- ArthroVerse

Protein Family IF03453

Metagenome Isolate

376 Members

283 Samples

159 Scaffolds

249.62 Avg Length

🧬 Representative Sequence

ID: 3300010882|Ga0123354_10001757|Ga0123354_1000175718
Length: 288 aa
Sequence: MLWLIEDVQRRYRGVLTTSGSEYGRLIMVDSGSYELFDPVGVEPDFNPDPVAQMINVQKHFGHLHVLKDINLTVNRGEVVVVIGPSGSGKSTLCRTINRLEPIDSGQILIQGKLLPQEGRDLARLRADVGMVFQSFNLFAHMSILDNVTLGPRKARKVPKAKLALLDRVGIKDQAKKLPAQLSGGQQQRAAIARALAMHPVLMLFDEPTSALDPEMINEVLDVMVSLAKEGMTMIVVTHEMGFARRAADRVVFMSDGLILEEGSPEAFFTTPQTDRAKDFLAKILHH*

📊 Sample Types

Isolate 57.7%

Metagenome 42.3%

MAG 0.0%

Metatranscriptome 0.0%

Single Cell 0.0%

🐛 Taxa Family Distribution

Coreidae 25.2%

Unclassified 16.5%

Apidae 7.9%

Anthocoridae 6.8%

Termitidae 6.4%

Formicidae 5.6%

Curculionidae 4.5%

Culicidae 4.5%

Armadillidiidae 3.4%

Elmidae 3.0%

Drosophilidae 2.6%

Tenebrionidae 1.5%

Hydrophilidae 1.1%

Dytiscidae 1.1%

Termopsidae 1.1%

Daphniidae 0.8%

Kalotermitidae 0.8%

Rhinotermitidae 0.8%

Scarabaeidae 0.8%

Pteromalidae 0.4%

Chironomidae 0.4%

Ceratophyllidae 0.4%

Nephropidae 0.4%

Cerambycidae 0.4%

Berytidae 0.4%

Siricidae 0.4%

Pentatomidae 0.4%

Calliphoridae 0.4%

Alydidae 0.4%

Crambidae 0.4%

Muscidae 0.4%

Largidae 0.4%

Thripidae 0.4%

Palinuridae 0.4%

🌳 Taxonomy

Archaea 0

Bacteria 341

Eukaryota 0

Viruses 0

Unclassified 35

🗂️ Samples

#	Sample ID	Description	Type	Taxa Family
1	2065487013	Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm	Metagenome
2	2556921669	Shinella sp. DD12	Isolate	Daphniidae
3	2574179716	Serratia sp. DD3	Isolate	Daphniidae
4	2597489903	Providencia sneebia DSM 19967	Isolate	Drosophilidae
5	2597490194	Bifidobacterium coryneforme LMG 18911	Isolate	Apidae
6	2671180601	Bifidobacterium asteroides DSM 20089	Isolate	Unclassified
7	2864853652	Pseudomonas rhodesiae S00114	Isolate	Elmidae
8	2864964650	Tsukamurella ocularis S00236	Isolate	Elmidae
9	2873571580	Diaphorobacter sp. HDW4B	Isolate	Hydrophilidae
10	2873589062	Phycicoccus sp. HDW14	Isolate	Hydrophilidae
11	2880115952	Vibrio parahaemolyticus PB1937	Isolate	Unclassified
12	3300042625	Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363	Metagenome	Termitidae
13	3300042654	Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449	Metagenome	Termitidae
14	3300056814	Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2)	Metagenome	Tenebrionidae
15	3300057007	Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2)	Metagenome	Tenebrionidae
16	8025716094	Caballeronia zhejiangensis LZ028	Isolate	Coreidae
17	8101960468	Caballeronia sp. AAUFL_F2_KS46	Isolate	Coreidae
18	8101988189	Caballeronia sp. ATUFL_F1_KS4A	Isolate	Coreidae
19	8102014801	Caballeronia sp. ATUFL_M2_KS44	Isolate	Coreidae
20	8102060671	Caballeronia sp. GAFFF2	Isolate	Coreidae
21	8102152052	Caballeronia sp. LZ001	Isolate	Coreidae
22	8102208438	Caballeronia sp. LZ032	Isolate	Coreidae
23	8102251710	Caballeronia sp. LZ065	Isolate	Coreidae
24	8102279326	Caballeronia sp. NCTM1	Isolate	Coreidae
25	3300002931	Ant worker gut metagenome for colony PL010	Metagenome	Formicidae
26	3300002934	Ant worker gut metagenome for colony PL005	Metagenome	Formicidae
27	3300007052	Ant gut microbial communities from Cephalotes eduarduli, Brazil	Metagenome	Formicidae
28	3300007192	Ant gut microbial communities from Cephalotes persimplex, Brazil	Metagenome	Formicidae
29	3300010049	Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3	Metagenome	Termitidae
30	3300010167	Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3	Metagenome	Termitidae
31	3300010882	Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4	Metagenome	Termitidae
32	3300012829	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG	Metagenome	Armadillidiidae
33	8116627632	Vibrio penaeicida NBRC 15640	Isolate	Unclassified
34	2035918003	Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine	Metagenome	Curculionidae
35	2582581321	Oceanospirillum multiglobuliferum ATCC 33336	Isolate	Unclassified
36	2684622918	Bifidobacterium asteroides Bi_198	Isolate	Unclassified
37	2687453753	Burkholderiales bacterium B_Cag25	Isolate	Unclassified
38	2850131454	Providencia rettgeri NVIT03	Isolate	Pteromalidae
39	2894926108	Leucobacter sp. OLES1	Isolate	Anthocoridae
40	2918390780	Glutamicibacter protophormiae DSM 20168	Isolate	Unclassified
41	3300042582	Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373	Metagenome	Termitidae
42	3300042602	Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513	Metagenome	Unclassified
43	3300042612	Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485	Metagenome	Kalotermitidae
44	8024981139	Bifidobacterium asteroides ESL0170	Isolate	Apidae
45	8024984606	Bifidobacterium asteroides ESL0199	Isolate	Apidae
46	8025740903	Caballeronia zhejiangensis LZ008	Isolate	Coreidae
47	8030347546	Propionimicrobium sp. PCR01-08-3	Isolate	Tenebrionidae
48	8069748016	Caballeronia sp. LP003	Isolate	Coreidae
49	8099192374	Erwinia typographi IC4	Isolate	Curculionidae
50	8102033761	Caballeronia sp. AZ7_KS35	Isolate	Coreidae
51	8102094248	Caballeronia sp. GaOx3	Isolate	Coreidae
52	8102109360	Caballeronia sp. INML2	Isolate	Coreidae
53	8102145433	Caballeronia sp. LP006	Isolate	Coreidae
54	8102186987	Caballeronia sp. LZ028	Isolate	Coreidae
55	8102223607	Caballeronia sp. LZ034LL	Isolate	Coreidae
56	8102286609	Caballeronia sp. NCTM5	Isolate	Coreidae
57	3000861951	Budvicia diplopodorum D9	Isolate
58	3300002509	Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4	Metagenome	Termitidae
59	3300003973	Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle	Metagenome	Curculionidae
60	3300007095	Ant gut microbial communities from Cephalotes minutus, Brazil	Metagenome	Formicidae
61	3300012813	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG	Metagenome	Culicidae
62	3300012828	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG	Metagenome
63	3300012841	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG	Metagenome	Armadillidiidae
64	3300012847	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG	Metagenome	Armadillidiidae
65	3300012852	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG	Metagenome
66	8110340172	Bifidobacterium choladohabitans B14384H11	Isolate	Apidae
67	2511231129	Vibrio sp. EJY3	Isolate	Unclassified
68	2519899622	Pseudomonas sp. Ag1	Isolate	Culicidae
69	2519899775	Bifidobacterium asteroides PRL2011	Isolate	Apidae
70	2524023214	Leucobacter chironomi DSM 19883	Isolate	Chironomidae
71	2529292851	Providencia burhodogranariea DSM 19968	Isolate	Drosophilidae
72	2597490239	Bifidobacterium bohemicum DSM 22767	Isolate	Unclassified
73	2651870110	Izhakiella capsodis N6PO6	Isolate	Unclassified
74	2663763384	Bifidobacterium bombi DSM 19703	Isolate	Apidae
75	2687453754	Pseudomonadales bacterium Cag26	Isolate	Unclassified
76	2751185856	Bartonella apis BBC0244	Isolate	Apidae
77	2820909719	Unclassified Actinobacteria Emb289P4bin20	Isolate	Unclassified
78	2864755708	Massilia timonae S00006	Isolate	Elmidae
79	2865983822	Bifidobacterium xylocopae XV2	Isolate	Apidae
80	2885046828	Erwinia sp. OLCASP19	Isolate	Anthocoridae
81	2885054481	Erwinia sp. OLMDSP33	Isolate	Anthocoridae
82	2894932631	Leucobacter sp. OAMLP11	Isolate	Anthocoridae
83	2894966443	Leucobacter sp. OLCALW19	Isolate	Anthocoridae
84	3300042621	Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511	Metagenome	Rhinotermitidae
85	3300042643	Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481	Metagenome	Kalotermitidae
86	3300042659	Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116	Metagenome	Termitidae
87	8001394582	Limnobaculum allomyrinae BWR-B9	Isolate	Scarabaeidae
88	8006199443	Yersinia pestis M-1763	Isolate	Ceratophyllidae
89	8011329375	Pseudomonas sp. S31	Isolate	Curculionidae
90	8023747282	Caballeronia zhejiangensis LZ019	Isolate	Coreidae
91	8024025509	Caballeronia grimmiae Lep1A1	Isolate	Coreidae
92	8024037630	Caballeronia zhejiangensis A33_M4_a	Isolate	Coreidae
93	8025685901	Caballeronia fortuita LZ035	Isolate	Coreidae
94	8025723035	Caballeronia grimmiae LZ025	Isolate	Coreidae
95	8025756023	Caballeronia peredens LZ002	Isolate	Coreidae
96	8033364368	Vibrio panuliri LBS 2	Isolate	Nephropidae
97	8078130113	Caballeronia sp. INDeC2	Isolate	Coreidae
98	8102102351	Caballeronia sp. INML1	Isolate	Coreidae
99	8102161003	Caballeronia sp. LZ002	Isolate	Coreidae
100	3003178663	Psychrobacter fulvigenes KC-40	Isolate	Unclassified
101	3007473699	Pseudomonas sp. S30	Isolate	Curculionidae
102	3300000333	Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony	Metagenome	Apidae
103	3300007142	Ant gut microbial communities from Cephalotes grandinosus, Brazil	Metagenome	Formicidae
104	8110341875	Bifidobacterium polysaccharolyticum W8117	Isolate	Apidae
105	2044078006	Dendroctonus frontalis bacterial communities from Mississippi, USA	Metagenome	Curculionidae
106	2084038013	Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae	Metagenome	Cerambycidae
107	2556921622	Terasakiella pusilla DSM 6293	Isolate	Unclassified
108	2808606957	Bifidobacterium sp. ESL0447	Isolate	Unclassified
109	2821314491	Unclassified Actinobacteria Lab288P4bin49	Isolate	Unclassified
110	2847305884	Microbacterium protaetiae DFW100M-13	Isolate	Scarabaeidae
111	2861449170	Desulfovibrio intestinalis DSM 11275	Isolate	Unclassified
112	2864745180	Pseudomonas rhodesiae S00002	Isolate	Elmidae
113	2864773010	Tsukamurella ocularis S00022	Isolate	Elmidae
114	2885058212	Erwinia sp. OLTSP20	Isolate	Anthocoridae
115	2894981435	Leucobacter sp. OLDS2	Isolate	Anthocoridae
116	2931425734	Nocardioides sp. J2M5	Isolate
117	3300042601	Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463	Metagenome	Unclassified
118	8023724303	Caballeronia zhejiangensis LP003	Isolate	Coreidae
119	8024001094	Caballeronia sp. TF1N1	Isolate	Berytidae
120	8025694439	Caballeronia cordobensis LZ033	Isolate	Coreidae
121	8052469819	Pseudomonas putida DZ-F23	Isolate
122	8101967387	Caballeronia sp. AAUFL_F3_KS11A	Isolate	Coreidae
123	8102007614	Caballeronia sp. ATUFL_M1_KS5A	Isolate	Coreidae
124	8102041249	Caballeronia sp. GACF4	Isolate	Coreidae
125	8102087471	Caballeronia sp. GAWG2-1	Isolate	Coreidae
126	8102264549	Caballeronia sp. NCF2	Isolate	Coreidae
127	3300007141	Ant gut microbial communities from Cephalotes maculatus, Brazil	Metagenome	Formicidae
128	3300007188	Ant gut microbial communities from Cephalotes rohweri, Arizona, USA	Metagenome	Formicidae
129	3300012824	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG	Metagenome	Armadillidiidae
130	3300012835	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG	Metagenome	Culicidae
131	3300012837	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG	Metagenome	Armadillidiidae
132	3300012849	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG	Metagenome	Culicidae
133	3300012850	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG	Metagenome	Culicidae
134	3300012854	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG	Metagenome	Culicidae
135	2100351016	Sirex noctilio microbial communities from Pennsylvania, USA - adult community	Metagenome	Siricidae
136	2681813507	Insolitispirillum peregrinum integrum DSM 11589	Isolate	Unclassified
137	2684622920	Bifidobacterium asteroides Bi_200	Isolate	Unclassified
138	2687453742	Burkholderiales bacterium B_Cag20	Isolate	Unclassified
139	2744054871	Candidatus Arsenophonus triatominarum ATi	Isolate	Unclassified
140	2802429577	Bifidobacterium indicum DSM 20214	Isolate	Unclassified
141	2818991478	Micromonospora palomenae DSM 102131	Isolate	Pentatomidae
142	2833478085	Oceanospirillum multiglobuliferum ATCC 33336	Isolate	Unclassified
143	2841260384	Providencia alcalifaciens Dmel2	Isolate	Drosophilidae
144	2864918810	Tsukamurella ocularis S00175	Isolate	Elmidae
145	2864960361	Comamonas odontotermitis S00229	Isolate	Elmidae
146	2873614151	Leucobacter viscericola HDW9C	Isolate	Dytiscidae
147	2879643867	Bifidobacterium sp. wkB344	Isolate	Apidae
148	2885043073	Erwinia sp. OLSSP12	Isolate	Anthocoridae
149	2894897082	Leucobacter sp. OLCS4	Isolate	Anthocoridae
150	2894974975	Leucobacter sp. OLIS6	Isolate	Anthocoridae
151	2896187957	Providencia stuartii Crippen	Isolate	Calliphoridae
152	8023757577	Caballeronia peredens LP006	Isolate	Coreidae
153	8023764196	Caballeronia peredens LZ001	Isolate	Coreidae
154	8025678175	Caballeronia hypogeia LZ043	Isolate	Coreidae
155	8025747911	Caballeronia peredens LZ003	Isolate	Coreidae
156	8035321120	Pseudomonas prosekii A2-NA12	Isolate	Curculionidae
157	8068955631	Bartonella apihabitans M0280	Isolate	Apidae
158	8069755105	Caballeronia sp. LZ003	Isolate	Coreidae
159	8101951471	Caballeronia sp. AAUFL_F1_KS45	Isolate	Coreidae
160	8101974301	Caballeronia sp. ASUFL_F2_KS49	Isolate	Coreidae
161	8101981714	Caballeronia sp. ATUFL_F1_KS39	Isolate	Coreidae
162	8102026984	Caballeronia sp. AZ1_KS37	Isolate	Coreidae
163	8102067727	Caballeronia sp. GAFFF3	Isolate	Coreidae
164	3300002464	Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1	Metagenome	Culicidae
165	3300009784	Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4	Metagenome	Termitidae
166	3300012809	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG	Metagenome
167	3300012812	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG	Metagenome	Culicidae
168	3300012858	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG	Metagenome	Armadillidiidae
169	2508501043	Desulfovibrio termitidis HI1	Isolate	Rhinotermitidae
170	2597489944	Caballeronia insecticola RPE64	Isolate	Alydidae
171	2660238275	Bifidobacterium indicum DSM 20214	Isolate	Unclassified
172	2684622916	Bifidobacterium asteroides Bi_170	Isolate	Unclassified
173	2684622917	Bifidobacterium coryneforme Bi_197	Isolate	Unclassified
174	2693429521	Bifidobacterium coryneforme DSM 20216	Isolate	Unclassified
175	2788500098	Bombiscardovia coagulans DSM 22924	Isolate	Apidae
176	2816332114	Microbacterium saperdae DSM 20169	Isolate	Unclassified
177	2820829137	Unclassified Actinobacteria Nc150P5bin2	Isolate	Unclassified
178	2841330038	Sulfitobacter sp. D7	Isolate
179	2855798354	Achromobacter insolitus AR476-2	Isolate	Crambidae
180	2873620646	Leucobacter coleopterorum HDW9A	Isolate	Dytiscidae
181	2885050628	Erwinia sp. OLMTSP26	Isolate	Anthocoridae
182	2885061987	Erwinia sp. OLFS4	Isolate	Anthocoridae
183	2885065815	Erwinia sp. OAMSP11	Isolate	Anthocoridae
184	2894935787	Leucobacter sp. OLJS4	Isolate	Anthocoridae
185	2898991528	Erwinia sp. OLMDLW33	Isolate	Anthocoridae
186	2918394494	Microbacterium imperiale DSM 20530	Isolate	Unclassified
187	3300042624	Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50	Metagenome	Termopsidae
188	3300056842	Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2)	Metagenome	Tenebrionidae
189	8024982947	Bifidobacterium asteroides ESL0200	Isolate	Apidae
190	8035422605	Pseudomonas monteilii CY06	Isolate
191	8067483258	Ochrobactrum soli MTP-C0764	Isolate	Muscidae
192	8069763219	Caballeronia sp. LZ008	Isolate	Coreidae
193	8102001125	Caballeronia sp. ATUFL_F2_KS9A	Isolate	Coreidae
194	8102169119	Caballeronia sp. LZ016	Isolate	Coreidae
195	8102181083	Caballeronia sp. LZ025	Isolate	Coreidae
196	8102271933	Caballeronia sp. NCF4	Isolate	Coreidae
197	3003878002	Paraburkholderia sp. PGU19	Isolate	Largidae
198	3300005318	Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut	Metagenome	Drosophilidae
199	3300005721	Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176	Metagenome	Apidae
200	3300007067	Ant gut microbial communities from Cephalotes spinosus, Peru	Metagenome	Formicidae
201	3300007139	Ant gut microbial communities from Cephalotes pellans, Brazil	Metagenome	Formicidae
202	3300009826	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1	Metagenome	Termitidae
203	3300012820	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG	Metagenome	Armadillidiidae
204	3300012825	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG	Metagenome
205	3300012845	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG	Metagenome	Culicidae
206	3300012848	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG	Metagenome	Armadillidiidae
207	3300012861	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG	Metagenome	Culicidae
208	2032320009	Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine	Metagenome	Curculionidae
209	2513237174	Bifidobacterium asteroides ATCC 25910	Isolate	Apidae
210	2645727657	Bifidobacterium actinocoloniiforme DSM 22766	Isolate	Unclassified
211	2687453755	Pseudomonadales bacterium Cag27	Isolate	Unclassified
212	2824199081	Bifidobacterium commune DSM 28792	Isolate	Unclassified
213	2864870719	Comamonas odontotermitis S00124	Isolate	Elmidae
214	2865982043	Bifidobacterium aemilianum XV10	Isolate	Apidae
215	2871760914	Pantoea ananatis PANS 01-2	Isolate	Thripidae
216	2891720358	Azoarcus nasutitermitis CC-YHH838	Isolate	Unclassified
217	2894944011	Leucobacter sp. OLAS13	Isolate	Anthocoridae
218	2963630348	Burkholderiales bacterium 3487_49	Isolate	Formicidae
219	3300038395	Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut	Metagenome	Termitidae
220	3300042592	Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333	Metagenome	Termitidae
221	3300042598	Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382	Metagenome	Termitidae
222	3300042604	Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323	Metagenome	Termitidae
223	3300042610	Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337	Metagenome	Termitidae
224	3300042649	Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381	Metagenome	Termitidae
225	8025650824	Caballeronia hypogeia LZ032	Isolate	Coreidae
226	8025671076	Caballeronia cordobensis LZ034LL	Isolate	Coreidae
227	8025735396	Caballeronia zhejiangensis LZ016	Isolate	Coreidae
228	8062647588	Nissabacter archeti JGM97	Isolate	Drosophilidae
229	8077775691	Tsukamurella sp. PLM1	Isolate	Formicidae
230	8102047609	Caballeronia sp. GACF5	Isolate	Coreidae
231	8102074813	Caballeronia sp. GAWG1-1	Isolate	Coreidae
232	8102117041	Caballeronia sp. INML3	Isolate	Coreidae
233	8102131453	Caballeronia sp. INML5	Isolate	Coreidae
234	8102138357	Caballeronia sp. INSB1	Isolate	Coreidae
235	8102216467	Caballeronia sp. LZ033	Isolate	Coreidae
236	8102230706	Caballeronia sp. LZ035	Isolate	Coreidae
237	8102239244	Caballeronia sp. LZ043	Isolate	Coreidae
238	3300007130	Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut	Metagenome	Drosophilidae
239	3300012818	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG	Metagenome
240	3300012834	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG	Metagenome
241	3300012846	Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG	Metagenome	Armadillidiidae
242	3300012857	Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG	Metagenome	Culicidae
243	2568526170	Bifidobacterium sp. A11	Isolate	Apidae
244	2597489902	Providencia rettgeri Dmel1	Isolate	Drosophilidae
245	2600255079	Bifidobacterium bombi DSM 19703	Isolate	Apidae
246	2603880172	Burkholderiales C	Isolate	Unclassified
247	2684622919	Bifidobacterium asteroides Bi_199	Isolate	Unclassified
248	2687453756	Pseudomonadales bacterium Cag32	Isolate	Unclassified
249	2820834831	Unclassified Actinobacteria Lab288P4bin79	Isolate	Unclassified
250	2820840446	Unclassified Actinobacteria Lab288P4bin17	Isolate	Unclassified
251	2836714267	Shimwellia blattae NCTC10965	Isolate
252	2861945162	Microbacterium sp. AR7-10	Isolate	Culicidae
253	2873565274	Diaphorobacter sp. HDW4A	Isolate	Hydrophilidae
254	2873617540	Leucobacter insecticola HDW9B	Isolate	Dytiscidae
255	2888667245	Corynebacterium diphtheriae FRC0190	Isolate	Unclassified
256	2894900265	Leucobacter sp. OLTLW20	Isolate	Anthocoridae
257	2894929448	Leucobacter sp. OAMSW11	Isolate	Anthocoridae
258	3300042619	Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218	Metagenome	Termopsidae
259	3300042655	Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454	Metagenome	Termopsidae
260	637000219	Pseudomonas entomophila L48	Isolate	Unclassified
261	8024986378	Bifidobacterium asteroides ESL0198	Isolate	Apidae
262	8025658853	Caballeronia temeraria LZ065	Isolate	Coreidae
263	8025708040	Caballeronia jiangsuensis LZ029	Isolate	Coreidae
264	8032009961	Bifidobacterium indicum ESL0197	Isolate	Apidae
265	8033368880	Vibrio panuliri CAIM 1902	Isolate	Palinuridae
266	8035326735	Pseudomonas prosekii A2-NA13	Isolate	Curculionidae
267	8069770227	Caballeronia sp. LZ019	Isolate	Coreidae
268	8101994502	Caballeronia sp. ATUFL_F2_KS42	Isolate	Coreidae
269	8102124461	Caballeronia sp. INML3B	Isolate	Coreidae
270	8102193924	Caballeronia sp. LZ029	Isolate	Coreidae
271	8102312426	Caballeronia sp. AAUFL_F1_KS47	Isolate	Coreidae
272	8103002986	Erwinia sp. S38	Isolate	Curculionidae
273	8103008710	Erwinia sp. S43	Isolate	Curculionidae
274	2971189173	Yersinia pestis A-1249	Isolate	Unclassified
275	2972038244	Pseudomonas sp. DS1	Isolate	Formicidae
276	3007478678	Pseudomonas sp. S37	Isolate	Curculionidae
277	3300002504	Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4	Metagenome	Termitidae
278	3300007129	Ant gut microbial communities from Cephalotes atratus, Brazil	Metagenome	Formicidae
279	3300012803	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG	Metagenome
280	3300012805	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG	Metagenome
281	3300012814	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG	Metagenome
282	3300012815	Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG	Metagenome
283	3300026175	Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1	Metagenome	Formicidae

🔗 Scaffolds

#	Scaffold	Sample	Taxonomy	Length
1	SPBB_contig00033	2044078006	Unclassified	15909
2	SPBB_contig11411	2044078006	Bacteria	58715
3	SWWA_contig31666__length_22134___numreads_1377	2100351016	Bacteria	22134
4	JGI24705J35276_12225099	3300002504	Bacteria	2680
5	Ga0063521_1004964	3300003973	Bacteria	3138
6	Ga0103268_1000669	3300007192	Unclassified	9865
7	Ga0160453_101796	3300012814	Unclassified	6394
8	Ga0160440_100044	3300012815	Bacteria	176066
9	Ga0160469_101422	3300012824	Unclassified	6414
10	Ga0160446_100011	3300012835	Bacteria	308637
11	Ga0160455_101165	3300012837	Unclassified	8841
12	Ga0160443_101082	3300012848	Bacteria	11220
13	Ga0160430_101089	3300012852	Unclassified	11145
14	Ga0160435_1000128	3300012857	Bacteria	44445
15	Ga0466693_206930	3300042592	Bacteria	7026
16	Ga0466701_061049	3300042598	Bacteria	6976
17	Ga0123356_10054049	3300010049	Bacteria	3739
18	Ga0160470_100145	3300012813	Bacteria	71359
19	Ga0466735_083587	3300042624	Bacteria	2220
20	Ga0466724_66581	3300042649	Bacteria	665985
21	Ga0562378_0006	3300056814	Bacteria	1902205
22	DPO_contig00443	2032320009	Unclassified	5910
23	DPO_contig02306	2032320009	Unclassified	39083
24	AglaG_contig03863	2084038013	Bacteria	2252
25	JGI24699J35502_11119832	3300002509	Bacteria	3200
26	CVPL010W_10002329	3300002931	Bacteria	22290
27	CVPL010W_10002819	3300002931	Bacteria	20260
28	Ga0063521_1000093	3300003973	Bacteria	71254
29	Ga0063521_1002450	3300003973	Bacteria	4538
30	Ga0103266_1003531	3300007067	Bacteria	2204
31	Ga0102734_1000586	3300007129	Bacteria	10154
32	Ga0102738_1000540	3300007141	Unclassified	6250
33	Ga0160432_100861	3300012818	Bacteria	13501
34	Ga0160432_103771	3300012818	Bacteria	2026
35	Ga0160431_100013	3300012828	Bacteria	221352
36	Ga0160431_101006	3300012828	Unclassified	8626
37	Ga0160444_100247	3300012841	Unclassified	44623
38	Ga0160444_110953	3300012841	Unclassified	1099
39	Ga0160445_100006	3300012847	Bacteria	349790
40	Ga0160447_114966	3300012849	Unclassified	1456
41	Ga0255572_1000007	3300026175	Bacteria	235375
42	Ga0466701_035802	3300042598	Bacteria	68770
43	Ga0466701_048741	3300042598	Bacteria	4720
44	Ga0466707_228096	3300042601	Bacteria	68140
45	Ga0466698_513735	3300042610	Bacteria	1163
46	Ga0123355_10249085	3300009826	Unclassified	2504
47	Ga0466704_590183	3300042643	Bacteria	34538
48	Ga0466724_22252	3300042649	Bacteria	197662
49	HBC_ctgsDRAFT_1010858	3300000333	Bacteria	2173
50	JGI24699J35502_11120056	3300002509	Bacteria	3218
51	CVPL005W_1000979	3300002934	Bacteria	8832
52	Ga0103266_1000080	3300007067	Bacteria	51901
53	Ga0103260_1000885	3300007139	Bacteria	5592
54	Ga0123357_10001490	3300009784	Unclassified	24877
55	Ga0160469_100289	3300012824	Bacteria	34412
56	Ga0160446_100179	3300012835	Bacteria	46458
57	Ga0123355_10454208	3300009826	Bacteria	1612
58	Ga0466724_29713	3300042649	Bacteria	11454
59	Ga0466733_108669	3300042659	Bacteria	25589
60	Ga0562378_0151	3300056814	Bacteria	174366
61	DPO_contig08135	2032320009	Bacteria	11588
62	CVPL010W_10000640	3300002931	Bacteria	38354
63	Ga0102737_1007948	3300007142	Bacteria	1901
64	Ga0103264_1000182	3300007188	Bacteria	37428
65	Ga0160456_100826	3300012820	Unclassified	8396
66	Ga0160431_101563	3300012828	Unclassified	6389
67	Ga0160460_100026	3300012845	Bacteria	329165
68	Ga0160443_101624	3300012848	Unclassified	6929
69	Ga0160434_100939	3300012850	Bacteria	6087
70	Ga0160448_101370	3300012854	Bacteria	7862
71	Ga0160457_1008017	3300012858	Bacteria	1529
72	Ga0466701_073130	3300042598	Bacteria	6247
73	Ga0466701_099688	3300042598	Bacteria	43967
74	Ga0466707_165779	3300042601	Bacteria	177707
75	Ga0466717_005882	3300042604	Bacteria	1042
76	Ga0160466_100460	3300012809	Unclassified	20809
77	Ga0160471_103624	3300012812	Unclassified	2293
78	Ga0466729_298879	3300042621	Bacteria	94207
79	Ga0466725_155289	3300042654	Bacteria	1847
80	Ga0562377_0183	3300056842	Bacteria	165152
81	Ga0466726_096724	3300042619	Bacteria	86105
82	AglaG_contig12163	2084038013	Bacteria	1310
83	JGI24699J35502_11079032	3300002509	Bacteria	1946
84	Ga0104042_1124326	3300007130	Bacteria	1346
85	Ga0160467_101758	3300012829	Bacteria	6891
86	Ga0160452_100032	3300012834	Bacteria	218733
87	Ga0160433_100300	3300012846	Bacteria	32057
88	Ga0160443_100020	3300012848	Bacteria	410950
89	Ga0160443_100116	3300012848	Bacteria	126340
90	Ga0160457_1000085	3300012858	Bacteria	123382
91	Ga0466707_302603	3300042601	Bacteria	62986
92	Ga0466713_027305	3300042602	Bacteria	1350
93	Ga0123353_10265905	3300010167	Unclassified	2646
94	Ga0123354_10031072	3300010882	Bacteria	8381
95	Ga0123354_10069817	3300010882	Bacteria	5089
96	Ga0466729_268099	3300042621	Bacteria	126069
97	Ga0466730_051421	3300042625	Bacteria	2733
98	Ga0466724_04543	3300042649	Bacteria	3538
99	Ga0466705_076459	3300042612	Bacteria	9200
100	DPOL_contig00085	2035918003	Unclassified	5138
101	DPOL_contig14489	2035918003	Unclassified	19988
102	CVPL010W_10006742	3300002931	Bacteria	11620
103	Ga0074278_124576	3300005721	Bacteria	4471
104	Ga0102736_1000421	3300007052	Bacteria	8779
105	Ga0102736_1002530	3300007052	Bacteria	4101
106	Ga0102737_1005861	3300007142	Bacteria	2744
107	Ga0103264_1002703	3300007188	Bacteria	11937
108	Ga0160431_100792	3300012828	Bacteria	10532
109	Ga0160447_108636	3300012849	Bacteria	2416
110	Ga0160430_100987	3300012852	Unclassified	12182
111	Ga0160430_101559	3300012852	Unclassified	8359
112	Ga0160436_1011350	3300012861	Unclassified	1911
113	Ga0415639_190115	3300038395	Bacteria	1275
114	Ga0466657_015060	3300042582	Bacteria	16570
115	Ga0123357_10013077	3300009784	Bacteria	10739
116	Ga0123354_10002636	3300010882	Unclassified	23951
117	Ga0466704_288083	3300042643	Bacteria	14382
118	Ga0466705_223214	3300042612	Bacteria	4221
119	Ga0562378_0045	3300056814	Bacteria	393275
120	Ga0562374_1743	3300057007	Bacteria	23737
121	DPO_contig00888	2032320009	Bacteria	8349
122	SPBB_contig11554	2044078006	Unclassified	42966
123	SPBB_contig11640	2044078006	Unclassified	8255
124	FGTW_contig30745	2065487013	Unclassified	10073
125	SWWA_contig32622__length_855___numreads_13	2100351016	Unclassified	855
126	Meta3P_1004449	3300002464	Unclassified	11276
127	JGI24699J35502_11126156	3300002509	Bacteria	3912
128	Ga0102739_1000988	3300007095	Bacteria	4969
129	Ga0123357_10000106	3300009784	Bacteria	69720
130	Ga0160453_104473	3300012814	Bacteria	2549
131	Ga0160441_100447	3300012825	Bacteria	31779
132	Ga0160467_100014	3300012829	Bacteria	376035
133	Ga0160460_101079	3300012845	Bacteria	10855
134	Ga0160435_1011693	3300012857	Bacteria	1783
135	Ga0123357_10013924	3300009784	Bacteria	10471
136	Ga0123354_10001757	3300010882	Bacteria	27260
137	Ga0160465_101431	3300012803	Bacteria	6955
138	Ga0160464_100189	3300012805	Bacteria	62914
139	Ga0466730_086701	3300042625	Bacteria	2629
140	Ga0466724_52286	3300042649	Bacteria	68677
141	Meta3P_1002232	3300002464	Unclassified	7083
142	CVPL010W_10023769	3300002931	Bacteria	3578
143	Ga0074188_1040335	3300005318	Bacteria	1479
144	Ga0103266_1000092	3300007067	Bacteria	49685
145	Ga0103266_1000155	3300007067	Bacteria	21021
146	Ga0123357_10001374	3300009784	Bacteria	25767
147	Ga0160446_104698	3300012835	Bacteria	2013
148	Ga0160455_101805	3300012837	Bacteria	5492
149	Ga0160447_101353	3300012849	Bacteria	9642
150	Ga0160436_1013944	3300012861	Bacteria	1664
151	Ga0415639_170310	3300038395	Bacteria	7729
152	Ga0466657_003970	3300042582	Bacteria	9259
153	Ga0466701_038768	3300042598	Bacteria	86982
154	Ga0466713_016137	3300042602	Bacteria	1966
155	Ga0466713_018742	3300042602	Bacteria	3214
156	Ga0123356_10034981	3300010049	Unclassified	4695
157	Ga0466730_046886	3300042625	Bacteria	2741
158	Ga0466724_23164	3300042649	Unclassified	11339
159	Ga0466727_026844	3300042655	Bacteria	12823

📋 Family Sequences

#	Sample	Scaffold	Protein	Length (aa)
1	3300012805	Ga0160464_100189	Ga0160464_10018947	228
2	3300012812	Ga0160471_103624	Ga0160471_1036242	228
3	3300012849	Ga0160447_101353	Ga0160447_1013536	228
4	3300012848	Ga0160443_101624	Ga0160443_1016242	229
5	2032320009	DPO_contig08135	DPOB_402670	231
6	2035918003	DPOL_contig00085	DPOLB_401560	231
7	2044078006	SPBB_contig11554	SPBB_424120	231
8	2044078006	SPBB_contig11640	SPBB_663150	231
9	2065487013	FGTW_contig30745	FGTW_02995370	231
10	3300002464	Meta3P_1004449	Meta3P_100444910	232
11	3300012809	Ga0160466_100460	Ga0160466_10046020	232
12	3300012824	Ga0160469_100289	Ga0160469_10028927	232
13	3300012835	Ga0160446_100179	Ga0160446_10017911	232
14	3300012835	Ga0160446_104698	Ga0160446_1046982	232
15	3300012841	Ga0160444_100247	Ga0160444_1002471	232
16	3300012841	Ga0160444_110953	Ga0160444_1109532	232
17	3300012861	Ga0160436_1011350	Ga0160436_10113502	232
18	3300056842	Ga0562377_0183	Ga0562377_0183_33536_34261	232
19	3300005318	Ga0074188_1040335	Ga0074188_10403352	233
20	2084038013	AglaG_contig03863	AglaG_03888040	236
21	3300038395	Ga0415639_170310	Ga0415639_170310_793_1506	237
22	3300042612	Ga0466705_223214	Ga0466705_223214_3036_3794	240
23	iso_pr_bacteria	2556921622	2558101944	240
24	iso_pr_bacteria	2582581321	2585351937	240
25	iso_pr_bacteria	2833478085	2833479050	240
26	iso_pr_bacteria	2841330038	2841333500	240
27	3300042592	Ga0466693_206930	Ga0466693_206930_5495_6220	241
28	3300042598	Ga0466701_073130	Ga0466701_073130_2594_3319	241
29	3300042598	Ga0466701_099688	Ga0466701_099688_32675_33400	241
30	3300042601	Ga0466707_165779	Ga0466707_165779_98214_98939	241
31	3300042649	Ga0466724_04543	Ga0466724_04543_373_1098	241
32	iso_pr_bacteria	2529292851	2530234634	241
33	iso_pr_bacteria	2574179716	2574246461	241
34	iso_pr_bacteria	2597489902	2597922649	241
35	iso_pr_bacteria	2597489903	2597924566	241
36	iso_pr_bacteria	2597489944	2598056447	241
37	iso_pr_bacteria	2603880172	2606034070	241
38	iso_pr_bacteria	2651870110	2653797977	241
39	iso_pr_bacteria	2744054871	2745948012	241
40	iso_pr_bacteria	2836714267	2836717131	241
41	iso_pr_bacteria	2841260384	2841262443	241
42	iso_pr_bacteria	2850131454	2850132685	241
43	iso_pr_bacteria	2871760914	2871763088	241
44	iso_pr_bacteria	2896187957	2896188405	241
45	iso_pr_bacteria	2898991528	2898995675	241
46	iso_pr_bacteria	2971189173	2971191411	241
47	iso_pr_bacteria	3000861951	3000864920	241
48	iso_pr_bacteria	8001394582	8001395356	241
49	iso_pr_bacteria	8006199443	8006199825	241
50	iso_pr_bacteria	8023724303	8023728436	241
51	iso_pr_bacteria	8023747282	8023751589	241
52	iso_pr_bacteria	8023757577	8023761710	241
53	iso_pr_bacteria	8023764196	8023769221	241
54	iso_pr_bacteria	8024001094	8024001395	241
55	iso_pr_bacteria	8024025509	8024027967	241
56	iso_pr_bacteria	8024037630	8024037930	241
57	iso_pr_bacteria	8025650824	8025651140	241
58	iso_pr_bacteria	8025658853	8025659489	241
59	iso_pr_bacteria	8025671076	8025671369	241
60	iso_pr_bacteria	8025678175	8025678478	241
61	iso_pr_bacteria	8025685901	8025686535	241
62	iso_pr_bacteria	8025694439	8025694841	241
63	iso_pr_bacteria	8025708040	8025708409	241
64	iso_pr_bacteria	8025716094	8025716706	241
65	iso_pr_bacteria	8025723035	8025723329	241
66	iso_pr_bacteria	8025735396	8025735849	241
67	iso_pr_bacteria	8025740903	8025741195	241
68	iso_pr_bacteria	8025747911	8025748230	241
69	iso_pr_bacteria	8025756023	8025756342	241
70	iso_pr_bacteria	8062647588	8062650356	241
71	iso_pr_bacteria	8069748016	8069748724	241
72	iso_pr_bacteria	8069755105	8069755424	241
73	iso_pr_bacteria	8069763219	8069763511	241
74	iso_pr_bacteria	8069770227	8069774534	241
75	iso_pr_bacteria	8078130113	8078130414	241
76	iso_pr_bacteria	8099192374	8099195486	241
77	iso_pr_bacteria	8101951471	8101951805	241
78	iso_pr_bacteria	8101960468	8101960802	241
79	iso_pr_bacteria	8101967387	8101967721	241
80	iso_pr_bacteria	8101974301	8101974636	241
81	iso_pr_bacteria	8101981714	8101982108	241
82	iso_pr_bacteria	8101988189	8101988609	241
83	iso_pr_bacteria	8101994502	8101995111	241
84	iso_pr_bacteria	8102001125	8102001374	241
85	iso_pr_bacteria	8102007614	8102007939	241
86	iso_pr_bacteria	8102014801	8102015093	241
87	iso_pr_bacteria	8102026984	8102027421	241
88	iso_pr_bacteria	8102033761	8102034312	241
89	iso_pr_bacteria	8102041249	8102041540	241
90	iso_pr_bacteria	8102047609	8102048086	241
91	iso_pr_bacteria	8102060671	8102061057	241
92	iso_pr_bacteria	8102067727	8102068145	241
93	iso_pr_bacteria	8102074813	8102075166	241
94	iso_pr_bacteria	8102087471	8102087833	241
95	iso_pr_bacteria	8102094248	8102094863	241
96	iso_pr_bacteria	8102102351	8102102701	241
97	iso_pr_bacteria	8102109360	8102109695	241
98	iso_pr_bacteria	8102117041	8102117360	241
99	iso_pr_bacteria	8102124461	8102124983	241
100	iso_pr_bacteria	8102131453	8102132225	241
101	iso_pr_bacteria	8102138357	8102138666	241
102	iso_pr_bacteria	8102145433	8102149566	241
103	iso_pr_bacteria	8102152052	8102157077	241
104	iso_pr_bacteria	8102161003	8102165132	241
105	iso_pr_bacteria	8102169119	8102169572	241
106	iso_pr_bacteria	8102181083	8102181377	241
107	iso_pr_bacteria	8102186987	8102187599	241
108	iso_pr_bacteria	8102193924	8102194293	241
109	iso_pr_bacteria	8102208438	8102208754	241
110	iso_pr_bacteria	8102216467	8102216869	241
111	iso_pr_bacteria	8102223607	8102223900	241
112	iso_pr_bacteria	8102230706	8102231340	241
113	iso_pr_bacteria	8102239244	8102239547	241
114	iso_pr_bacteria	8102251710	8102252346	241
115	iso_pr_bacteria	8102264549	8102264971	241
116	iso_pr_bacteria	8102271933	8102272434	241
117	iso_pr_bacteria	8102279326	8102279642	241
118	iso_pr_bacteria	8102286609	8102287163	241
119	iso_pr_bacteria	8102312426	8102312761	241
120	iso_pr_bacteria	8103002986	8103005324	241
121	iso_pr_bacteria	8103008710	8103012755	241
122	2032320009	DPO_contig00888	DPOB_445960	242
123	3300000333	HBC_ctgsDRAFT_1010858	HBC_ctgsDRAFT_10108582	242
124	3300003973	Ga0063521_1000093	Ga0063521_100009335	242
125	3300007052	Ga0102736_1002530	Ga0102736_10025307	242
126	3300007067	Ga0103266_1000155	Ga0103266_10001552	242
127	3300007095	Ga0102739_1000988	Ga0102739_10009885	242
128	3300007139	Ga0103260_1000885	Ga0103260_10008853	242
129	3300007141	Ga0102738_1000540	Ga0102738_10005404	242
130	3300007142	Ga0102737_1007948	Ga0102737_10079482	242
131	3300007192	Ga0103268_1000669	Ga0103268_10006693	242
132	3300010882	Ga0123354_10031072	Ga0123354_100310725	242
133	3300012818	Ga0160432_100861	Ga0160432_1008615	242
134	3300012845	Ga0160460_100026	Ga0160460_100026272	242
135	3300012847	Ga0160445_100006	Ga0160445_10000659	242
136	3300026175	Ga0255572_1000007	Ga0255572_100000796	242
137	3300042610	Ga0466698_513735	Ga0466698_513735_80_808	242
138	3300056814	Ga0562378_0151	Ga0562378_0151_30890_31618	242
139	iso_pr_bacteria	2864755708	2864760770	242
140	iso_pr_bacteria	8023747282	8023751420	242
141	iso_pr_bacteria	8025735396	8025739535	242
142	iso_pr_bacteria	8025740903	8025747445	242
143	iso_pr_bacteria	8069763219	8069769761	242
144	iso_pr_bacteria	8069770227	8069774365	242
145	iso_pr_bacteria	8102169119	8102173258	242
146	3300012850	Ga0160434_100939	Ga0160434_1009393	243
147	iso_pr_bacteria	2508501043	2508702028	243
148	2032320009	DPO_contig00443	DPOB_523290	244
149	2032320009	DPO_contig02306	DPOB_327080	244
150	2035918003	DPOL_contig14489	DPOLB_809790	244
151	2044078006	SPBB_contig00033	SPBB_216290	244
152	2044078006	SPBB_contig11411	SPBB_209650	244
153	2100351016	SWWA_contig31666__length_22134___numreads_1377	SWWA_01999610	244
154	2100351016	SWWA_contig32622__length_855___numreads_13	SWWA_01838990	244
155	3300042649	Ga0466724_23164	Ga0466724_23164_9569_10303	244
156	iso_pr_bacteria	2511231129	2511733534	244
157	iso_pr_bacteria	2519899622	2520392517	244
158	iso_pr_bacteria	2864745180	2864746824	244
159	iso_pr_bacteria	2864853652	2864856601	244
160	iso_pr_bacteria	2880115952	2880120400	244
161	iso_pr_bacteria	2891720358	2891721882	244
162	iso_pr_bacteria	2972038244	2972039071	244
163	iso_pr_bacteria	637000219	638003939	244
164	iso_pr_bacteria	8033364368	8033367801	244
165	iso_pr_bacteria	8033368880	8033370198	244
166	iso_pr_bacteria	8035321120	8035324487	244
167	iso_pr_bacteria	8035326735	8035328980	244
168	3300002464	Meta3P_1002232	Meta3P_10022321	245
169	3300007130	Ga0104042_1124326	Ga0104042_11243262	245
170	3300012813	Ga0160470_100145	Ga0160470_10014516	245
171	3300012814	Ga0160453_101796	Ga0160453_1017968	245
172	3300012820	Ga0160456_100826	Ga0160456_1008268	245
173	3300012824	Ga0160469_101422	Ga0160469_1014223	245
174	3300012828	Ga0160431_101563	Ga0160431_1015638	245
175	3300012829	Ga0160467_101758	Ga0160467_1017588	245
176	3300012837	Ga0160455_101165	Ga0160455_1011658	245
177	3300012846	Ga0160433_100300	Ga0160433_10030015	245
178	3300012852	Ga0160430_101089	Ga0160430_1010897	245
179	3300042643	Ga0466704_590183	Ga0466704_590183_1407_2162	245
180	3300002931	CVPL010W_10002819	CVPL010W_100028193	246
181	3300007067	Ga0103266_1000092	Ga0103266_100009239	246
182	3300007129	Ga0102734_1000586	Ga0102734_100058610	246
183	3300042612	Ga0466705_076459	Ga0466705_076459_4997_5755	246
184	3300042659	Ga0466733_108669	Ga0466733_108669_8034_8774	246
185	iso_pr_bacteria	2864870719	2864872050	246
186	iso_pr_bacteria	2864960361	2864961789	246
187	iso_pr_bacteria	2873589062	2873590869	246
188	iso_pr_bacteria	2963630348	2963633148	246
189	iso_pr_bacteria	8116627632	8116633066	246
190	3300002931	CVPL010W_10023769	CVPL010W_100237693	247
191	3300042598	Ga0466701_035802	Ga0466701_035802_9943_10686	247
192	3300042598	Ga0466701_038768	Ga0466701_038768_64999_65742	247
193	3300042621	Ga0466729_268099	Ga0466729_268099_27987_28730	247
194	3300042649	Ga0466724_29713	Ga0466724_29713_9684_10427	247
195	3300042649	Ga0466724_52286	Ga0466724_52286_1742_2485	247
196	iso_pr_bacteria	2855798354	2855800694	247
197	iso_pr_bacteria	2873571580	2873574019	247
198	iso_pr_bacteria	3007473699	3007477193	247
199	iso_pr_bacteria	3007478678	3007482408	247
200	iso_pr_bacteria	8011329375	8011331135	247
201	iso_pr_bacteria	8035422605	8035425427	247
202	iso_pr_bacteria	8052469819	8052473764	247
203	3300012803	Ga0160465_101431	Ga0160465_1014312	248
204	3300012815	Ga0160440_100044	Ga0160440_100044176	248
205	3300012828	Ga0160431_100013	Ga0160431_100013107	248
206	3300012829	Ga0160467_100014	Ga0160467_100014277	248
207	3300012835	Ga0160446_100011	Ga0160446_100011280	248
208	3300012848	Ga0160443_100116	Ga0160443_10011639	248
209	3300012858	Ga0160457_1008017	Ga0160457_10080172	248
210	3300042582	Ga0466657_015060	Ga0466657_015060_7745_8491	248
211	3300042601	Ga0466707_228096	Ga0466707_228096_14703_15449	248
212	3300042619	Ga0466726_096724	Ga0466726_096724_2678_3424	248
213	3300042621	Ga0466729_298879	Ga0466729_298879_37808_38554	248
214	3300042649	Ga0466724_22252	Ga0466724_22252_48439_49185	248
215	iso_pr_bacteria	2508501043	2508699907	248
216	iso_pr_bacteria	2816332114	2816397316	248
217	iso_pr_bacteria	2818991478	2819788649	248
218	iso_pr_bacteria	2873565274	2873569997	248
219	iso_pr_bacteria	2873614151	2873614594	248
220	iso_pr_bacteria	2873617540	2873619809	248
221	iso_pr_bacteria	2873620646	2873622592	248
222	iso_pr_bacteria	2894897082	2894898173	248
223	iso_pr_bacteria	2894900265	2894903234	248
224	iso_pr_bacteria	2894926108	2894926264	248
225	iso_pr_bacteria	2894929448	2894932226	248
226	iso_pr_bacteria	2894932631	2894935301	248
227	iso_pr_bacteria	2894935787	2894935962	248
228	iso_pr_bacteria	2894944011	2894946534	248
229	iso_pr_bacteria	2894966443	2894969211	248
230	iso_pr_bacteria	2894974975	2894976938	248
231	iso_pr_bacteria	2894981435	2894984292	248
232	3300038395	Ga0415639_190115	Ga0415639_190115_323_1072	249
233	iso_pr_bacteria	2524023214	2524489673	249
234	iso_pr_bacteria	2751185856	2753592407	249
235	iso_pr_bacteria	2861449170	2861449272	249
236	iso_pr_bacteria	2861945162	2861946991	249
237	iso_pr_bacteria	3003878002	3003886559	249
238	iso_pr_bacteria	8030347546	8030349611	249
239	iso_pr_bacteria	8068955631	8068955839	249
240	2084038013	AglaG_contig12163	AglaG_00839660	250
241	3300007067	Ga0103266_1003531	Ga0103266_10035312	250
242	3300012818	Ga0160432_103771	Ga0160432_1037712	250
243	3300012828	Ga0160431_100792	Ga0160431_10079214	250
244	3300012837	Ga0160455_101805	Ga0160455_1018055	250
245	3300012849	Ga0160447_108636	Ga0160447_1086363	250
246	3300012852	Ga0160430_101559	Ga0160430_1015595	250
247	3300042602	Ga0466713_016137	Ga0466713_016137_1078_1830	250
248	iso_pr_bacteria	2556921622	2558101539	250
249	iso_pr_bacteria	2861449170	2861450176	250
250	3300042602	Ga0466713_018742	Ga0466713_018742_587_1342	251
251	3300042604	Ga0466717_005882	Ga0466717_005882_203_958	251
252	3300042625	Ga0466730_051421	Ga0466730_051421_1045_1800	251
253	3300042654	Ga0466725_155289	Ga0466725_155289_541_1296	251
254	3300056814	Ga0562378_0006	Ga0562378_0006_1535917_1536672	251
255	3300056814	Ga0562378_0045	Ga0562378_0045_350513_351268	251
256	3300057007	Ga0562374_1743	Ga0562374_1743_1843_2598	251
257	iso_pr_bacteria	2820834831	2820835158	251
258	3300003973	Ga0063521_1002450	Ga0063521_10024504	252
259	3300007052	Ga0102736_1000421	Ga0102736_10004218	252
260	3300009826	Ga0123355_10249085	Ga0123355_102490853	252
261	3300010049	Ga0123356_10034981	Ga0123356_100349812	252
262	3300042655	Ga0466727_026844	Ga0466727_026844_5028_5786	252
263	iso_pr_bacteria	2885043073	2885046386	252
264	iso_pr_bacteria	2885046828	2885050169	252
265	iso_pr_bacteria	2885050628	2885054014	252
266	iso_pr_bacteria	2885054481	2885057624	252
267	iso_pr_bacteria	2885058212	2885061701	252
268	iso_pr_bacteria	2885061987	2885065183	252
269	iso_pr_bacteria	2885065815	2885069178	252
270	3300007188	Ga0103264_1002703	Ga0103264_10027038	253
271	3300042598	Ga0466701_061049	Ga0466701_061049_1635_2396	253
272	3300042625	Ga0466730_086701	Ga0466730_086701_1853_2614	253
273	3300002931	CVPL010W_10000640	CVPL010W_100006408	254
274	3300002931	CVPL010W_10002329	CVPL010W_1000232916	254
275	3300002934	CVPL005W_1000979	CVPL005W_10009796	254
276	3300007188	Ga0103264_1000182	Ga0103264_100018225	254
277	iso_pr_bacteria	2556921669	2558278213	254
278	iso_pr_bacteria	8067483258	8067486330	254
279	iso_pr_bacteria	8067483258	8067487712	254
280	3300007067	Ga0103266_1000080	Ga0103266_10000804	255
281	3300012825	Ga0160441_100447	Ga0160441_10044728	255
282	3300042602	Ga0466713_027305	Ga0466713_027305_421_1188	255
283	iso_pr_bacteria	2681813507	2684383682	255
284	iso_pr_bacteria	2888667245	2888669447	255
285	iso_pr_bacteria	8067483258	8067484480	255
286	3300007142	Ga0102737_1005861	Ga0102737_10058611	256
287	3300012845	Ga0160460_101079	Ga0160460_1010798	256
288	3300042643	Ga0466704_288083	Ga0466704_288083_11446_12216	256
289	3300042649	Ga0466724_66581	Ga0466724_66581_296065_296835	256
290	iso_pr_bacteria	2864773010	2864773477	256
291	iso_pr_bacteria	2864918810	2864920629	256
292	iso_pr_bacteria	2864964650	2864965117	256
293	iso_pr_bacteria	8077775691	8077777732	256
294	iso_pr_bacteria	2687453742	2689987466	257
295	iso_pr_bacteria	2687453753	2690039792	257
296	iso_pr_bacteria	2687453754	2690042072	257
297	iso_pr_bacteria	2687453755	2690044807	257
298	iso_pr_bacteria	2687453756	2690047317	257
299	iso_pr_bacteria	2918390780	2918394175	257
300	3300003973	Ga0063521_1004964	Ga0063521_10049644	258
301	3300012848	Ga0160443_100020	Ga0160443_100020102	258
302	iso_pr_bacteria	2820909719	2820910134	258
303	iso_pr_bacteria	2821314491	2821316162	258
304	iso_pr_bacteria	2855798354	2855804296	258
305	iso_pr_bacteria	2931425734	2931426171	258
306	3300009784	Ga0123357_10000106	Ga0123357_1000010633	259
307	3300009784	Ga0123357_10001374	Ga0123357_1000137421	259
308	3300009784	Ga0123357_10001490	Ga0123357_1000149021	259
309	3300009784	Ga0123357_10013077	Ga0123357_100130776	259
310	3300009784	Ga0123357_10013924	Ga0123357_100139245	259
311	3300010167	Ga0123353_10265905	Ga0123353_102659053	259
312	3300010882	Ga0123354_10069817	Ga0123354_100698172	259
313	3300012848	Ga0160443_101082	Ga0160443_10108211	259
314	3300012861	Ga0160436_1013944	Ga0160436_10139442	259
315	3300042582	Ga0466657_003970	Ga0466657_003970_5380_6159	259
316	iso_pr_bacteria	2820829137	2820830276	259
317	3300002509	JGI24699J35502_11079032	JGI24699J35502_110790322	260
318	3300002509	JGI24699J35502_11126156	JGI24699J35502_111261564	260
319	iso_pr_bacteria	2582581321	2585352791	260
320	iso_pr_bacteria	2824199081	2824199163	260
321	iso_pr_bacteria	2833478085	2833481690	260
322	3300009826	Ga0123355_10454208	Ga0123355_104542083	261
323	3300010049	Ga0123356_10054049	Ga0123356_100540493	261
324	3300002931	CVPL010W_10006742	CVPL010W_1000674211	262
325	3300010882	Ga0123354_10002636	Ga0123354_1000263615	262
326	3300002504	JGI24705J35276_12225099	JGI24705J35276_122250993	263
327	3300012849	Ga0160447_114966	Ga0160447_1149662	263
328	3300042625	Ga0466730_046886	Ga0466730_046886_1250_2041	263
329	iso_pr_bacteria	2847305884	2847308560	263
330	iso_pr_bacteria	2918394494	2918395415	263
331	3300012834	Ga0160452_100032	Ga0160452_10003285	265
332	3300012858	Ga0160457_1000085	Ga0160457_100008528	265
333	iso_pr_bacteria	2820840446	2820840774	265
334	3300042598	Ga0466701_048741	Ga0466701_048741_1345_2145	266
335	3300042601	Ga0466707_302603	Ga0466707_302603_48271_49071	266
336	iso_pr_bacteria	2788500098	2789513784	266
337	3300002509	JGI24699J35502_11120056	JGI24699J35502_111200562	267
338	iso_pr_bacteria	3003178663	3003181246	267
339	3300002509	JGI24699J35502_11119832	JGI24699J35502_111198322	269
340	iso_pr_bacteria	2597490239	2598797252	269
341	iso_pr_bacteria	2600255079	2600868005	269
342	iso_pr_bacteria	2663763384	2666812190	269
343	iso_pr_bacteria	2865983822	2865984938	269
344	iso_pr_bacteria	2645727657	2646405360	270
345	iso_pr_bacteria	2597490194	2598674117	271
346	iso_pr_bacteria	2660238275	2661718591	271
347	iso_pr_bacteria	2684622917	2686084110	271
348	iso_pr_bacteria	2693429521	2693516151	271
349	iso_pr_bacteria	2802429577	2805813693	271
350	iso_pr_bacteria	2879643867	2879645227	271
351	iso_pr_bacteria	8032009961	8032010497	271
352	3300012814	Ga0160453_104473	Ga0160453_1044732	272
353	3300012828	Ga0160431_101006	Ga0160431_1010066	272
354	3300012852	Ga0160430_100987	Ga0160430_10098714	272
355	3300012854	Ga0160448_101370	Ga0160448_1013709	272
356	3300012857	Ga0160435_1011693	Ga0160435_10116932	272
357	iso_pr_bacteria	2865982043	2865982157	272
358	3300012857	Ga0160435_1000128	Ga0160435_100012825	274
359	iso_pr_bacteria	2513237174	2514075427	284
360	iso_pr_bacteria	2519899775	2520952627	284
361	iso_pr_bacteria	2568526170	2569120478	284
362	iso_pr_bacteria	2671180601	2673428280	284
363	iso_pr_bacteria	2684622916	2686082457	284
364	iso_pr_bacteria	2684622918	2686085650	284
365	iso_pr_bacteria	2684622919	2686087446	284
366	iso_pr_bacteria	2808606957	2811755927	284
367	iso_pr_bacteria	8024981139	8024981799	284
368	iso_pr_bacteria	8024984606	8024985257	284
369	iso_pr_bacteria	8024986378	8024987050	284
370	iso_pr_bacteria	8110340172	8110341122	284
371	iso_pr_bacteria	8110341875	8110342256	284
372	3300005721	Ga0074278_124576	Ga0074278_1245764	285
373	3300010882	Ga0123354_10001757	Ga0123354_1000175718	288
374	iso_pr_bacteria	2684622920	2686089130	288
375	iso_pr_bacteria	8024982947	8024983542	288
376	3300042624	Ga0466735_083587	Ga0466735_083587_1124_2026	300

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM ID	Name	Description	Start	End	Accuracy
PF00005	ABC_tran	ABC transporter	67	210	0.93
PF13304	AAA_21	AAA domain, putative AbiEii toxin, Type IV TA system	178	241	0.84
PF02463	SMC_N	RecF/RecN/SMC N terminal domain	78	251	0.77
PF13191	AAA_16	AAA ATPase domain	75	207	0.61
PF13401	AAA_22	AAA domain	78	172	0.52

🌐 Gene Ontology Annotation

PFAM	GO Term	Description	Category
PF13401	GO:0016887	ATP hydrolysis activity	MF

⚛️ Structure & Feature Viewer

pLDDT	pTM	Quality
0.82	0.9	High

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.