Protein Family IF03479
Metagenome
Metatranscriptome
Isolate
180
Members
85
Samples
155
Scaffolds
98.72
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10025356|Ga0123354_100253565
- Length
- 112 aa
- Sequence
- MFYSKIRNPANMNTSFEILLKPILTEKLTAQEEHLNRYGFKVDRTANKIQIKKAIEEMYGVTVEAVNTMRYAGKNKSRFTKAGVIAGRGNHFKKAMITLKKGDKIDFYSNI*
Sample Types
Isolate
13.9%
Metagenome
84.4%
MAG
0.0%
Metatranscriptome
1.7%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.6%
Kalotermitidae
14.6%
Unclassified
12.2%
Blattidae
11.0%
Rhinotermitidae
6.1%
Termopsidae
4.9%
Passalidae
2.4%
Hydrophilidae
2.4%
Hodotermitidae
1.2%
Nephropidae
1.2%
Noctuidae
1.2%
Drosophilidae
1.2%
Armadillidiidae
1.2%
Kiwaidae
1.2%
Harpacticidae
1.2%
Apidae
1.2%
Taxonomy
Archaea
0
Bacteria
172
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2940253009 | Dysgonomonas sp. PF1-23 | Isolate | Blattidae |
| 2 | 2940257232 | Dysgonomonas sp. PFB1-18 | Isolate | Blattidae |
| 3 | 2695420317 | Dysgonomonas sp. HGC4 | Isolate | Unclassified |
| 4 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 8 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 9 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 10 | 2910949487 | Dysgonomonas sp. 520 | Isolate | Blattidae |
| 11 | 2910959314 | Dysgonomonas sp. 511 | Isolate | Blattidae |
| 12 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 8100157865 | Dysgonomonas sp. GY617 | Isolate | Rhinotermitidae |
| 16 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 19 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 20 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 2838772460 | Aquimarina sp. I32.4 | Isolate | Nephropidae |
| 28 | 2910926975 | Dysgonomonas sp. 25 | Isolate | Blattidae |
| 29 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 35 | 3300007505 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii female 6 gut | Metagenome | Drosophilidae |
| 36 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 37 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 38 | 2820727601 | Unclassified Cloacimonetes Nt197P3bin46 | Isolate | Unclassified |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 43 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 44 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 45 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 49 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 50 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 51 | 2940248789 | Dysgonomonas sp. PF1-16 | Isolate | Blattidae |
| 52 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 54 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 55 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 56 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 57 | 3300013007 | Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts | Metagenome | Kiwaidae |
| 58 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 59 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 60 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 61 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 62 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 63 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 64 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 65 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 66 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 67 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 68 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 69 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 70 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 71 | 3300021221 | Termite gut microbial communities from nest - French Guiana - 18a-5 mRNA SA | Metatranscriptome | Termitidae |
| 72 | 2910930387 | Dysgonomonas sp. 216 | Isolate | Blattidae |
| 73 | 2940244548 | Dysgonomonas sp. PF1-14 | Isolate | Blattidae |
| 74 | 2021593000 | Sample 264 | Metagenome | Harpacticidae |
| 75 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 76 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 77 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 78 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 79 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 80 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 81 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 82 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 83 | 3004672520 | Bacteroides sp. 51 | Isolate | Blattidae |
| 84 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 85 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | IMNBL1DRAFT_c0020686 | 3300000062 | Bacteria | 2654 |
| 2 | JGI24705J35276_12234796 | 3300002504 | Bacteria | 5858 |
| 3 | Ga0123356_10070678 | 3300010049 | Bacteria | 3274 |
| 4 | Ga0123356_11317278 | 3300010049 | Unclassified | 885 |
| 5 | Ga0123356_13578338 | 3300010049 | Unclassified | 538 |
| 6 | Ga0123353_10106017 | 3300010167 | Bacteria | 4529 |
| 7 | Ga0123353_10186932 | 3300010167 | Bacteria | 3275 |
| 8 | Ga0466703_019525 | 3300042636 | Bacteria | 29012 |
| 9 | Ga0466704_442514 | 3300042643 | Bacteria | 75471 |
| 10 | Ga0466701_034352 | 3300042598 | Bacteria | 2625 |
| 11 | Ga0466706_191825 | 3300042599 | Bacteria | 26014 |
| 12 | Ga0466707_152952 | 3300042601 | Bacteria | 15357 |
| 13 | Ga0466713_137400 | 3300042602 | Bacteria | 1552 |
| 14 | Ga0466722_055729 | 3300042609 | Bacteria | 3414 |
| 15 | Ga0233288_1020593 | 3300022232 | Bacteria | 1403 |
| 16 | Ga0466712_180312 | 3300042614 | Bacteria | 2900 |
| 17 | Ga0466726_284088 | 3300042619 | Bacteria | 8137 |
| 18 | Ga0466729_193843 | 3300042621 | Bacteria | 2391 |
| 19 | Ga0466733_020611 | 3300042659 | Bacteria | 2555 |
| 20 | Ga0466733_120712 | 3300042659 | Bacteria | 3449 |
| 21 | Ga0466733_200869 | 3300042659 | Bacteria | 1898 |
| 22 | 2227325260 | 2225789004 | Bacteria | 1181 |
| 23 | 2227473157 | 2225789004 | Bacteria | 907 |
| 24 | IMNBL1DRAFT_c0144727 | 3300000062 | Bacteria | 613 |
| 25 | JGI24702J35022_10004749 | 3300002462 | Bacteria | 8038 |
| 26 | JGI24696J40584_12877013 | 3300002834 | Bacteria | 1068 |
| 27 | Ga0123356_10054982 | 3300010049 | Bacteria | 3707 |
| 28 | Ga0123356_11007862 | 3300010049 | Bacteria | 1003 |
| 29 | Ga0123356_11231259 | 3300010049 | Unclassified | 914 |
| 30 | Ga0123353_13088988 | 3300010167 | Bacteria | 537 |
| 31 | Ga0466708_169565 | 3300042652 | Bacteria | 34312 |
| 32 | Ga0466701_074079 | 3300042598 | Bacteria | 1177 |
| 33 | Ga0466706_142094 | 3300042599 | Bacteria | 1186 |
| 34 | Ga0466713_072740 | 3300042602 | Bacteria | 29878 |
| 35 | Ga0466714_110110 | 3300042603 | Bacteria | 3022 |
| 36 | Ga0466719_385682 | 3300042606 | Bacteria | 3334 |
| 37 | Ga0466657_385166 | 3300042582 | Bacteria | 1398 |
| 38 | Ga0466692_149579 | 3300042591 | Bacteria | 83669 |
| 39 | 2227484956 | 2225789004 | Bacteria | 824 |
| 40 | JGI24705J35276_11366159 | 3300002504 | Bacteria | 518 |
| 41 | Ga0105005_1329385 | 3300007505 | Bacteria | 580 |
| 42 | Ga0123357_10049693 | 3300009784 | Bacteria | 5680 |
| 43 | Ga0123353_10001965 | 3300010167 | Bacteria | 25350 |
| 44 | Ga0123353_10402705 | 3300010167 | Bacteria | 2036 |
| 45 | Ga0466709_170238 | 3300042648 | Bacteria | 55916 |
| 46 | Ga0466657_330370 | 3300042582 | Bacteria | 1117 |
| 47 | Ga0466690_095939 | 3300042590 | Bacteria | 5717 |
| 48 | Ga0466690_287618 | 3300042590 | Bacteria | 16965 |
| 49 | Ga0466694_037794 | 3300042594 | Bacteria | 1123 |
| 50 | Ga0466710_082075 | 3300042613 | Bacteria | 1736 |
| 51 | Ga0466715_045203 | 3300042616 | Bacteria | 21834 |
| 52 | Ga0466697_093502 | 3300042611 | Bacteria | 1250 |
| 53 | Ga0466705_092258 | 3300042612 | Bacteria | 6924 |
| 54 | TM1208_contig62774 | 2021593000 | Bacteria | 556 |
| 55 | 2227527393 | 2225789004 | Bacteria | 16791 |
| 56 | IMNBL1DRAFT_c0000687 | 3300000062 | Bacteria | 27159 |
| 57 | JGI24702J35022_10006433 | 3300002462 | Bacteria | 6791 |
| 58 | JGI24702J35022_10231668 | 3300002462 | Bacteria | 1068 |
| 59 | JGI24705J35276_12139085 | 3300002504 | Bacteria | 1133 |
| 60 | Ga0072941_1370518 | 3300005201 | Bacteria | 1785 |
| 61 | Ga0123355_10439773 | 3300009826 | Bacteria | 1652 |
| 62 | Ga0123356_10360153 | 3300010049 | Bacteria | 1581 |
| 63 | Ga0123356_10655471 | 3300010049 | Bacteria | 1217 |
| 64 | Ga0123356_11068384 | 3300010049 | Bacteria | 976 |
| 65 | Ga0123356_12528326 | 3300010049 | Unclassified | 643 |
| 66 | Ga0466703_249699 | 3300042636 | Bacteria | 47455 |
| 67 | Ga0466704_311970 | 3300042643 | Bacteria | 2079 |
| 68 | Ga0466725_361915 | 3300042654 | Bacteria | 1100 |
| 69 | Ga0466727_117581 | 3300042655 | Bacteria | 2355 |
| 70 | Ga0466707_245265 | 3300042601 | Bacteria | 1827 |
| 71 | Ga0466717_251818 | 3300042604 | Bacteria | 1157 |
| 72 | Ga0466721_228876 | 3300042608 | Bacteria | 1046 |
| 73 | Ga0160456_112972 | 3300012820 | Bacteria | 824 |
| 74 | Ga0466711_080899 | 3300042615 | Bacteria | 15234 |
| 75 | Ga0466715_533905 | 3300042616 | Bacteria | 9746 |
| 76 | Ga0466723_373256 | 3300042618 | Bacteria | 33738 |
| 77 | Ga0466726_471260 | 3300042619 | Bacteria | 1798 |
| 78 | IMNBL1DRAFT_c0000119 | 3300000062 | Bacteria | 71190 |
| 79 | Ga0068302_10187715 | 3300005071 | Bacteria | 1590 |
| 80 | Ga0068305_10010112 | 3300005083 | Bacteria | 17726 |
| 81 | Ga0123357_10005900 | 3300009784 | Bacteria | 14780 |
| 82 | Ga0466734_173702 | 3300042623 | Bacteria | 1787 |
| 83 | Ga0466735_216908 | 3300042624 | Bacteria | 3045 |
| 84 | Ga0466703_369160 | 3300042636 | Bacteria | 28465 |
| 85 | Ga0466708_143755 | 3300042652 | Bacteria | 8647 |
| 86 | Ga0466706_086447 | 3300042599 | Bacteria | 4039 |
| 87 | Ga0466707_375112 | 3300042601 | Bacteria | 17480 |
| 88 | Ga0466713_113019 | 3300042602 | Bacteria | 16771 |
| 89 | Ga0466717_113039 | 3300042604 | Bacteria | 1060 |
| 90 | Ga0466719_292822 | 3300042606 | Bacteria | 42754 |
| 91 | Ga0466722_267306 | 3300042609 | Bacteria | 1656 |
| 92 | Ga0157631_112806 | 3300013007 | Bacteria | 3277 |
| 93 | Ga0264413_148151 | 3300024493 | Bacteria | 2089 |
| 94 | Ga0466656_102353 | 3300042550 | Bacteria | 1465 |
| 95 | Ga0466690_136026 | 3300042590 | Bacteria | 11620 |
| 96 | Ga0466692_159524 | 3300042591 | Bacteria | 46807 |
| 97 | Ga0466723_184116 | 3300042618 | Bacteria | 30069 |
| 98 | Ga0466697_256611 | 3300042611 | Bacteria | 1086 |
| 99 | Ga0466727_349423 | 3300042655 | Bacteria | 30219 |
| 100 | Ga0466733_052918 | 3300042659 | Bacteria | 1967 |
| 101 | Ga0466733_204953 | 3300042659 | Bacteria | 3034 |
| 102 | IMNBL1DRAFT_c0053481 | 3300000062 | Bacteria | 1258 |
| 103 | Ga0072941_1073474 | 3300005201 | Bacteria | 1324 |
| 104 | Ga0123356_10086245 | 3300010049 | Bacteria | 2980 |
| 105 | Ga0123356_10305778 | 3300010049 | Bacteria | 1697 |
| 106 | Ga0123356_12573574 | 3300010049 | Bacteria | 637 |
| 107 | Ga0123356_12988717 | 3300010049 | Bacteria | 590 |
| 108 | Ga0123353_10152434 | 3300010167 | Bacteria | 3688 |
| 109 | Ga0123353_11012807 | 3300010167 | Unclassified | 1114 |
| 110 | Ga0466734_150090 | 3300042623 | Bacteria | 1234 |
| 111 | Ga0466735_232692 | 3300042624 | Bacteria | 20733 |
| 112 | Ga0466703_269331 | 3300042636 | Bacteria | 1526 |
| 113 | Ga0466725_255972 | 3300042654 | Bacteria | 39464 |
| 114 | Ga0466727_012114 | 3300042655 | Bacteria | 4624 |
| 115 | Ga0466700_021305 | 3300042600 | Bacteria | 30578 |
| 116 | Ga0466717_255735 | 3300042604 | Bacteria | 4005 |
| 117 | Ga0466710_347434 | 3300042613 | Bacteria | 1731 |
| 118 | Ga0466723_175652 | 3300042618 | Bacteria | 41824 |
| 119 | Ga0466726_142630 | 3300042619 | Bacteria | 1440 |
| 120 | Ga0466697_105486 | 3300042611 | Bacteria | 1506 |
| 121 | Ga0466732_339081 | 3300042656 | Bacteria | 1415 |
| 122 | Ga0466733_174455 | 3300042659 | Bacteria | 4998 |
| 123 | JGI24695J34938_10112447 | 3300002450 | Unclassified | 1109 |
| 124 | JGI24702J35022_10005043 | 3300002462 | Bacteria | 7778 |
| 125 | JGI24702J35022_10320345 | 3300002462 | Bacteria | 919 |
| 126 | Ga0123356_10018638 | 3300010049 | Bacteria | 6586 |
| 127 | Ga0123356_10319132 | 3300010049 | Bacteria | 1666 |
| 128 | Ga0123354_10025356 | 3300010882 | Bacteria | 9348 |
| 129 | Ga0466730_020607 | 3300042625 | Bacteria | 3112 |
| 130 | Ga0466702_060779 | 3300042635 | Bacteria | 1415 |
| 131 | Ga0466706_124077 | 3300042599 | Bacteria | 1141 |
| 132 | Ga0466700_233886 | 3300042600 | Bacteria | 5710 |
| 133 | Ga0466707_374739 | 3300042601 | Bacteria | 28797 |
| 134 | Ga0466716_065737 | 3300042605 | Bacteria | 4990 |
| 135 | Ga0466716_532094 | 3300042605 | Bacteria | 21649 |
| 136 | Ga0466701_014159 | 3300042598 | Bacteria | 1343 |
| 137 | Ga0466710_453259 | 3300042613 | Bacteria | 4177 |
| 138 | Ga0466715_586714 | 3300042616 | Bacteria | 57830 |
| 139 | Ga0466729_117874 | 3300042621 | Bacteria | 2916 |
| 140 | Ga0466732_019305 | 3300042656 | Unclassified | 1428 |
| 141 | IMNBL1DRAFT_c0002428 | 3300000062 | Bacteria | 12971 |
| 142 | IMNBL1DRAFT_c0079345 | 3300000062 | Bacteria | 924 |
| 143 | Ga0072941_1514243 | 3300005201 | Bacteria | 565 |
| 144 | Ga0123356_10042349 | 3300010049 | Bacteria | 4242 |
| 145 | Ga0123356_10786814 | 3300010049 | Unclassified | 1122 |
| 146 | Ga0466708_014146 | 3300042652 | Bacteria | 33245 |
| 147 | Ga0466706_064416 | 3300042599 | Bacteria | 22081 |
| 148 | Ga0466713_017147 | 3300042602 | Bacteria | 4646 |
| 149 | Ga0223689_102448 | 3300021221 | Bacteria | 669 |
| 150 | Ga0223683_1084349 | 3300021245 | Bacteria | 522 |
| 151 | Ga0466657_203302 | 3300042582 | Bacteria | 2737 |
| 152 | Ga0466695_019243 | 3300042595 | Bacteria | 4125 |
| 153 | Ga0466696_398980 | 3300042596 | Bacteria | 15504 |
| 154 | Ga0466710_416897 | 3300042613 | Bacteria | 23309 |
| 155 | Ga0466711_062266 | 3300042615 | Bacteria | 2461 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 2225789004 | 2227473157 | 2227921741 | 79 |
| 2 | 3300042590 | Ga0466690_095939 | Ga0466690_095939_3323_3577 | 84 |
| 3 | 3300005201 | Ga0072941_1514243 | Ga0072941_15142431 | 85 |
| 4 | iso_pr_bacteria | 2910926975 | 2910930133 | 93 |
| 5 | iso_pr_bacteria | 2820727601 | 2820727866 | 94 |
| 6 | 2225789004 | 2227484956 | 2227949893 | 95 |
| 7 | 3300010167 | Ga0123353_10001965 | Ga0123353_1000196517 | 95 |
| 8 | 3300042613 | Ga0466710_416897 | Ga0466710_416897_1047_1334 | 95 |
| 9 | 2021593000 | TM1208_contig62774 | TM1208A_655690 | 96 |
| 10 | 2225789004 | 2227325260 | 2227773300 | 96 |
| 11 | 2225789004 | 2227527393 | 2228036312 | 96 |
| 12 | 3300042598 | Ga0466701_034352 | Ga0466701_034352_1475_1765 | 96 |
| 13 | 3300042599 | Ga0466706_086447 | Ga0466706_086447_567_857 | 96 |
| 14 | 3300042601 | Ga0466707_245265 | Ga0466707_245265_193_483 | 96 |
| 15 | 3300042601 | Ga0466707_374739 | Ga0466707_374739_18901_19191 | 96 |
| 16 | 3300042601 | Ga0466707_375112 | Ga0466707_375112_16114_16404 | 96 |
| 17 | 3300042603 | Ga0466714_110110 | Ga0466714_110110_1072_1362 | 96 |
| 18 | 3300042604 | Ga0466717_251818 | Ga0466717_251818_444_734 | 96 |
| 19 | 3300042609 | Ga0466722_055729 | Ga0466722_055729_2870_3160 | 96 |
| 20 | 3300042609 | Ga0466722_267306 | Ga0466722_267306_1317_1607 | 96 |
| 21 | 3300042614 | Ga0466712_180312 | Ga0466712_180312_1582_1872 | 96 |
| 22 | 3300042615 | Ga0466711_080899 | Ga0466711_080899_2460_2750 | 96 |
| 23 | 3300042616 | Ga0466715_045203 | Ga0466715_045203_14010_14300 | 96 |
| 24 | 3300042619 | Ga0466726_142630 | Ga0466726_142630_157_447 | 96 |
| 25 | 3300042619 | Ga0466726_471260 | Ga0466726_471260_826_1116 | 96 |
| 26 | 3300042624 | Ga0466735_232692 | Ga0466735_232692_7336_7626 | 96 |
| 27 | 3300042652 | Ga0466708_143755 | Ga0466708_143755_7056_7346 | 96 |
| 28 | 3300042655 | Ga0466727_012114 | Ga0466727_012114_2221_2511 | 96 |
| 29 | 3300042659 | Ga0466733_120712 | Ga0466733_120712_3010_3300 | 96 |
| 30 | iso_pr_bacteria | 2551306396 | 2552923417 | 96 |
| 31 | iso_pr_bacteria | 2718218155 | 2720329003 | 96 |
| 32 | iso_pr_bacteria | 2820044805 | 2820045211 | 96 |
| 33 | iso_pr_bacteria | 2820044805 | 2820045257 | 96 |
| 34 | iso_pr_bacteria | 2820757377 | 2820758101 | 96 |
| 35 | iso_pr_bacteria | 2838772460 | 2838772769 | 96 |
| 36 | iso_pr_bacteria | 2971438493 | 2971439359 | 96 |
| 37 | iso_pr_bacteria | 2983866074 | 2983871061 | 96 |
| 38 | iso_pr_bacteria | 3004672520 | 3004672629 | 96 |
| 39 | 3300000062 | IMNBL1DRAFT_c0002428 | IMNBL1DRAFT_000242810 | 97 |
| 40 | 3300000062 | IMNBL1DRAFT_c0020686 | IMNBL1DRAFT_00206865 | 97 |
| 41 | 3300000062 | IMNBL1DRAFT_c0053481 | IMNBL1DRAFT_00534813 | 97 |
| 42 | 3300000062 | IMNBL1DRAFT_c0079345 | IMNBL1DRAFT_00793452 | 97 |
| 43 | 3300002462 | JGI24702J35022_10006433 | JGI24702J35022_1000643316 | 97 |
| 44 | 3300002462 | JGI24702J35022_10320345 | JGI24702J35022_103203451 | 97 |
| 45 | 3300005201 | Ga0072941_1370518 | Ga0072941_13705183 | 97 |
| 46 | 3300009784 | Ga0123357_10049693 | Ga0123357_100496935 | 97 |
| 47 | 3300010049 | Ga0123356_10305778 | Ga0123356_103057783 | 97 |
| 48 | 3300010167 | Ga0123353_10186932 | Ga0123353_101869325 | 97 |
| 49 | 3300012820 | Ga0160456_112972 | Ga0160456_1129722 | 97 |
| 50 | 3300013007 | Ga0157631_112806 | Ga0157631_1128062 | 97 |
| 51 | 3300042590 | Ga0466690_136026 | Ga0466690_136026_6408_6701 | 97 |
| 52 | 3300042590 | Ga0466690_287618 | Ga0466690_287618_8091_8384 | 97 |
| 53 | 3300042591 | Ga0466692_159524 | Ga0466692_159524_20794_21087 | 97 |
| 54 | 3300042599 | Ga0466706_064416 | Ga0466706_064416_14311_14604 | 97 |
| 55 | 3300042599 | Ga0466706_124077 | Ga0466706_124077_30_323 | 97 |
| 56 | 3300042599 | Ga0466706_191825 | Ga0466706_191825_4810_5103 | 97 |
| 57 | 3300042600 | Ga0466700_021305 | Ga0466700_021305_10386_10679 | 97 |
| 58 | 3300042601 | Ga0466707_152952 | Ga0466707_152952_11785_12078 | 97 |
| 59 | 3300042602 | Ga0466713_017147 | Ga0466713_017147_3650_3943 | 97 |
| 60 | 3300042602 | Ga0466713_072740 | Ga0466713_072740_21719_22012 | 97 |
| 61 | 3300042602 | Ga0466713_113019 | Ga0466713_113019_8226_8519 | 97 |
| 62 | 3300042605 | Ga0466716_532094 | Ga0466716_532094_16170_16463 | 97 |
| 63 | 3300042606 | Ga0466719_292822 | Ga0466719_292822_28437_28730 | 97 |
| 64 | 3300042606 | Ga0466719_385682 | Ga0466719_385682_1411_1704 | 97 |
| 65 | 3300042611 | Ga0466697_093502 | Ga0466697_093502_765_1058 | 97 |
| 66 | 3300042615 | Ga0466711_062266 | Ga0466711_062266_902_1195 | 97 |
| 67 | 3300042616 | Ga0466715_586714 | Ga0466715_586714_27683_27976 | 97 |
| 68 | 3300042618 | Ga0466723_175652 | Ga0466723_175652_39511_39804 | 97 |
| 69 | 3300042618 | Ga0466723_184116 | Ga0466723_184116_8632_8925 | 97 |
| 70 | 3300042618 | Ga0466723_373256 | Ga0466723_373256_13542_13835 | 97 |
| 71 | 3300042619 | Ga0466726_284088 | Ga0466726_284088_7108_7401 | 97 |
| 72 | 3300042621 | Ga0466729_117874 | Ga0466729_117874_1396_1689 | 97 |
| 73 | 3300042624 | Ga0466735_216908 | Ga0466735_216908_1804_2097 | 97 |
| 74 | 3300042625 | Ga0466730_020607 | Ga0466730_020607_829_1122 | 97 |
| 75 | 3300042636 | Ga0466703_019525 | Ga0466703_019525_27290_27583 | 97 |
| 76 | 3300042636 | Ga0466703_249699 | Ga0466703_249699_32308_32601 | 97 |
| 77 | 3300042636 | Ga0466703_269331 | Ga0466703_269331_110_403 | 97 |
| 78 | 3300042636 | Ga0466703_369160 | Ga0466703_369160_13524_13817 | 97 |
| 79 | 3300042643 | Ga0466704_311970 | Ga0466704_311970_485_778 | 97 |
| 80 | 3300042652 | Ga0466708_014146 | Ga0466708_014146_6012_6305 | 97 |
| 81 | 3300042652 | Ga0466708_169565 | Ga0466708_169565_19502_19795 | 97 |
| 82 | 3300042654 | Ga0466725_255972 | Ga0466725_255972_14915_15208 | 97 |
| 83 | 3300042655 | Ga0466727_117581 | Ga0466727_117581_1658_1951 | 97 |
| 84 | 3300042655 | Ga0466727_349423 | Ga0466727_349423_13129_13422 | 97 |
| 85 | 3300042656 | Ga0466732_019305 | Ga0466732_019305_351_644 | 97 |
| 86 | 3300042659 | Ga0466733_052918 | Ga0466733_052918_399_692 | 97 |
| 87 | 3300042659 | Ga0466733_174455 | Ga0466733_174455_4323_4616 | 97 |
| 88 | iso_pr_bacteria | 2695420317 | 2695484876 | 97 |
| 89 | iso_pr_bacteria | 2873600114 | 2873602041 | 97 |
| 90 | iso_pr_bacteria | 2873610414 | 2873612402 | 97 |
| 91 | iso_pr_bacteria | 2910930387 | 2910931360 | 97 |
| 92 | iso_pr_bacteria | 2910949487 | 2910951319 | 97 |
| 93 | iso_pr_bacteria | 2910959314 | 2910959536 | 97 |
| 94 | iso_pr_bacteria | 2940244548 | 2940244771 | 97 |
| 95 | iso_pr_bacteria | 2940248789 | 2940249011 | 97 |
| 96 | iso_pr_bacteria | 2940253009 | 2940253263 | 97 |
| 97 | iso_pr_bacteria | 2940257232 | 2940257685 | 97 |
| 98 | iso_pr_bacteria | 8100157865 | 8100158758 | 97 |
| 99 | iso_pr_bacteria | 8100166142 | 8100169617 | 97 |
| 100 | 3300000062 | IMNBL1DRAFT_c0000119 | IMNBL1DRAFT_000011911 | 98 |
| 101 | 3300000062 | IMNBL1DRAFT_c0000687 | IMNBL1DRAFT_000068715 | 98 |
| 102 | 3300000062 | IMNBL1DRAFT_c0144727 | IMNBL1DRAFT_01447272 | 98 |
| 103 | 3300002462 | JGI24702J35022_10004749 | JGI24702J35022_100047498 | 98 |
| 104 | 3300005071 | Ga0068302_10187715 | Ga0068302_101877152 | 98 |
| 105 | 3300005083 | Ga0068305_10010112 | Ga0068305_100101129 | 98 |
| 106 | 3300007505 | Ga0105005_1329385 | Ga0105005_13293851 | 98 |
| 107 | 3300010167 | Ga0123353_13088988 | Ga0123353_130889881 | 98 |
| 108 | 3300022232 | Ga0233288_1020593 | Ga0233288_10205932 | 98 |
| 109 | 3300042591 | Ga0466692_149579 | Ga0466692_149579_14895_15191 | 98 |
| 110 | 3300042602 | Ga0466713_137400 | Ga0466713_137400_710_1006 | 98 |
| 111 | 3300042596 | Ga0466696_398980 | Ga0466696_398980_8085_8384 | 99 |
| 112 | 3300042598 | Ga0466701_014159 | Ga0466701_014159_544_843 | 99 |
| 113 | 3300042599 | Ga0466706_142094 | Ga0466706_142094_603_902 | 99 |
| 114 | 3300042623 | Ga0466734_173702 | Ga0466734_173702_499_798 | 99 |
| 115 | 3300010049 | Ga0123356_10070678 | Ga0123356_100706782 | 100 |
| 116 | 3300010049 | Ga0123356_10319132 | Ga0123356_103191323 | 100 |
| 117 | 3300010049 | Ga0123356_10786814 | Ga0123356_107868142 | 100 |
| 118 | 3300010049 | Ga0123356_11068384 | Ga0123356_110683842 | 100 |
| 119 | 3300010049 | Ga0123356_11231259 | Ga0123356_112312592 | 100 |
| 120 | 3300010049 | Ga0123356_11317278 | Ga0123356_113172782 | 100 |
| 121 | 3300010049 | Ga0123356_12528326 | Ga0123356_125283262 | 100 |
| 122 | 3300021221 | Ga0223689_102448 | Ga0223689_1024482 | 100 |
| 123 | 3300021245 | Ga0223683_1084349 | Ga0223683_10843492 | 100 |
| 124 | 3300024493 | Ga0264413_148151 | Ga0264413_1481513 | 100 |
| 125 | 3300042550 | Ga0466656_102353 | Ga0466656_102353_346_648 | 100 |
| 126 | 3300042582 | Ga0466657_203302 | Ga0466657_203302_756_1058 | 100 |
| 127 | 3300042582 | Ga0466657_330370 | Ga0466657_330370_275_577 | 100 |
| 128 | 3300042582 | Ga0466657_385166 | Ga0466657_385166_1037_1339 | 100 |
| 129 | 3300042594 | Ga0466694_037794 | Ga0466694_037794_38_340 | 100 |
| 130 | 3300042595 | Ga0466695_019243 | Ga0466695_019243_2286_2588 | 100 |
| 131 | 3300042600 | Ga0466700_233886 | Ga0466700_233886_1997_2299 | 100 |
| 132 | 3300042604 | Ga0466717_113039 | Ga0466717_113039_33_335 | 100 |
| 133 | 3300042604 | Ga0466717_255735 | Ga0466717_255735_2670_2972 | 100 |
| 134 | 3300042608 | Ga0466721_228876 | Ga0466721_228876_495_797 | 100 |
| 135 | 3300042611 | Ga0466697_105486 | Ga0466697_105486_592_894 | 100 |
| 136 | 3300042611 | Ga0466697_256611 | Ga0466697_256611_90_392 | 100 |
| 137 | 3300042612 | Ga0466705_092258 | Ga0466705_092258_1534_1836 | 100 |
| 138 | 3300042613 | Ga0466710_082075 | Ga0466710_082075_46_348 | 100 |
| 139 | 3300042613 | Ga0466710_347434 | Ga0466710_347434_1185_1487 | 100 |
| 140 | 3300042613 | Ga0466710_453259 | Ga0466710_453259_2795_3097 | 100 |
| 141 | 3300042623 | Ga0466734_150090 | Ga0466734_150090_825_1127 | 100 |
| 142 | 3300042635 | Ga0466702_060779 | Ga0466702_060779_194_496 | 100 |
| 143 | 3300042643 | Ga0466704_442514 | Ga0466704_442514_72059_72361 | 100 |
| 144 | 3300042648 | Ga0466709_170238 | Ga0466709_170238_43444_43746 | 100 |
| 145 | 3300042654 | Ga0466725_361915 | Ga0466725_361915_289_591 | 100 |
| 146 | 3300042656 | Ga0466732_339081 | Ga0466732_339081_327_629 | 100 |
| 147 | 3300042659 | Ga0466733_200869 | Ga0466733_200869_885_1187 | 100 |
| 148 | 3300042659 | Ga0466733_204953 | Ga0466733_204953_718_1020 | 100 |
| 149 | 3300002450 | JGI24695J34938_10112447 | JGI24695J34938_101124471 | 101 |
| 150 | 3300002462 | JGI24702J35022_10005043 | JGI24702J35022_100050439 | 101 |
| 151 | 3300002462 | JGI24702J35022_10231668 | JGI24702J35022_102316682 | 101 |
| 152 | 3300002504 | JGI24705J35276_11366159 | JGI24705J35276_113661592 | 101 |
| 153 | 3300002504 | JGI24705J35276_12139085 | JGI24705J35276_121390851 | 101 |
| 154 | 3300002834 | JGI24696J40584_12877013 | JGI24696J40584_128770132 | 101 |
| 155 | 3300005201 | Ga0072941_1073474 | Ga0072941_10734742 | 101 |
| 156 | 3300009826 | Ga0123355_10439773 | Ga0123355_104397732 | 101 |
| 157 | 3300010049 | Ga0123356_10018638 | Ga0123356_100186384 | 101 |
| 158 | 3300010049 | Ga0123356_10042349 | Ga0123356_100423496 | 101 |
| 159 | 3300010049 | Ga0123356_10054982 | Ga0123356_100549825 | 101 |
| 160 | 3300010049 | Ga0123356_10086245 | Ga0123356_100862453 | 101 |
| 161 | 3300010049 | Ga0123356_10360153 | Ga0123356_103601532 | 101 |
| 162 | 3300010049 | Ga0123356_10655471 | Ga0123356_106554712 | 101 |
| 163 | 3300010049 | Ga0123356_11007862 | Ga0123356_110078622 | 101 |
| 164 | 3300010049 | Ga0123356_12573574 | Ga0123356_125735742 | 101 |
| 165 | 3300010049 | Ga0123356_12988717 | Ga0123356_129887172 | 101 |
| 166 | 3300010049 | Ga0123356_13578338 | Ga0123356_135783381 | 101 |
| 167 | 3300010167 | Ga0123353_10106017 | Ga0123353_101060173 | 101 |
| 168 | 3300010167 | Ga0123353_10402705 | Ga0123353_104027052 | 101 |
| 169 | 3300010167 | Ga0123353_11012807 | Ga0123353_110128072 | 101 |
| 170 | 3300010167 | Ga0123353_10152434 | Ga0123353_101524342 | 103 |
| 171 | 3300042621 | Ga0466729_193843 | Ga0466729_193843_2045_2356 | 103 |
| 172 | 3300042598 | Ga0466701_074079 | Ga0466701_074079_391_726 | 111 |
| 173 | 3300010882 | Ga0123354_10025356 | Ga0123354_100253565 | 112 |
| 174 | 3300042605 | Ga0466716_065737 | Ga0466716_065737_2498_2845 | 115 |
| 175 | iso_pr_bacteria | 2820751898 | 2820753065 | 115 |
| 176 | iso_pr_bacteria | 2820776227 | 2820777711 | 115 |
| 177 | 3300002504 | JGI24705J35276_12234796 | JGI24705J35276_122347962 | 116 |
| 178 | 3300009784 | Ga0123357_10005900 | Ga0123357_1000590021 | 116 |
| 179 | 3300042659 | Ga0466733_020611 | Ga0466733_020611_811_1167 | 118 |
| 180 | 3300042616 | Ga0466715_533905 | Ga0466715_533905_5687_6088 | 133 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00276 | Ribosomal_L23 | Ribosomal protein L23 | 18 | 107 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.76 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.