Protein Family IF03499

Metagenome Isolate
138 Members
57 Samples
117 Scaffolds
383.22 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10082567|Ga0123354_100825673
Length
455 aa
Sequence
MDTSKIREKFKSLYGTTGSVYTSPGRVNLIGEHTDYNGGFVLPGAIDKAMYCEIKPNGTNKVRAFALDLGESAEFGLEEADKPAQQWARYIFGVCREMAKRGKQVGGFDTVFAGDVPLGAGMSSSAALESCFGFALDDLFNLGLERFEIALIGQSTEHNYVGVMCGIMDQFASCCGKEGHLMRLDCRSLEFEYVPFNPKGYRLVLINTCVTHNLAGGEYNKRRLSCERVVAAIAKRHPEVKLLRDANMAMLAEVKGEVDAVDYMRAEFVVEEIQRLLDACAAMEKDDYETVGRLMYGTHHGLSKLYEVSCPELDFLNDMAKECGVTGSRIMGGGFGGCTINLVKNELYDSFVKKATEAYKAKFGIDAKVYDVVIKDGARKAGVKPRLSTTARTSITGFYRRCHTRYRRRPPRXSPVRLFGSCFYSCHRSRKSAFYQPESRIWRNSSHGDDSLTD*

📊 Sample Types

Isolate 15.2%
Metagenome 84.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 25.0%
Kalotermitidae 23.2%
Unclassified 14.3%
Blattidae 14.3%
Rhinotermitidae 8.9%
Termopsidae 5.4%
Hydrophilidae 3.6%
Passalidae 3.6%
Tenebrionidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
15 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
16 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
17 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
20 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
21 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
29 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
30 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
31 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
32 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
37 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
38 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
39 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
40 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
41 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
42 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
43 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
44 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
50 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
51 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
54 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
55 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
56 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
57 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_259821 3300042616 Bacteria 31019
2 Ga0466723_312424 3300042618 Bacteria 3940
3 Ga0466726_385773 3300042619 Bacteria 1786
4 Ga0466691_093787 3300042593 Bacteria 5766
5 Ga0466696_007849 3300042596 Bacteria 54852
6 Ga0123353_10000136 3300010167 Bacteria 89026
7 Ga0466735_100916 3300042624 Bacteria 3924
8 Ga0466704_140628 3300042643 Bacteria 15835
9 Ga0466704_480030 3300042643 Bacteria 3946
10 Ga0466709_021217 3300042648 Bacteria 24774
11 Ga0466700_016544 3300042600 Bacteria 2573
12 Ga0466707_065776 3300042601 Bacteria 7239
13 Ga0466713_059661 3300042602 Bacteria 2390
14 Ga0466719_446548 3300042606 Bacteria 6852
15 Ga0466722_222202 3300042609 Bacteria 7709
16 2227467976 2225789004 Bacteria 5038
17 IMNBL1DRAFT_c0003167 3300000062 Bacteria 10790
18 JGI24705J35276_12221232 3300002504 Bacteria 2325
19 Ga0466711_216976 3300042615 Bacteria 6568
20 Ga0466715_181089 3300042616 Bacteria 15777
21 Ga0466715_614043 3300042616 Bacteria 10897
22 Ga0466726_010377 3300042619 Bacteria 10573
23 Ga0466729_144058 3300042621 Bacteria 4770
24 Ga0466729_151578 3300042621 Bacteria 2246
25 Ga0466692_089422 3300042591 Bacteria 4833
26 Ga0123354_10082567 3300010882 Bacteria 4528
27 Ga0466735_205490 3300042624 Bacteria 2181
28 Ga0466709_134637 3300042648 Bacteria 19759
29 Ga0466707_194468 3300042601 Bacteria 43259
30 Ga0466714_074216 3300042603 Bacteria 22640
31 Ga0466722_034718 3300042609 Bacteria 7523
32 IMNBL1DRAFT_c0008823 3300000062 Bacteria 5079
33 Ga0072941_1145795 3300005201 Bacteria 3745
34 Ga0466723_291184 3300042618 Bacteria 3301
35 Ga0466692_146630 3300042591 Bacteria 10066
36 Ga0123354_10010376 3300010882 Bacteria 14348
37 Ga0466729_314346 3300042621 Bacteria 10888
38 Ga0466735_033158 3300042624 Bacteria 16684
39 Ga0466730_036402 3300042625 Unclassified 2930
40 Ga0466703_107147 3300042636 Bacteria 8237
41 Ga0466713_051288 3300042602 Bacteria 230715
42 Ga0466713_111128 3300042602 Bacteria 15728
43 Ga0466716_266440 3300042605 Bacteria 20602
44 Ga0123357_10002011 3300009784 Bacteria 22277
45 Ga0466697_084284 3300042611 Bacteria 2508
46 Ga0466733_171717 3300042659 Bacteria 27734
47 Ga0562377_0004 3300056842 Bacteria 3525959
48 Ga0466692_118934 3300042591 Unclassified 3598
49 Ga0123353_10392226 3300010167 Bacteria 2071
50 Ga0466735_067715 3300042624 Bacteria 9180
51 Ga0466735_174903 3300042624 Bacteria 2934
52 Ga0466727_166040 3300042655 Bacteria 4754
53 Ga0466701_058955 3300042598 Bacteria 26869
54 Ga0466707_257015 3300042601 Bacteria 9430
55 Ga0466713_002197 3300042602 Bacteria 31090
56 Ga0466713_076063 3300042602 Bacteria 37576
57 IMNBL1DRAFT_c0000149 3300000062 Bacteria 62726
58 Ga0466697_260334 3300042611 Bacteria 2658
59 Ga0466733_183783 3300042659 Bacteria 3194
60 Ga0466715_212551 3300042616 Bacteria 9142
61 Ga0123354_10085693 3300010882 Unclassified 4411
62 Ga0123354_10196106 3300010882 Bacteria 2240
63 Ga0466735_029550 3300042624 Bacteria 5603
64 Ga0466709_054618 3300042648 Bacteria 102226
65 Ga0466727_096280 3300042655 Bacteria 1428
66 Ga0466707_087386 3300042601 Bacteria 25499
67 Ga0466713_139646 3300042602 Bacteria 516516
68 Ga0466714_073873 3300042603 Bacteria 17431
69 JGI24699J35502_11134018 3300002509 Bacteria 24446
70 Ga0466733_018359 3300042659 Bacteria 2095
71 Ga0466705_421295 3300042612 Bacteria 2108
72 Ga0466711_341966 3300042615 Bacteria 7398
73 Ga0466729_175447 3300042621 Bacteria 4603
74 Ga0466692_116573 3300042591 Bacteria 8922
75 Ga0466691_224364 3300042593 Bacteria 31650
76 Ga0466696_258760 3300042596 Bacteria 39981
77 Ga0466696_373365 3300042596 Bacteria 17016
78 Ga0123357_10015185 3300009784 Bacteria 10091
79 Ga0123357_10017659 3300009784 Bacteria 9452
80 Ga0123353_10029439 3300010167 Bacteria 8463
81 Ga0123354_10034204 3300010882 Bacteria 7948
82 Ga0123354_10045502 3300010882 Bacteria 6716
83 Ga0466735_059305 3300042624 Bacteria 1413
84 Ga0466704_089150 3300042643 Bacteria 4526
85 Ga0466713_045750 3300042602 Bacteria 35229
86 IMNBL1DRAFT_c0009871 3300000062 Bacteria 4652
87 Ga0123357_10000306 3300009784 Bacteria 46839
88 Ga0466705_404818 3300042612 Unclassified 11904
89 Ga0466705_459208 3300042612 Bacteria 9399
90 Ga0466711_133227 3300042615 Bacteria 7042
91 Ga0466715_107845 3300042616 Bacteria 5404
92 Ga0466715_379015 3300042616 Bacteria 16425
93 Ga0466726_011452 3300042619 Bacteria 4477
94 Ga0466728_106796 3300042620 Bacteria 2225
95 Ga0466729_104723 3300042621 Bacteria 11891
96 Ga0123353_10819900 3300010167 Bacteria 1281
97 Ga0466704_078634 3300042643 Bacteria 22178
98 Ga0466708_221268 3300042652 Bacteria 13982
99 Ga0466727_232178 3300042655 Bacteria 2869
100 Ga0466707_018222 3300042601 Bacteria 3994
101 Ga0466719_337418 3300042606 Bacteria 2101
102 Ga0466733_124159 3300042659 Bacteria 5740
103 Ga0466710_400293 3300042613 Bacteria 1378
104 Ga0466711_007864 3300042615 Bacteria 9144
105 Ga0466711_115858 3300042615 Bacteria 7719
106 Ga0466711_202921 3300042615 Bacteria 7533
107 Ga0466723_018599 3300042618 Bacteria 4253
108 Ga0123356_10200050 3300010049 Bacteria 2037
109 Ga0466735_133959 3300042624 Bacteria 1352
110 Ga0466735_199111 3300042624 Bacteria 2522
111 Ga0466735_203414 3300042624 Bacteria 4690
112 Ga0466707_022169 3300042601 Bacteria 38620
113 Ga0466707_194051 3300042601 Bacteria 6556
114 Ga0466713_101790 3300042602 Bacteria 7501
115 Ga0466719_382906 3300042606 Bacteria 2587
116 Ga0466698_138024 3300042610 Bacteria 1726
117 Ga0072941_1033930 3300005201 Bacteria 1539

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 8100157865 8100158911 365
2 3300042603 Ga0466714_073873 Ga0466714_073873_359_1483 374
3 3300042603 Ga0466714_074216 Ga0466714_074216_19854_20981 375
4 3300042618 Ga0466723_312424 Ga0466723_312424_1087_2232 376
5 3300042655 Ga0466727_096280 Ga0466727_096280_85_1221 378
6 3300042655 Ga0466727_232178 Ga0466727_232178_300_1436 378
7 3300009784 Ga0123357_10000306 Ga0123357_1000030613 380
8 3300042601 Ga0466707_022169 Ga0466707_022169_8882_10024 380
9 3300042601 Ga0466707_065776 Ga0466707_065776_2531_3673 380
10 3300042616 Ga0466715_614043 Ga0466715_614043_2645_3787 380
11 3300042648 Ga0466709_054618 Ga0466709_054618_92289_93431 380
12 iso_pr_bacteria 2695420317 2695484693 380
13 iso_pr_bacteria 2695420317 2695484747 380
14 iso_pr_bacteria 2873600114 2873602234 380
15 iso_pr_bacteria 2873610414 2873612599 380
16 iso_pr_bacteria 2910942425 2910946808 380
17 2225789004 2227467976 2227909608 381
18 3300042591 Ga0466692_089422 Ga0466692_089422_1104_2249 381
19 3300042593 Ga0466691_093787 Ga0466691_093787_3605_4750 381
20 3300042601 Ga0466707_257015 Ga0466707_257015_3468_4613 381
21 3300042602 Ga0466713_045750 Ga0466713_045750_6938_8083 381
22 3300042602 Ga0466713_051288 Ga0466713_051288_181480_182625 381
23 3300042606 Ga0466719_337418 Ga0466719_337418_635_1780 381
24 3300042612 Ga0466705_459208 Ga0466705_459208_3098_4243 381
25 3300042615 Ga0466711_007864 Ga0466711_007864_6837_7982 381
26 3300042615 Ga0466711_115858 Ga0466711_115858_1610_2755 381
27 3300042615 Ga0466711_133227 Ga0466711_133227_1670_2815 381
28 3300042615 Ga0466711_202921 Ga0466711_202921_5557_6702 381
29 3300042615 Ga0466711_341966 Ga0466711_341966_5472_6617 381
30 3300042616 Ga0466715_107845 Ga0466715_107845_4192_5337 381
31 3300042616 Ga0466715_259821 Ga0466715_259821_9585_10730 381
32 3300042621 Ga0466729_175447 Ga0466729_175447_271_1416 381
33 3300042621 Ga0466729_314346 Ga0466729_314346_4460_5605 381
34 3300042624 Ga0466735_029550 Ga0466735_029550_185_1330 381
35 3300042624 Ga0466735_033158 Ga0466735_033158_6172_7317 381
36 3300042624 Ga0466735_059305 Ga0466735_059305_102_1247 381
37 3300042624 Ga0466735_100916 Ga0466735_100916_37_1182 381
38 3300042624 Ga0466735_133959 Ga0466735_133959_115_1260 381
39 3300042625 Ga0466730_036402 Ga0466730_036402_179_1324 381
40 3300042648 Ga0466709_134637 Ga0466709_134637_21_1166 381
41 3300042659 Ga0466733_124159 Ga0466733_124159_2522_3667 381
42 3300042659 Ga0466733_171717 Ga0466733_171717_8677_9822 381
43 3300056842 Ga0562377_0004 Ga0562377_0004_1873425_1874570 381
44 iso_pr_bacteria 2695420314 2695472256 381
45 iso_pr_bacteria 2910949487 2910949771 381
46 iso_pr_bacteria 2910959314 2910960846 381
47 iso_pr_bacteria 2940244548 2940246657 381
48 iso_pr_bacteria 2940248789 2940250767 381
49 iso_pr_bacteria 2940253009 2940254842 381
50 iso_pr_bacteria 2940257232 2940258975 381
51 iso_pr_bacteria 2967483437 2967485751 381
52 iso_pr_bacteria 2967483437 2967485761 381
53 iso_pr_bacteria 8100166142 8100170627 381
54 3300000062 IMNBL1DRAFT_c0003167 IMNBL1DRAFT_00031674 382
55 3300000062 IMNBL1DRAFT_c0008823 IMNBL1DRAFT_00088233 382
56 3300005201 Ga0072941_1033930 Ga0072941_10339302 382
57 3300042591 Ga0466692_116573 Ga0466692_116573_218_1366 382
58 3300042596 Ga0466696_373365 Ga0466696_373365_6245_7393 382
59 3300042598 Ga0466701_058955 Ga0466701_058955_17011_18159 382
60 3300042601 Ga0466707_018222 Ga0466707_018222_2669_3817 382
61 3300042601 Ga0466707_087386 Ga0466707_087386_16104_17252 382
62 3300042601 Ga0466707_194468 Ga0466707_194468_25706_26854 382
63 3300042605 Ga0466716_266440 Ga0466716_266440_4818_5966 382
64 3300042609 Ga0466722_034718 Ga0466722_034718_3903_5051 382
65 3300042611 Ga0466697_084284 Ga0466697_084284_280_1428 382
66 3300042611 Ga0466697_260334 Ga0466697_260334_1335_2483 382
67 3300042618 Ga0466723_018599 Ga0466723_018599_760_1908 382
68 3300042621 Ga0466729_144058 Ga0466729_144058_807_1955 382
69 3300042648 Ga0466709_021217 Ga0466709_021217_16763_17911 382
70 3300042659 Ga0466733_018359 Ga0466733_018359_210_1358 382
71 iso_pr_bacteria 2820768849 2820770104 382
72 iso_pr_bacteria 2820774381 2820775983 382
73 iso_pr_bacteria 2910930387 2910931850 382
74 3300000062 IMNBL1DRAFT_c0000149 IMNBL1DRAFT_000014946 383
75 3300002504 JGI24705J35276_12221232 JGI24705J35276_122212324 383
76 3300009784 Ga0123357_10017659 Ga0123357_100176593 383
77 3300010167 Ga0123353_10000136 Ga0123353_1000013654 383
78 3300010882 Ga0123354_10010376 Ga0123354_100103763 383
79 3300042612 Ga0466705_421295 Ga0466705_421295_821_1972 383
80 3300042613 Ga0466710_400293 Ga0466710_400293_168_1319 383
81 3300042618 Ga0466723_291184 Ga0466723_291184_1387_2538 383
82 3300042619 Ga0466726_011452 Ga0466726_011452_208_1359 383
83 3300042621 Ga0466729_151578 Ga0466729_151578_430_1581 383
84 3300042624 Ga0466735_174903 Ga0466735_174903_1692_2843 383
85 3300042624 Ga0466735_199111 Ga0466735_199111_1074_2225 383
86 3300000062 IMNBL1DRAFT_c0009871 IMNBL1DRAFT_00098714 384
87 3300005201 Ga0072941_1145795 Ga0072941_11457953 384
88 3300010167 Ga0123353_10392226 Ga0123353_103922262 384
89 3300010882 Ga0123354_10196106 Ga0123354_101961062 384
90 3300042591 Ga0466692_146630 Ga0466692_146630_3052_4206 384
91 3300042600 Ga0466700_016544 Ga0466700_016544_1070_2224 384
92 3300042602 Ga0466713_139646 Ga0466713_139646_232677_233831 384
93 3300042610 Ga0466698_138024 Ga0466698_138024_446_1600 384
94 3300042643 Ga0466704_089150 Ga0466704_089150_1507_2661 384
95 iso_pr_bacteria 2820759988 2820761478 384
96 3300002509 JGI24699J35502_11134018 JGI24699J35502_1113401819 385
97 3300009784 Ga0123357_10002011 Ga0123357_100020116 385
98 3300010167 Ga0123353_10819900 Ga0123353_108199001 385
99 3300010882 Ga0123354_10034204 Ga0123354_100342044 385
100 3300010882 Ga0123354_10045502 Ga0123354_100455023 385
101 3300010882 Ga0123354_10085693 Ga0123354_100856934 385
102 3300042591 Ga0466692_118934 Ga0466692_118934_1473_2630 385
103 3300042601 Ga0466707_194051 Ga0466707_194051_4899_6056 385
104 3300042602 Ga0466713_002197 Ga0466713_002197_5453_6610 385
105 3300042602 Ga0466713_059661 Ga0466713_059661_968_2125 385
106 3300042602 Ga0466713_076063 Ga0466713_076063_26868_28025 385
107 3300042602 Ga0466713_111128 Ga0466713_111128_8034_9191 385
108 3300042606 Ga0466719_446548 Ga0466719_446548_1836_2993 385
109 3300042615 Ga0466711_216976 Ga0466711_216976_2927_4084 385
110 3300042616 Ga0466715_181089 Ga0466715_181089_4108_5265 385
111 3300042616 Ga0466715_379015 Ga0466715_379015_7655_8812 385
112 3300042619 Ga0466726_010377 Ga0466726_010377_7395_8552 385
113 3300042619 Ga0466726_385773 Ga0466726_385773_283_1440 385
114 3300042621 Ga0466729_104723 Ga0466729_104723_3474_4631 385
115 3300042624 Ga0466735_067715 Ga0466735_067715_17_1174 385
116 3300042624 Ga0466735_203414 Ga0466735_203414_974_2131 385
117 3300042643 Ga0466704_140628 Ga0466704_140628_8007_9164 385
118 3300042643 Ga0466704_480030 Ga0466704_480030_320_1477 385
119 3300042652 Ga0466708_221268 Ga0466708_221268_2624_3781 385
120 3300042655 Ga0466727_166040 Ga0466727_166040_1659_2816 385
121 iso_pr_bacteria 2967483437 2967483499 385
122 3300010167 Ga0123353_10029439 Ga0123353_100294392 386
123 3300042593 Ga0466691_224364 Ga0466691_224364_28315_29475 386
124 3300042602 Ga0466713_101790 Ga0466713_101790_5728_6888 386
125 3300042606 Ga0466719_382906 Ga0466719_382906_741_1901 386
126 3300042624 Ga0466735_205490 Ga0466735_205490_995_2155 386
127 3300042636 Ga0466703_107147 Ga0466703_107147_3965_5125 386
128 3300042659 Ga0466733_183783 Ga0466733_183783_944_2104 386
129 3300009784 Ga0123357_10015185 Ga0123357_100151853 387
130 3300042609 Ga0466722_222202 Ga0466722_222202_3075_4238 387
131 3300042612 Ga0466705_404818 Ga0466705_404818_7926_9089 387
132 3300042616 Ga0466715_212551 Ga0466715_212551_2222_3385 387
133 3300042620 Ga0466728_106796 Ga0466728_106796_954_2117 387
134 3300042596 Ga0466696_007849 Ga0466696_007849_25776_26945 389
135 3300042643 Ga0466704_078634 Ga0466704_078634_5589_6758 389
136 3300010049 Ga0123356_10200050 Ga0123356_102000502 392
137 3300042596 Ga0466696_258760 Ga0466696_258760_4875_6056 393
138 3300010882 Ga0123354_10082567 Ga0123354_100825673 455

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10509 GalKase_gal_bdg Galactokinase galactose-binding signature 8 56 0.96
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 90 177 0.94
PF08544 GHMP_kinases_C GHMP kinases C terminal 282 346 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00288 GO:0005524 ATP binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.73 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.