Protein Family IF03495

Metagenome Isolate
138 Members
38 Samples
128 Scaffolds
264.01 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10065571|Ga0123354_100655715
Length
299 aa
Sequence
VRTTTSEILSIKDLSKAYNSKDSKALKNVSITVESGEFISVIGPSGAGKSTLLRCINRMVDATEGEIVFNGQNISKVKGKALRVVRTNIGMIFQNYNLVNRLSVLENVLHGRLGYKSTISGALGFYSEAEKEKAFEIISRLGLIKHAYKRCDELSGGQKQRVGIARALMQDPQLILCDEPIASLDPNSSKVIMDYLQDINRAMKITCIVNLHQVDFACKYAERIIGINNGAIVYDGSAKTISQSDLKAIYESDQESYINDAGYSCQELVVTTANATKQVLETNKITLNEKHLVYEKHY*

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.1%
Kalotermitidae 36.1%
Unclassified 22.2%
Rhinotermitidae 2.8%
Penaeidae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 134
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
2 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
3 2820909719 Unclassified Actinobacteria Emb289P4bin20 Isolate Unclassified
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820698910 Unclassified Firmicutes Co191P1bin64 Isolate Unclassified
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
16 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
21 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
22 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
23 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
24 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
25 8082023105 Niallia sp. Man26 Isolate Penaeidae
26 2820833147 Unclassified Actinobacteria Lab288P4bin85 Isolate Unclassified
27 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
28 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
29 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
30 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
31 2820663833 Unclassified Firmicutes Co191P3bin41 Isolate Unclassified
32 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 2873597894 Erysipelothrix sp. HDW6B Isolate Unclassified
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_004222 3300042590 Bacteria 1514
2 Ga0466692_062291 3300042591 Bacteria 3411
3 Ga0466691_073857 3300042593 Bacteria 12152
4 Ga0466708_063693 3300042652 Bacteria 2304
5 Ga0466708_252652 3300042652 Bacteria 4384
6 Ga0123357_10226069 3300009784 Bacteria 2064
7 Ga0123353_10429917 3300010167 Bacteria 1953
8 Ga0123353_11240888 3300010167 Bacteria 974
9 Ga0123354_10335884 3300010882 Bacteria 1370
10 Ga0466711_456831 3300042615 Bacteria 1949
11 Ga0466715_019276 3300042616 Bacteria 18285
12 Ga0466723_342913 3300042618 Bacteria 10032
13 Ga0466728_065780 3300042620 Bacteria 4350
14 Ga0466716_445839 3300042605 Unclassified 1707
15 Ga0466716_503323 3300042605 Bacteria 8608
16 Ga0466716_542890 3300042605 Bacteria 1243
17 Ga0466690_051266 3300042590 Bacteria 2284
18 Ga0466690_094725 3300042590 Bacteria 4188
19 Ga0466699_211020 3300042597 Bacteria 2132
20 Ga0466703_127939 3300042636 Bacteria 32645
21 Ga0466703_362285 3300042636 Bacteria 1058
22 Ga0466703_415436 3300042636 Bacteria 2706
23 Ga0466704_166993 3300042643 Bacteria 2836
24 Ga0466704_223982 3300042643 Bacteria 3430
25 Ga0466709_143033 3300042648 Bacteria 14752
26 Ga0466708_161973 3300042652 Bacteria 41034
27 Ga0466708_171619 3300042652 Bacteria 15797
28 Ga0466708_328975 3300042652 Bacteria 16368
29 Ga0123357_10077910 3300009784 Bacteria 4370
30 Ga0123354_10000071 3300010882 Bacteria 76954
31 Ga0466711_022754 3300042615 Bacteria 3505
32 Ga0466715_077102 3300042616 Bacteria 10738
33 Ga0466728_272307 3300042620 Bacteria 6898
34 Ga0466705_203339 3300042612 Bacteria 4151
35 Ga0466704_153272 3300042643 Bacteria 24613
36 Ga0466708_159795 3300042652 Bacteria 18178
37 Ga0123357_10006340 3300009784 Bacteria 14408
38 Ga0123356_10073986 3300010049 Bacteria 3205
39 Ga0123353_10270168 3300010167 Unclassified 2620
40 Ga0123353_10312042 3300010167 Bacteria 2392
41 Ga0123353_10907196 3300010167 Bacteria 1199
42 Ga0466715_162008 3300042616 Bacteria 2734
43 Ga0466723_141391 3300042618 Bacteria 24854
44 Ga0466723_370110 3300042618 Bacteria 1604
45 Ga0466728_068200 3300042620 Bacteria 4712
46 Ga0466705_236602 3300042612 Bacteria 26817
47 Ga0466720_108039 3300042607 Bacteria 13191
48 Ga0466691_010447 3300042593 Bacteria 1818
49 Ga0466691_137048 3300042593 Bacteria 28584
50 Ga0466703_268818 3300042636 Bacteria 5406
51 Ga0466703_381334 3300042636 Bacteria 10561
52 Ga0466704_387524 3300042643 Bacteria 3470
53 Ga0466709_223746 3300042648 Bacteria 4167
54 Ga0466708_121783 3300042652 Bacteria 2339
55 Ga0123356_10800191 3300010049 Bacteria 1114
56 Ga0466715_244159 3300042616 Bacteria 31385
57 Ga0466723_325484 3300042618 Bacteria 4461
58 Ga0466723_345541 3300042618 Bacteria 8295
59 JGI24695J34938_10000077 3300002450 Bacteria 83455
60 Ga0466705_308711 3300042612 Bacteria 4351
61 Ga0466719_345548 3300042606 Bacteria 4916
62 Ga0415639_096628 3300038395 Bacteria 1733
63 Ga0466690_138899 3300042590 Bacteria 1134
64 Ga0466691_060371 3300042593 Bacteria 20351
65 Ga0466703_272627 3300042636 Bacteria 11884
66 Ga0466704_096911 3300042643 Bacteria 3491
67 Ga0123357_10196649 3300009784 Bacteria 2307
68 Ga0123355_10006535 3300009826 Bacteria 17296
69 Ga0123353_10018517 3300010167 Bacteria 10300
70 Ga0123353_10145836 3300010167 Bacteria 3785
71 Ga0466705_522651 3300042612 Bacteria 30673
72 Ga0466723_050687 3300042618 Bacteria 1913
73 Ga0466723_175933 3300042618 Bacteria 11294
74 Ga0466728_056223 3300042620 Bacteria 10745
75 Ga0466728_171780 3300042620 Bacteria 1766
76 Ga0466705_045928 3300042612 Bacteria 4369
77 Ga0466705_096074 3300042612 Bacteria 2754
78 Ga0466717_183663 3300042604 Unclassified 1570
79 Ga0466716_057704 3300042605 Bacteria 22306
80 Ga0466690_049371 3300042590 Bacteria 5349
81 Ga0466691_028713 3300042593 Bacteria 11625
82 Ga0466703_330833 3300042636 Bacteria 14129
83 Ga0466703_413259 3300042636 Bacteria 2331
84 Ga0466709_165042 3300042648 Bacteria 6881
85 Ga0466709_390021 3300042648 Bacteria 2887
86 Ga0466709_404141 3300042648 Bacteria 3159
87 Ga0123357_10093667 3300009784 Bacteria 3903
88 Ga0123355_10002922 3300009826 Bacteria 24284
89 Ga0123355_10004337 3300009826 Bacteria 20628
90 Ga0123355_10561238 3300009826 Bacteria 1375
91 Ga0123354_10065571 3300010882 Bacteria 5313
92 Ga0123354_10102756 3300010882 Bacteria 3849
93 Ga0466723_078936 3300042618 Bacteria 9831
94 Ga0466723_170171 3300042618 Bacteria 4394
95 Ga0466723_243195 3300042618 Bacteria 87629
96 Ga0466723_318990 3300042618 Bacteria 1585
97 Ga0466728_128904 3300042620 Bacteria 5682
98 Ga0466728_390232 3300042620 Bacteria 5979
99 AustNasuHG_c1004224 3300000089 Bacteria 5157
100 Ga0466719_333256 3300042606 Unclassified 2380
101 Ga0466719_387724 3300042606 Bacteria 2938
102 Ga0466692_191585 3300042591 Bacteria 1086
103 Ga0466731_199636 3300042622 Bacteria 3301
104 Ga0466704_031627 3300042643 Bacteria 4631
105 Ga0466704_057369 3300042643 Bacteria 3692
106 Ga0466709_390168 3300042648 Bacteria 3676
107 Ga0123353_10259113 3300010167 Bacteria 2688
108 Ga0123353_10647830 3300010167 Bacteria 1496
109 Ga0466711_054990 3300042615 Bacteria 8308
110 Ga0466723_026563 3300042618 Bacteria 110971
111 Ga0466723_148005 3300042618 Bacteria 27024
112 Ga0466723_200185 3300042618 Bacteria 12692
113 Ga0466732_081713 3300042656 Bacteria 4301
114 Ga0466719_369321 3300042606 Bacteria 1187
115 Ga0466691_096810 3300042593 Bacteria 2881
116 Ga0466703_036839 3300042636 Bacteria 7162
117 Ga0466709_160787 3300042648 Bacteria 4895
118 Ga0466709_230639 3300042648 Bacteria 5628
119 Ga0123357_10050049 3300009784 Bacteria 5657
120 Ga0466711_026376 3300042615 Bacteria 5079
121 Ga0466711_138665 3300042615 Bacteria 5456
122 Ga0466715_030227 3300042616 Bacteria 24248
123 Ga0466723_051811 3300042618 Bacteria 1917
124 Ga0466723_213834 3300042618 Bacteria 8852
125 Ga0466723_244080 3300042618 Bacteria 15547
126 Ga0466728_390942 3300042620 Bacteria 2096
127 AustNasuHG_c1022420 3300000089 Bacteria 2028
128 Ga0072941_1013479 3300005201 Bacteria 12277

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042605 Ga0466716_445839 Ga0466716_445839_208_903 231
2 3300042618 Ga0466723_345541 Ga0466723_345541_442_1137 231
3 3300042636 Ga0466703_036839 Ga0466703_036839_452_1153 233
4 3300042636 Ga0466703_362285 Ga0466703_362285_295_1011 238
5 3300042590 Ga0466690_004222 Ga0466690_004222_651_1370 239
6 3300042618 Ga0466723_318990 Ga0466723_318990_617_1339 240
7 3300009826 Ga0123355_10002922 Ga0123355_1000292222 246
8 3300009826 Ga0123355_10561238 Ga0123355_105612382 246
9 3300009826 Ga0123355_10006535 Ga0123355_100065357 247
10 iso_pr_bacteria 2820663833 2820665098 247
11 iso_pr_bacteria 2820698910 2820700073 247
12 3300002450 JGI24695J34938_10000077 JGI24695J34938_1000007730 248
13 3300038395 Ga0415639_096628 Ga0415639_096628_381_1136 251
14 iso_pr_bacteria 2873597894 2873599937 252
15 3300009826 Ga0123355_10004337 Ga0123355_1000433721 254
16 3300042643 Ga0466704_166993 Ga0466704_166993_1580_2425 255
17 3300042618 Ga0466723_244080 Ga0466723_244080_13542_14315 257
18 3300042656 Ga0466732_081713 Ga0466732_081713_432_1205 257
19 3300042616 Ga0466715_162008 Ga0466715_162008_642_1418 258
20 3300042618 Ga0466723_026563 Ga0466723_026563_24952_25728 258
21 3300042618 Ga0466723_213834 Ga0466723_213834_5811_6587 258
22 iso_pr_bacteria 8082023105 8082027085 258
23 3300042615 Ga0466711_054990 Ga0466711_054990_6955_7734 259
24 3300042618 Ga0466723_342913 Ga0466723_342913_7624_8403 259
25 3300042636 Ga0466703_127939 Ga0466703_127939_30765_31544 259
26 3300042636 Ga0466703_415436 Ga0466703_415436_895_1677 260
27 3300042652 Ga0466708_252652 Ga0466708_252652_2877_3659 260
28 iso_pr_bacteria 2820422691 2820423607 260
29 3300042597 Ga0466699_211020 Ga0466699_211020_277_1062 261
30 3300042606 Ga0466719_369321 Ga0466719_369321_316_1101 261
31 3300042616 Ga0466715_244159 Ga0466715_244159_5828_6613 261
32 3300042618 Ga0466723_148005 Ga0466723_148005_24818_25603 261
33 3300042622 Ga0466731_199636 Ga0466731_199636_563_1348 261
34 3300042643 Ga0466704_057369 Ga0466704_057369_586_1371 261
35 3300042648 Ga0466709_404141 Ga0466709_404141_1185_1970 261
36 3300042652 Ga0466708_161973 Ga0466708_161973_37470_38255 261
37 3300005201 Ga0072941_1013479 Ga0072941_10134792 262
38 3300009784 Ga0123357_10196649 Ga0123357_101966492 262
39 3300010049 Ga0123356_10800191 Ga0123356_108001912 262
40 3300010167 Ga0123353_10145836 Ga0123353_101458364 262
41 3300010167 Ga0123353_10259113 Ga0123353_102591133 262
42 3300010167 Ga0123353_10907196 Ga0123353_109071962 262
43 3300010167 Ga0123353_11240888 Ga0123353_112408881 262
44 3300042590 Ga0466690_138899 Ga0466690_138899_161_949 262
45 3300042591 Ga0466692_062291 Ga0466692_062291_1087_1875 262
46 3300042604 Ga0466717_183663 Ga0466717_183663_305_1093 262
47 3300042607 Ga0466720_108039 Ga0466720_108039_673_1461 262
48 3300042616 Ga0466715_019276 Ga0466715_019276_6403_7191 262
49 3300042618 Ga0466723_078936 Ga0466723_078936_1761_2549 262
50 3300042620 Ga0466728_171780 Ga0466728_171780_656_1444 262
51 3300042636 Ga0466703_330833 Ga0466703_330833_9576_10364 262
52 iso_pr_bacteria 2781125631 2781268973 262
53 3300000089 AustNasuHG_c1004224 AustNasuHG_10042245 263
54 3300000089 AustNasuHG_c1022420 AustNasuHG_10224202 263
55 3300042593 Ga0466691_010447 Ga0466691_010447_1008_1799 263
56 3300042593 Ga0466691_096810 Ga0466691_096810_1073_1864 263
57 3300042605 Ga0466716_542890 Ga0466716_542890_235_1026 263
58 3300042612 Ga0466705_045928 Ga0466705_045928_476_1267 263
59 3300042616 Ga0466715_030227 Ga0466715_030227_10059_10850 263
60 3300042618 Ga0466723_175933 Ga0466723_175933_8418_9209 263
61 3300042618 Ga0466723_243195 Ga0466723_243195_4463_5254 263
62 3300042620 Ga0466728_056223 Ga0466728_056223_2112_2903 263
63 3300042620 Ga0466728_065780 Ga0466728_065780_566_1357 263
64 3300042636 Ga0466703_381334 Ga0466703_381334_937_1728 263
65 3300042636 Ga0466703_413259 Ga0466703_413259_925_1716 263
66 3300042648 Ga0466709_143033 Ga0466709_143033_12477_13268 263
67 3300042648 Ga0466709_390021 Ga0466709_390021_41_832 263
68 3300042652 Ga0466708_159795 Ga0466708_159795_6289_7080 263
69 3300010167 Ga0123353_10429917 Ga0123353_104299172 264
70 3300042590 Ga0466690_049371 Ga0466690_049371_2296_3090 264
71 3300042590 Ga0466690_094725 Ga0466690_094725_2044_2838 264
72 3300042591 Ga0466692_191585 Ga0466692_191585_44_838 264
73 3300042593 Ga0466691_028713 Ga0466691_028713_660_1454 264
74 3300042593 Ga0466691_060371 Ga0466691_060371_15424_16218 264
75 3300042605 Ga0466716_057704 Ga0466716_057704_144_938 264
76 3300042606 Ga0466719_333256 Ga0466719_333256_218_1012 264
77 3300042612 Ga0466705_203339 Ga0466705_203339_1329_2123 264
78 3300042612 Ga0466705_236602 Ga0466705_236602_3292_4086 264
79 3300042615 Ga0466711_138665 Ga0466711_138665_3717_4511 264
80 3300042618 Ga0466723_050687 Ga0466723_050687_296_1090 264
81 3300042618 Ga0466723_051811 Ga0466723_051811_300_1094 264
82 3300042618 Ga0466723_141391 Ga0466723_141391_20405_21199 264
83 3300042618 Ga0466723_325484 Ga0466723_325484_655_1449 264
84 3300042618 Ga0466723_370110 Ga0466723_370110_482_1276 264
85 3300042620 Ga0466728_272307 Ga0466728_272307_5088_5882 264
86 3300042643 Ga0466704_096911 Ga0466704_096911_1460_2254 264
87 3300042643 Ga0466704_153272 Ga0466704_153272_17517_18311 264
88 3300042643 Ga0466704_223982 Ga0466704_223982_1345_2139 264
89 3300042648 Ga0466709_230639 Ga0466709_230639_2510_3304 264
90 3300042652 Ga0466708_063693 Ga0466708_063693_245_1039 264
91 3300042652 Ga0466708_121783 Ga0466708_121783_1513_2307 264
92 3300042652 Ga0466708_171619 Ga0466708_171619_7874_8668 264
93 3300010167 Ga0123353_10018517 Ga0123353_100185173 265
94 3300042615 Ga0466711_022754 Ga0466711_022754_1257_2111 265
95 3300042643 Ga0466704_031627 Ga0466704_031627_1312_2205 265
96 3300010049 Ga0123356_10073986 Ga0123356_100739862 266
97 3300042590 Ga0466690_051266 Ga0466690_051266_1122_1922 266
98 3300042605 Ga0466716_503323 Ga0466716_503323_912_1712 266
99 3300042615 Ga0466711_026376 Ga0466711_026376_1557_2357 266
100 3300042615 Ga0466711_456831 Ga0466711_456831_24_824 266
101 3300042620 Ga0466728_068200 Ga0466728_068200_3022_3822 266
102 3300042620 Ga0466728_390232 Ga0466728_390232_3873_4673 266
103 3300042636 Ga0466703_268818 Ga0466703_268818_4116_4916 266
104 3300042643 Ga0466704_387524 Ga0466704_387524_1600_2400 266
105 3300042648 Ga0466709_223746 Ga0466709_223746_881_1681 266
106 3300042652 Ga0466708_328975 Ga0466708_328975_5532_6332 266
107 3300010167 Ga0123353_10270168 Ga0123353_102701682 267
108 3300010167 Ga0123353_10312042 Ga0123353_103120423 267
109 3300042616 Ga0466715_077102 Ga0466715_077102_1144_1947 267
110 3300042648 Ga0466709_160787 Ga0466709_160787_2511_3314 267
111 3300042606 Ga0466719_345548 Ga0466719_345548_1461_2267 268
112 3300042612 Ga0466705_308711 Ga0466705_308711_586_1398 270
113 3300042648 Ga0466709_390168 Ga0466709_390168_265_1077 270
114 iso_pr_bacteria 8114537524 8114540837 270
115 3300042612 Ga0466705_522651 Ga0466705_522651_11525_12346 273
116 3300042620 Ga0466728_390942 Ga0466728_390942_1167_1988 273
117 3300042606 Ga0466719_387724 Ga0466719_387724_10_834 274
118 3300042648 Ga0466709_165042 Ga0466709_165042_2119_2943 274
119 3300042593 Ga0466691_073857 Ga0466691_073857_9779_10606 275
120 3300042612 Ga0466705_096074 Ga0466705_096074_1819_2649 276
121 3300010882 Ga0123354_10102756 Ga0123354_101027563 277
122 3300042636 Ga0466703_272627 Ga0466703_272627_9995_10828 277
123 3300010167 Ga0123353_10647830 Ga0123353_106478302 278
124 3300042593 Ga0466691_137048 Ga0466691_137048_1392_2228 278
125 iso_pr_bacteria 2843246524 2843248650 278
126 3300042620 Ga0466728_128904 Ga0466728_128904_2125_2964 279
127 iso_pr_bacteria 2820833147 2820833658 279
128 3300009784 Ga0123357_10226069 Ga0123357_102260692 280
129 3300010882 Ga0123354_10000071 Ga0123354_1000007161 280
130 3300009784 Ga0123357_10050049 Ga0123357_100500494 281
131 3300010882 Ga0123354_10335884 Ga0123354_103358842 281
132 3300042618 Ga0466723_200185 Ga0466723_200185_3159_4004 281
133 3300009784 Ga0123357_10077910 Ga0123357_100779104 283
134 iso_pr_bacteria 2820909719 2820910628 286
135 3300009784 Ga0123357_10006340 Ga0123357_100063409 287
136 3300042618 Ga0466723_170171 Ga0466723_170171_1511_2383 290
137 3300009784 Ga0123357_10093667 Ga0123357_100936672 295
138 3300010882 Ga0123354_10065571 Ga0123354_100655715 299

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00005 ABC_tran ABC transporter 26 182 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.89 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.