Protein Family IF03496

Metagenome Isolate
136 Members
55 Samples
126 Scaffolds
309.61 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10068649|Ga0123354_100686493
Length
363 aa
Sequence
MLLRLQQNNDVIKPLLFHHNFSAGCVLLRTRFFVAPTKNRIFALKINDLLMPLNIPRNLPAVEALKKENIFVMDDLRASTQDIRPLKVALLNLMPVKITTETDFVRLLSNSPLQVEIDLLKMQSHDSKNTSQEHLATFYKNFDDICKSNYDGMIITGAPVELLDFEEVNYWNELAGIMNWAARHVTSTLYICWGAQAGLYHFHGIPKYPLDKKKFGVFKHTLNSPNIPLFRGFDDEFYAPHSRHTEIRRDDILKVPALNILSESADAGVYIVMSRGGREIFITGHSEYAPDTLHTEYFRDLEKNLPISVPVNYYADDDPQKGIKVRWRAHAHLMFKNWLNYYVYQSTPFNSEEIELLGDIHA*

📊 Sample Types

Isolate 7.3%
Metagenome 92.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.2%
Kalotermitidae 24.1%
Unclassified 22.2%
Termopsidae 7.4%
Rhinotermitidae 3.7%
Passalidae 3.7%
Hodotermitidae 1.9%
Sarcophagidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
2 2820170025 Unclassified Proteobacteria Co191P1bin43 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
12 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
21 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
22 2820488713 Unclassified Firmicutes Lab288P1bin69 Isolate Unclassified
23 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
24 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
31 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
34 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2820344559 Unclassified Firmicutes Nt197P3bin63 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2820168331 Unclassified Proteobacteria Co191P3bin57 Isolate Unclassified
41 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
42 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
43 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
47 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
48 2832039703 Ignatzschineria cameli UAE-HKU59 Isolate Sarcophagidae
49 2820166269 Unclassified Proteobacteria Co191P4bin16 Isolate Unclassified
50 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
51 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
52 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_197075 3300042611 Bacteria 1396
2 Ga0123356_10115330 3300010049 Bacteria 2602
3 Ga0123353_10285114 3300010167 Bacteria 2533
4 Ga0466722_113613 3300042609 Bacteria 129604
5 Ga0466722_120035 3300042609 Bacteria 45106
6 Ga0466703_000348 3300042636 Bacteria 2106
7 Ga0466703_161775 3300042636 Bacteria 2639
8 Ga0466703_258501 3300042636 Bacteria 8590
9 Ga0466708_070580 3300042652 Bacteria 12677
10 Ga0466711_480633 3300042615 Bacteria 3251
11 Ga0466715_332133 3300042616 Bacteria 83480
12 Ga0466715_511783 3300042616 Bacteria 16929
13 Ga0466715_575966 3300042616 Bacteria 2672
14 Ga0466723_098789 3300042618 Bacteria 53207
15 Ga0466690_265774 3300042590 Bacteria 41173
16 Ga0466696_183805 3300042596 Bacteria 5470
17 Ga0123357_10010842 3300009784 Bacteria 11627
18 Ga0123357_10029592 3300009784 Bacteria 7422
19 Ga0123357_10118803 3300009784 Bacteria 3339
20 Ga0123354_10125706 3300010882 Bacteria 3277
21 Ga0123354_10304860 3300010882 Bacteria 1499
22 Ga0466717_106815 3300042604 Bacteria 1061
23 Ga0466719_233643 3300042606 Bacteria 1260
24 2227521841 2225789004 Bacteria 17301
25 Ga0068302_10149867 3300005071 Bacteria 6189
26 Ga0068302_10162646 3300005071 Bacteria 2820
27 Ga0068305_10071735 3300005083 Bacteria 1653
28 Ga0072940_1088499 3300005200 Bacteria 1647
29 Ga0123357_10000658 3300009784 Bacteria 34456
30 Ga0466735_090442 3300042624 Bacteria 1589
31 Ga0466703_042660 3300042636 Bacteria 3857
32 Ga0466703_231389 3300042636 Bacteria 15715
33 Ga0466709_107759 3300042648 Bacteria 9623
34 Ga0466727_238954 3300042655 Bacteria 5086
35 Ga0466715_201523 3300042616 Unclassified 1877
36 Ga0466715_343665 3300042616 Bacteria 20123
37 Ga0466690_329486 3300042590 Bacteria 7489
38 Ga0466705_064419 3300042612 Bacteria 18478
39 Ga0123355_10000761 3300009826 Bacteria 43990
40 Ga0466707_417559 3300042601 Bacteria 1500
41 Ga0466722_153298 3300042609 Bacteria 32266
42 IMNBL1DRAFT_c0000275 3300000062 Bacteria 45397
43 JGI24699J35502_11134232 3300002509 Bacteria 111679
44 Ga0466715_356515 3300042616 Bacteria 18946
45 Ga0466723_155582 3300042618 Bacteria 11071
46 Ga0466705_318007 3300042612 Bacteria 3226
47 Ga0123357_10299644 3300009784 Unclassified 1626
48 Ga0123356_10000138 3300010049 Bacteria 82103
49 Ga0123353_10167395 3300010167 Bacteria 3492
50 2227203869 2225789004 Bacteria 1431
51 IMNBL1DRAFT_c0000827 3300000062 Bacteria 24404
52 IMNBL1DRAFT_c0011972 3300000062 Bacteria 4001
53 JGI24702J35022_10001437 3300002462 Bacteria 14862
54 JGI24702J35022_10012522 3300002462 Bacteria 4711
55 JGI24696J40584_12961194 3300002834 Bacteria 11880
56 Ga0072940_1082541 3300005200 Bacteria 1751
57 Ga0466731_054000 3300042622 Bacteria 1281
58 Ga0466711_280284 3300042615 Bacteria 2524
59 Ga0466718_103367 3300042617 Bacteria 1896
60 Ga0466726_201375 3300042619 Bacteria 3822
61 Ga0466726_295459 3300042619 Bacteria 9304
62 Ga0466693_064247 3300042592 Bacteria 2044
63 Ga0466697_245354 3300042611 Bacteria 4138
64 Ga0123354_10001754 3300010882 Bacteria 27280
65 Ga0466706_100840 3300042599 Bacteria 2182
66 Ga0466700_482160 3300042600 Bacteria 10498
67 Ga0466707_053875 3300042601 Bacteria 21857
68 Ga0466713_043123 3300042602 Bacteria 81226
69 Ga0466717_253350 3300042604 Bacteria 2040
70 Ga0466719_144767 3300042606 Bacteria 4664
71 JGI24705J35276_12237768 3300002504 Bacteria 13008
72 JGI24696J40584_12960083 3300002834 Bacteria 6276
73 Ga0466704_459141 3300042643 Bacteria 2317
74 Ga0466727_099109 3300042655 Bacteria 13117
75 Ga0466715_031863 3300042616 Bacteria 42176
76 Ga0466715_074119 3300042616 Bacteria 27442
77 Ga0466729_090999 3300042621 Bacteria 5517
78 Ga0123357_10120809 3300009784 Bacteria 3301
79 Ga0123356_10345095 3300010049 Bacteria 1611
80 Ga0466706_108154 3300042599 Bacteria 3880
81 Ga0466707_205352 3300042601 Bacteria 12166
82 Ga0466713_020857 3300042602 Bacteria 6155
83 Ga0466714_085847 3300042603 Bacteria 2182
84 Ga0466722_256948 3300042609 Bacteria 1564
85 2227607976 2225789004 Bacteria 2285
86 IMNBL1DRAFT_c0000815 3300000062 Bacteria 24587
87 JGI24702J35022_10012024 3300002462 Bacteria 4819
88 JGI24699J35502_11134031 3300002509 Bacteria 25636
89 Ga0466735_064090 3300042624 Bacteria 2046
90 Ga0466726_066852 3300042619 Bacteria 44599
91 Ga0466726_099951 3300042619 Bacteria 13893
92 Ga0466728_153933 3300042620 Bacteria 2765
93 Ga0264413_113553 3300024493 Bacteria 11564
94 Ga0466696_136935 3300042596 Bacteria 6527
95 Ga0123355_10122432 3300009826 Bacteria 4031
96 Ga0123355_10150590 3300009826 Bacteria 3535
97 Ga0123354_10068649 3300010882 Bacteria 5151
98 Ga0466700_036108 3300042600 Bacteria 59458
99 Ga0466722_035283 3300042609 Bacteria 1236
100 JGI24702J35022_10001318 3300002462 Bacteria 15429
101 Ga0068305_10244848 3300005083 Bacteria 2233
102 Ga0466729_261638 3300042621 Bacteria 163955
103 Ga0466704_421462 3300042643 Bacteria 43158
104 Ga0466704_610062 3300042643 Bacteria 35016
105 Ga0466709_144034 3300042648 Bacteria 2147
106 Ga0466727_113322 3300042655 Bacteria 53270
107 Ga0466727_215312 3300042655 Bacteria 4563
108 Ga0466715_200741 3300042616 Bacteria 3086
109 Ga0466728_165174 3300042620 Bacteria 1938
110 Ga0466729_079464 3300042621 Bacteria 4620
111 Ga0466691_092057 3300042593 Bacteria 1523
112 Ga0466694_231596 3300042594 Bacteria 2902
113 Ga0466705_229048 3300042612 Bacteria 1591
114 Ga0123357_10006658 3300009784 Bacteria 14153
115 Ga0123355_10000368 3300009826 Bacteria 58435
116 Ga0123355_10031759 3300009826 Bacteria 8568
117 Ga0123353_10079460 3300010167 Bacteria 5273
118 Ga0466714_149019 3300042603 Bacteria 2695
119 Ga0466722_147616 3300042609 Bacteria 1525
120 Ga0466722_166839 3300042609 Bacteria 3199
121 Ga0068305_10062903 3300005083 Bacteria 2679
122 Ga0466709_058685 3300042648 Bacteria 3551
123 Ga0466723_305983 3300042618 Bacteria 3988
124 Ga0466656_199017 3300042550 Bacteria 9912
125 Ga0466696_077549 3300042596 Bacteria 8731
126 Ga0466696_418989 3300042596 Bacteria 5568

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005200 Ga0072940_1088499 Ga0072940_10884991 292
2 2225789004 2227521841 2228025770 294
3 3300042622 Ga0466731_054000 Ga0466731_054000_284_1168 294
4 3300000062 IMNBL1DRAFT_c0000827 IMNBL1DRAFT_000082712 295
5 3300002504 JGI24705J35276_12237768 JGI24705J35276_1223776816 295
6 3300005083 Ga0068305_10062903 Ga0068305_100629032 297
7 3300005200 Ga0072940_1082541 Ga0072940_10825411 297
8 3300042604 Ga0466717_253350 Ga0466717_253350_641_1540 299
9 3300042619 Ga0466726_201375 Ga0466726_201375_1291_2190 299
10 3300024493 Ga0264413_113553 Ga0264413_1135539 300
11 3300042643 Ga0466704_459141 Ga0466704_459141_873_1775 300
12 3300042592 Ga0466693_064247 Ga0466693_064247_381_1286 301
13 iso_pr_bacteria 2820488713 2820490792 301
14 iso_pr_bacteria 2820593525 2820594326 301
15 iso_pr_bacteria 2820654856 2820657055 301
16 3300009826 Ga0123355_10000368 Ga0123355_1000036841 302
17 3300009826 Ga0123355_10031759 Ga0123355_100317597 302
18 3300009826 Ga0123355_10150590 Ga0123355_101505902 302
19 iso_pr_bacteria 2820344559 2820344906 302
20 3300042596 Ga0466696_418989 Ga0466696_418989_733_1644 303
21 3300042599 Ga0466706_100840 Ga0466706_100840_257_1168 303
22 3300042616 Ga0466715_074119 Ga0466715_074119_20081_20992 303
23 3300042617 Ga0466718_103367 Ga0466718_103367_73_984 303
24 3300002462 JGI24702J35022_10001318 JGI24702J35022_1000131813 304
25 3300009826 Ga0123355_10000761 Ga0123355_1000076134 304
26 3300042601 Ga0466707_417559 Ga0466707_417559_404_1318 304
27 3300042603 Ga0466714_085847 Ga0466714_085847_404_1318 304
28 3300042618 Ga0466723_305983 Ga0466723_305983_2732_3646 304
29 3300042621 Ga0466729_090999 Ga0466729_090999_353_1267 304
30 3300042636 Ga0466703_000348 Ga0466703_000348_344_1258 304
31 3300042636 Ga0466703_231389 Ga0466703_231389_13344_14258 304
32 iso_pr_bacteria 2820263778 2820264399 304
33 2225789004 2227607976 2228178190 305
34 3300000062 IMNBL1DRAFT_c0011972 IMNBL1DRAFT_00119723 305
35 3300010882 Ga0123354_10304860 Ga0123354_103048602 305
36 3300042599 Ga0466706_108154 Ga0466706_108154_2713_3630 305
37 3300042601 Ga0466707_205352 Ga0466707_205352_9835_10752 305
38 3300042611 Ga0466697_197075 Ga0466697_197075_23_940 305
39 3300042612 Ga0466705_318007 Ga0466705_318007_2170_3087 305
40 3300042620 Ga0466728_165174 Ga0466728_165174_365_1303 305
41 iso_pr_bacteria 2820166269 2820167391 305
42 iso_pr_bacteria 2820168331 2820169259 305
43 iso_pr_bacteria 2820170025 2820171058 305
44 3300002462 JGI24702J35022_10001437 JGI24702J35022_1000143712 306
45 3300002834 JGI24696J40584_12960083 JGI24696J40584_129600832 306
46 3300002834 JGI24696J40584_12961194 JGI24696J40584_1296119410 306
47 3300010049 Ga0123356_10000138 Ga0123356_1000013870 306
48 3300010049 Ga0123356_10345095 Ga0123356_103450952 306
49 3300010167 Ga0123353_10079460 Ga0123353_100794603 306
50 3300042550 Ga0466656_199017 Ga0466656_199017_4209_5129 306
51 3300042612 Ga0466705_229048 Ga0466705_229048_427_1347 306
52 3300042615 Ga0466711_280284 Ga0466711_280284_954_1874 306
53 3300042619 Ga0466726_295459 Ga0466726_295459_740_1660 306
54 3300009826 Ga0123355_10122432 Ga0123355_101224321 307
55 3300042596 Ga0466696_183805 Ga0466696_183805_2049_2975 308
56 3300042612 Ga0466705_064419 Ga0466705_064419_15805_16731 308
57 3300042616 Ga0466715_511783 Ga0466715_511783_15024_15950 308
58 3300042643 Ga0466704_421462 Ga0466704_421462_12988_13914 308
59 3300010167 Ga0123353_10167395 Ga0123353_101673953 309
60 3300042604 Ga0466717_106815 Ga0466717_106815_120_1049 309
61 3300042616 Ga0466715_575966 Ga0466715_575966_1586_2515 309
62 iso_pr_bacteria 2832039703 2832041894 309
63 3300010167 Ga0123353_10285114 Ga0123353_102851144 310
64 3300042615 Ga0466711_480633 Ga0466711_480633_143_1075 310
65 3300042655 Ga0466727_099109 Ga0466727_099109_6206_7138 310
66 3300005083 Ga0068305_10071735 Ga0068305_100717351 311
67 3300042602 Ga0466713_043123 Ga0466713_043123_62735_63670 311
68 3300042603 Ga0466714_149019 Ga0466714_149019_1041_1976 311
69 3300042616 Ga0466715_031863 Ga0466715_031863_13253_14188 311
70 3300042616 Ga0466715_343665 Ga0466715_343665_7503_8438 311
71 3300042616 Ga0466715_356515 Ga0466715_356515_17584_18519 311
72 3300042618 Ga0466723_155582 Ga0466723_155582_2828_3763 311
73 3300042621 Ga0466729_261638 Ga0466729_261638_353_1288 311
74 3300042643 Ga0466704_610062 Ga0466704_610062_31598_32533 311
75 3300042648 Ga0466709_107759 Ga0466709_107759_3636_4571 311
76 2225789004 2227203869 2227630472 312
77 3300042590 Ga0466690_329486 Ga0466690_329486_61_999 312
78 3300042594 Ga0466694_231596 Ga0466694_231596_420_1358 312
79 3300042596 Ga0466696_136935 Ga0466696_136935_4598_5536 312
80 3300042600 Ga0466700_036108 Ga0466700_036108_17120_18058 312
81 3300042600 Ga0466700_482160 Ga0466700_482160_6187_7125 312
82 3300042601 Ga0466707_053875 Ga0466707_053875_232_1170 312
83 3300042602 Ga0466713_020857 Ga0466713_020857_11_949 312
84 3300042609 Ga0466722_120035 Ga0466722_120035_25713_26651 312
85 3300042611 Ga0466697_245354 Ga0466697_245354_2285_3223 312
86 3300042616 Ga0466715_200741 Ga0466715_200741_1467_2405 312
87 3300042616 Ga0466715_201523 Ga0466715_201523_682_1620 312
88 3300042618 Ga0466723_098789 Ga0466723_098789_7888_8826 312
89 3300042619 Ga0466726_099951 Ga0466726_099951_375_1313 312
90 3300042620 Ga0466728_153933 Ga0466728_153933_322_1260 312
91 3300042621 Ga0466729_079464 Ga0466729_079464_2114_3052 312
92 3300042636 Ga0466703_042660 Ga0466703_042660_273_1211 312
93 3300042636 Ga0466703_161775 Ga0466703_161775_230_1168 312
94 3300042636 Ga0466703_258501 Ga0466703_258501_7414_8352 312
95 3300042648 Ga0466709_058685 Ga0466709_058685_658_1596 312
96 3300042648 Ga0466709_144034 Ga0466709_144034_278_1216 312
97 3300042652 Ga0466708_070580 Ga0466708_070580_6805_7743 312
98 3300042655 Ga0466727_215312 Ga0466727_215312_270_1208 312
99 iso_pr_bacteria 2820759988 2820762704 312
100 3300000062 IMNBL1DRAFT_c0000275 IMNBL1DRAFT_000027525 313
101 3300000062 IMNBL1DRAFT_c0000815 IMNBL1DRAFT_000081513 313
102 3300002462 JGI24702J35022_10012024 JGI24702J35022_100120242 313
103 3300002462 JGI24702J35022_10012522 JGI24702J35022_100125224 313
104 3300002509 JGI24699J35502_11134031 JGI24699J35502_1113403114 313
105 3300002509 JGI24699J35502_11134232 JGI24699J35502_1113423265 313
106 3300005071 Ga0068302_10149867 Ga0068302_101498676 313
107 3300005083 Ga0068305_10244848 Ga0068305_102448482 313
108 3300009784 Ga0123357_10000658 Ga0123357_1000065823 313
109 3300009784 Ga0123357_10006658 Ga0123357_100066584 313
110 3300009784 Ga0123357_10010842 Ga0123357_100108427 313
111 3300009784 Ga0123357_10029592 Ga0123357_100295925 313
112 3300009784 Ga0123357_10120809 Ga0123357_101208094 313
113 3300009784 Ga0123357_10299644 Ga0123357_102996443 313
114 3300010882 Ga0123354_10001754 Ga0123354_1000175417 313
115 3300010882 Ga0123354_10125706 Ga0123354_101257062 313
116 3300042609 Ga0466722_113613 Ga0466722_113613_41231_42172 313
117 3300042609 Ga0466722_147616 Ga0466722_147616_89_1030 313
118 3300042609 Ga0466722_166839 Ga0466722_166839_348_1289 313
119 3300042619 Ga0466726_066852 Ga0466726_066852_23714_24655 313
120 3300042655 Ga0466727_113322 Ga0466727_113322_51931_52872 313
121 3300042624 Ga0466735_064090 Ga0466735_064090_945_1889 314
122 3300042624 Ga0466735_090442 Ga0466735_090442_145_1089 314
123 3300042590 Ga0466690_265774 Ga0466690_265774_13636_14583 315
124 3300042606 Ga0466719_233643 Ga0466719_233643_90_1037 315
125 3300042616 Ga0466715_332133 Ga0466715_332133_13649_14596 315
126 3300042655 Ga0466727_238954 Ga0466727_238954_3327_4274 315
127 3300005071 Ga0068302_10162646 Ga0068302_101626462 316
128 3300042593 Ga0466691_092057 Ga0466691_092057_333_1283 316
129 3300042609 Ga0466722_035283 Ga0466722_035283_20_970 316
130 3300042609 Ga0466722_256948 Ga0466722_256948_411_1364 317
131 3300042596 Ga0466696_077549 Ga0466696_077549_7142_8098 318
132 3300042606 Ga0466719_144767 Ga0466719_144767_1313_2317 325
133 3300042609 Ga0466722_153298 Ga0466722_153298_11119_12108 329
134 3300010049 Ga0123356_10115330 Ga0123356_101153303 337
135 3300010882 Ga0123354_10068649 Ga0123354_100686493 363
136 3300009784 Ga0123357_10118803 Ga0123357_101188032 369

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04204 HTS Homoserine O-succinyltransferase 52 349 1

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.