300042615 Bacteria 6131
97 Ga0466711_459916 3300042615 Bacteria 4877
98 Ga0466723_286481 3300042618 Bacteria 2525
99 Ga0466729_074553 3300042621 Bacteria 3711
100 Ga0466703_394453 3300042636 Bacteria 58488
101 Ga0466709_270450 3300042648 Bacteria 23228
102 Ga0466708_290418 3300042652 Bacteria 41998
103 Ga0466692_128374 3300042591 Bacteria 5282
104 Ga0466706_114758 3300042599 Bacteria 2808
105 Ga0466707_307703 3300042601 Unclassified 5191
106 Ga0466707_358935 3300042601 Bacteria 1812
107 Ga0466713_008877 3300042602 Bacteria 23396
108 2227520475 2225789004 Bacteria 3351
109 Ga0072941_1000238 3300005201 Bacteria 99795
110 Ga0104049_1134337 3300007103 Unclassified 1316
111 Ga0102740_1009717 3300007140 Bacteria 1544
112 Ga0103264_1000056 3300007188 Bacteria 65902
113 Ga0103264_1006678 3300007188 Bacteria 6795
114 Ga0123357_10001578 3300009784 Bacteria 24355
115 Ga0123357_10002831 3300009784 Bacteria 19575
116 Ga0466697_144897 3300042611 Bacteria 1833
117 Ga0562377_0291 3300056842 Bacteria 105987
118 Ga0562374_0201 3300057007 Unclassified 129306
119 Ga0123357_10019309 3300009784 Bacteria 9081
120 Ga0123355_10113091 3300009826 Bacteria 4235
121 Ga0123353_10997080 3300010167 Bacteria 1126
122 Ga0123354_10102567 3300010882 Bacteria 3855
123 Ga0466715_217695 3300042616 Bacteria 32243
124 Ga0466708_395980 3300042652 Bacteria 4762
125 Ga0160456_100117 3300012820 Bacteria 82446
126 Ga0466707_052291 3300042601 Bacteria 40320
127 Ga0466707_215693 3300042601 Bacteria 5520
128 Ga0466713_020587 3300042602 Bacteria 9070
129 Ga0466713_151904 3300042602 Unclassified 26033
130 Ga0466698_391013 3300042610 Bacteria 4021
131 gam1t_NODE_657739_length=28572_GC=34_2_Contigs=1 2189573031 Unclassified 28572
132 CVPL010W_10000679 3300002931 Bacteria 37404
133 CVPL005W_1000098 3300002934 Bacteria 34913
134 Ga0068305_10001080 3300005083 Unclassified 53401
135 Ga0102734_1000815 3300007129 Bacteria 17909
136 Ga0102737_1000034 3300007142 Bacteria 38785
137 Ga0103268_1003107 3300007192 Bacteria 3523
138 Ga0562377_0124 3300056842 Bacteria 238729
139 Ga0123357_10266328 3300009784 Bacteria 1800
140 Ga0123356_10005648 3300010049 Bacteria 12709
141 Ga0466715_092655 3300042616 Bacteria 7831
142 Ga0466730_036680 3300042625 Unclassified 1348
143 Ga0466703_053078 3300042636 Bacteria 1046
144 Ga0466704_027966 3300042643 Bacteria 9993
145 Ga0466704_243996 3300042643 Bacteria 1937
146 Ga0466690_094955 3300042590 Bacteria 2405
147 Ga0466692_130639 3300042591 Bacteria 1565
148 Ga0466694_045875 3300042594 Bacteria 5021
149 Ga0466706_122046 3300042599 Bacteria 228896
150 Ga0466707_191208 3300042601 Bacteria 2356
151 Ga0466707_268979 3300042601 Bacteria 22067
152 Ga0466707_312361 3300042601 Bacteria 5920
153 Ga0466713_113515 3300042602 Bacteria 7477
154 Ga0466719_123098 3300042606 Bacteria 142874
155 AglaG_contig00590 2084038013 Bacteria 30393
156 Ga0102736_1001371 3300007052 Bacteria 4858
157 Ga0103265_1003889 3300007068 Bacteria 2169
158 Ga0104041_1117456 3300007106 Bacteria 1197

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007142 Ga0102737_1000401 Ga0102737_10004016 211
2 3300007083 Ga0103261_1003891 Ga0103261_10038914 222
3 3300042625 Ga0466730_036680 Ga0466730_036680_616_1338 240
4 3300056790 Ga0562379_1315 Ga0562379_1315_5678_6400 240
5 3300056842 Ga0562377_0124 Ga0562377_0124_14222_14944 240
6 3300056842 Ga0562377_0281 Ga0562377_0281_67763_68485 240
7 3300056842 Ga0562377_0291 Ga0562377_0291_41141_41863 240
8 3300057007 Ga0562374_0201 Ga0562374_0201_108854_109576 240
9 iso_pr_bacteria 2537562000 2539438500 240
10 iso_pr_bacteria 2563367190 2565788103 240
11 iso_pr_bacteria 2822232166 2822234058 240
12 iso_pr_bacteria 2822450720 2822450947 240
13 iso_pr_bacteria 2864782175 2864787417 240
14 iso_pr_bacteria 2912849059 2912849314 240
15 iso_pr_bacteria 2916873227 2916877635 240
16 iso_pr_bacteria 2917496769 2917496872 240
17 iso_pr_bacteria 2969145278 2969147718 240
18 iso_pr_bacteria 2978778678 2978783579 240
19 iso_pr_bacteria 643886085 644677901 240
20 iso_pr_bacteria 643886087 644665703 240
21 iso_pr_bacteria 643886090 644659603 240
22 iso_pr_bacteria 643886091 644646547 240
23 iso_pr_bacteria 8012112996 8012113776 240
24 iso_pr_bacteria 8022725327 8022730898 240
25 iso_pr_bacteria 8022781829 8022782531 240
26 iso_pr_bacteria 8061039349 8061041832 240
27 iso_pr_bacteria 8061045771 8061048080 240
28 iso_pr_bacteria 8061100935 8061104037 240
29 iso_pr_bacteria 8112490586 8112492473 240
30 3300003973 Ga0063521_1000198 Ga0063521_10001986 241
31 3300042624 Ga0466735_059270 Ga0466735_059270_437_1192 241
32 iso_pr_bacteria 2590828840 2593257217 241
33 iso_pr_bacteria 2593339125 2595064972 241
34 iso_pr_bacteria 2529293168 2531451650 242
35 iso_pr_bacteria 2585428085 2587835383 242
36 3300012820 Ga0160456_100117 Ga0160456_10011766 243
37 3300042601 Ga0466707_268979 Ga0466707_268979_1939_2670 243
38 3300042606 Ga0466719_123098 Ga0466719_123098_83813_84544 243
39 3300042609 Ga0466722_097367 Ga0466722_097367_5468_6199 243
40 3300042616 Ga0466715_247848 Ga0466715_247848_17647_18378 243
41 3300042616 Ga0466715_282557 Ga0466715_282557_2005_2736 243
42 3300042616 Ga0466715_399208 Ga0466715_399208_1555_2367 243
43 3300010049 Ga0123356_10062737 Ga0123356_100627374 244
44 3300010167 Ga0123353_10598219 Ga0123353_105982192 244
45 3300012835 Ga0160446_100056 Ga0160446_10005684 244
46 3300042591 Ga0466692_064291 Ga0466692_064291_13035_13769 244
47 3300042591 Ga0466692_198067 Ga0466692_198067_744_1478 244
48 3300042594 Ga0466694_045875 Ga0466694_045875_2213_2986 244
49 3300042601 Ga0466707_052291 Ga0466707_052291_3371_4105 244
50 3300042601 Ga0466707_191208 Ga0466707_191208_970_1704 244
51 3300042601 Ga0466707_312361 Ga0466707_312361_4033_4767 244
52 3300042601 Ga0466707_358935 Ga0466707_358935_401_1135 244
53 3300042602 Ga0466713_113515 Ga0466713_113515_442_1176 244
54 3300042616 Ga0466715_060527 Ga0466715_060527_28700_29434 244
55 3300009784 Ga0123357_10518389 Ga0123357_105183891 245
56 3300012814 Ga0160453_106904 Ga0160453_1069042 245
57 3300012828 Ga0160431_103417 Ga0160431_1034174 245
58 3300012852 Ga0160430_116707 Ga0160430_1167072 245
59 3300042623 Ga0466734_165861 Ga0466734_165861_184_921 245
60 3300042659 Ga0466733_201987 Ga0466733_201987_736_1473 245
61 3300042591 Ga0466692_128374 Ga0466692_128374_411_1151 246
62 3300042595 Ga0466695_370359 Ga0466695_370359_5432_6172 246
63 3300042605 Ga0466716_264385 Ga0466716_264385_3858_4598 246
64 iso_pr_bacteria 2687453742 2689987734 246
65 iso_pr_bacteria 2820157249 2820158029 246
66 iso_pr_bacteria 2820573558 2820575501 246
67 iso_pr_bacteria 2820880921 2820881237 246
68 iso_pr_bacteria 2820934415 2820934889 246
69 iso_pr_bacteria 2820939604 2820940855 246
70 iso_pr_bacteria 2878462549 2878462597 246
71 iso_pr_bacteria 8067987626 8067987990 246
72 2225789004 2227520475 2228023298 247
73 3300000062 IMNBL1DRAFT_c0000883 IMNBL1DRAFT_000088322 247
74 3300000062 IMNBL1DRAFT_c0036919 IMNBL1DRAFT_00369192 247
75 3300007106 Ga0104041_1117456 Ga0104041_11174561 247
76 3300007188 Ga0103264_1000056 Ga0103264_100005639 247
77 3300009826 Ga0123355_10000027 Ga0123355_1000002714 247
78 3300009826 Ga0123355_10113091 Ga0123355_101130913 247
79 3300024493 Ga0264413_106800 Ga0264413_1068004 247
80 3300042598 Ga0466701_005840 Ga0466701_005840_509_1252 247
81 3300042601 Ga0466707_051094 Ga0466707_051094_350_1093 247
82 3300042611 Ga0466697_144897 Ga0466697_144897_441_1184 247
83 iso_pr_bacteria 2820856540 2820856636 247
84 3300010049 Ga0123356_10170913 Ga0123356_101709134 248
85 3300010167 Ga0123353_10001177 Ga0123353_100011778 248
86 3300042598 Ga0466701_019529 Ga0466701_019529_52219_52965 248
87 3300042615 Ga0466711_121812 Ga0466711_121812_194_940 248
88 iso_pr_bacteria 2820893114 2820894194 248
89 iso_pr_bacteria 2990166910 2990172295 248
90 3300010049 Ga0123356_10499069 Ga0123356_104990692 249
91 3300010049 Ga0123356_10906796 Ga0123356_109067961 249
92 iso_pr_bacteria 2603880170 2606027677 249
93 iso_pr_bacteria 2884613238 2884613820 249
94 2065487013 FGTW_contig00223 FGTW_02739190 250
95 3300002931 CVPL010W_10001712 CVPL010W_1000171223 250
96 3300005201 Ga0072941_1000238 Ga0072941_100023829 250
97 3300007140 Ga0102740_1009717 Ga0102740_10097172 250
98 3300042603 Ga0466714_052766 Ga0466714_052766_335_1087 250
99 3300042611 Ga0466697_150587 Ga0466697_150587_1799_2551 250
100 3300042612 Ga0466705_448079 Ga0466705_448079_2583_3335 250
101 3300042643 Ga0466704_027966 Ga0466704_027966_3599_4351 250
102 3300056790 Ga0562379_0013 Ga0562379_0013_1503772_1504524 250
103 iso_pr_bacteria 2551306396 2552920762 250
104 iso_pr_bacteria 2820332331 2820332521 250
105 iso_pr_bacteria 2835335304 2835338440 250
106 iso_pr_bacteria 2840797934 2840800120 250
107 iso_pr_bacteria 2846386538 2846387600 250
108 iso_pr_bacteria 2940221333 2940221910 250
109 iso_pr_bacteria 2940386776 2940392430 250
110 iso_pr_bacteria 2940393498 2940398028 250
111 iso_pr_bacteria 2940400224 2940404760 250
112 iso_pr_bacteria 2940406939 2940411144 250
113 iso_pr_bacteria 2940419646 2940421722 250
114 iso_pr_bacteria 2940425923 2940427988 250
115 iso_pr_bacteria 2983866074 2983867727 250
116 iso_pr_bacteria 3007994558 3007998463 250
117 3300003973 Ga0063521_1000879 Ga0063521_10008795 251
118 3300003973 Ga0063521_1001566 Ga0063521_10015665 251
119 3300010167 Ga0123353_10997080 Ga0123353_109970801 251
120 3300042599 Ga0466706_122046 Ga0466706_122046_15764_16519 251
121 2189573031 gam1t_NODE_657739_length=28572_GC=34_2_Contigs=1 gam1t_00020280 252
122 2225789004 2227591312 2228151173 252
123 3300009784 Ga0123357_10001398 Ga0123357_100013989 252
124 3300010049 Ga0123356_10224060 Ga0123356_102240602 252
125 3300010167 Ga0123353_11192455 Ga0123353_111924552 252
126 3300042621 Ga0466729_074553 Ga0466729_074553_1539_2297 252
127 iso_pr_bacteria 2515154034 2515298971 252
128 iso_pr_bacteria 2630968947 2633887390 252
129 iso_pr_bacteria 2684622921 2686091879 252
130 iso_pr_bacteria 2756170266 2756755293 252
131 iso_pr_bacteria 2833532623 2833534359 252
132 3300000062 IMNBL1DRAFT_c0000019 IMNBL1DRAFT_000001965 253
133 3300005721 Ga0074278_149775 Ga0074278_1497754 253
134 3300042599 Ga0466706_255419 Ga0466706_255419_860_1621 253
135 3300042601 Ga0466707_188782 Ga0466707_188782_14320_15081 253
136 3300042601 Ga0466707_307703 Ga0466707_307703_4275_5036 253
137 3300042602 Ga0466713_020587 Ga0466713_020587_5931_6692 253
138 3300042602 Ga0466713_151904 Ga0466713_151904_16188_16949 253
139 3300042603 Ga0466714_124349 Ga0466714_124349_1588_2349 253
140 3300042616 Ga0466715_483723 Ga0466715_483723_16278_17039 253
141 3300042648 Ga0466709_281782 Ga0466709_281782_6903_7664 253
142 iso_pr_bacteria 2756170277 2756796311 253
143 3300005083 Ga0068305_10001799 Ga0068305_100017997 254
144 3300042590 Ga0466690_094955 Ga0466690_094955_1065_1829 254
145 3300042601 Ga0466707_215693 Ga0466707_215693_891_1655 254
146 3300042601 Ga0466707_232510 Ga0466707_232510_3033_3797 254
147 3300042602 Ga0466713_008877 Ga0466713_008877_18268_19032 254
148 3300042602 Ga0466713_045251 Ga0466713_045251_126_890 254
149 3300042607 Ga0466720_040719 Ga0466720_040719_7787_8551 254
150 3300042616 Ga0466715_217695 Ga0466715_217695_26623_27387 254
151 3300042648 Ga0466709_314127 Ga0466709_314127_3999_4763 254
152 3300042652 Ga0466708_290418 Ga0466708_290418_15141_15905 254
153 3300005083 Ga0068305_10001080 Ga0068305_1000108023 255
154 3300005201 Ga0072941_1082977 Ga0072941_108297714 255
155 3300010049 Ga0123356_10005648 Ga0123356_1000564811 255
156 3300042612 Ga0466705_531714 Ga0466705_531714_57_824 255
157 3300042636 Ga0466703_053078 Ga0466703_053078_203_970 255
158 3300042649 Ga0466724_35576 Ga0466724_35576_84102_84869 255
159 iso_pr_bacteria 8102087471 8102094031 255
160 3300042625 Ga0466730_087517 Ga0466730_087517_2127_2897 256
161 3300042649 Ga0466724_34393 Ga0466724_34393_34028_34798 256
162 iso_pr_bacteria 2681813507 2684383857 256
163 3300042615 Ga0466711_459916 Ga0466711_459916_2408_3181 257
164 3300042616 Ga0466715_092655 Ga0466715_092655_4042_4815 257
165 3300007103 Ga0104049_1134337 Ga0104049_11343372 258
166 3300007106 Ga0104041_1000226 Ga0104041_10002266 258
167 3300007130 Ga0104042_1130400 Ga0104042_11304002 258
168 3300007505 Ga0105005_1009394 Ga0105005_100939416 258
169 3300042593 Ga0466691_098498 Ga0466691_098498_556_1374 258
170 3300042598 Ga0466701_041623 Ga0466701_041623_2868_3644 258
171 3300042615 Ga0466711_296921 Ga0466711_296921_2833_3609 258
172 3300042648 Ga0466709_270450 Ga0466709_270450_12597_13373 258
173 iso_pr_bacteria 2864937364 2864937790 258
174 2100351016 SWWA_contig31653__length_27474___numreads_1390 SWWA_01953220 259
175 2084038013 AglaG_contig00590 AglaG_06471810 260
176 3300007188 Ga0103264_1000454 Ga0103264_100045420 260
177 3300042599 Ga0466706_114758 Ga0466706_114758_1194_2054 260
178 iso_pr_bacteria 2898991528 2898995791 260
179 iso_pr_bacteria 8099192374 8099195302 260
180 3300002931 CVPL010W_10006038 CVPL010W_100060386 261
181 3300003973 Ga0063521_1000041 Ga0063521_1000041114 261
182 3300007129 Ga0102734_1008961 Ga0102734_10089613 261
183 3300007142 Ga0102737_1000034 Ga0102737_100003431 261
184 3300007188 Ga0103264_1006678 Ga0103264_10066785 261
185 3300042603 Ga0466714_038349 Ga0466714_038349_2979_3764 261
186 iso_pr_bacteria 2841168549 2841171783 261
187 3300009784 Ga0123357_10062084 Ga0123357_100620845 263
188 3300009784 Ga0123357_10266328 Ga0123357_102663282 263
189 3300042602 Ga0466713_024159 Ga0466713_024159_5651_6442 263
190 3300007052 Ga0102736_1001371 Ga0102736_10013712 264
191 3300007103 Ga0104049_1004399 Ga0104049_10043991 264
192 3300009784 Ga0123357_10127685 Ga0123357_101276854 264
193 3300009826 Ga0123355_10211273 Ga0123355_102112732 264
194 3300010049 Ga0123356_10172922 Ga0123356_101729224 264
195 iso_pr_bacteria 2588253732 2588528968 264
196 3300007129 Ga0102734_1000815 Ga0102734_100081514 265
197 3300010882 Ga0123354_10292800 Ga0123354_102928002 265
198 3300007188 Ga0103264_1000277 Ga0103264_100027724 266
199 iso_pr_bacteria 8102982778 8102985803 266
200 3300002931 CVPL010W_10000679 CVPL010W_1000067943 267
201 3300002931 CVPL010W_10003672 CVPL010W_1000367214 267
202 3300002934 CVPL005W_1000098 CVPL005W_10000985 267
203 3300007068 Ga0103265_1003889 Ga0103265_10038893 267
204 3300007192 Ga0103268_1003107 Ga0103268_10031073 267
205 3300042621 Ga0466729_093415 Ga0466729_093415_169_975 268
206 3300002504 JGI24705J35276_12221753 JGI24705J35276_122217532 271
207 3300009784 Ga0123357_10179115 Ga0123357_101791153 272
208 3300042618 Ga0466723_286481 Ga0466723_286481_245_1063 272
209 3300042636 Ga0466703_394453 Ga0466703_394453_13404_14222 272
210 3300042652 Ga0466708_395980 Ga0466708_395980_2640_3458 272
211 iso_pr_bacteria 2503538010 2503576283 272
212 3300009784 Ga0123357_10001578 Ga0123357_1000157819 273
213 3300009784 Ga0123357_10019309 Ga0123357_100193095 273
214 iso_pr_bacteria 2820829137 2820829318 273
215 3300010882 Ga0123354_10327821 Ga0123354_103278212 274
216 3300042591 Ga0466692_130639 Ga0466692_130639_98_922 274
217 3300010167 Ga0123353_10089522 Ga0123353_100895225 276
218 3300009784 Ga0123357_10109615 Ga0123357_101096152 277
219 3300042610 Ga0466698_391013 Ga0466698_391013_1263_2096 277
220 iso_pr_bacteria 2820899690 2820900413 277
221 iso_pr_bacteria 2820944107 2820945657 277
222 3300009784 Ga0123357_10002831 Ga0123357_100028316 279
223 3300002504 JGI24705J35276_12208130 JGI24705J35276_122081302 280
224 3300009784 Ga0123357_10002876 Ga0123357_1000287615 281
225 iso_pr_bacteria 2820909719 2820910707 281
226 iso_pr_bacteria 2821314491 2821315098 281
227 3300010882 Ga0123354_10009018 Ga0123354_100090182 282
228 3300042612 Ga0466705_115761 Ga0466705_115761_7946_8797 283
229 3300042643 Ga0466704_243996 Ga0466704_243996_812_1675 287
230 3300010882 Ga0123354_10102567 Ga0123354_101025675 292

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 29 177 0.94
PF03215 Rad17 Rad17 P-loop domain 27 98 0.78

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.