Protein Family IF03451

Metagenome Isolate
152 Members
57 Samples
137 Scaffolds
229.57 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10000458|Ga0123354_1000045829
Length
263 aa
Sequence
LNINGYTFEAFLPFSLENISEIECYMECASRKYPGHSAVIMALICFLSTTAAVAQEYKYEIGGSAGLSMYMGDANQSALLRGFNPAGGLVFRRNFNFRWALKTDLMIGKITGDTKNTENVFPNQGEASFSRTFFEIGGQTEFNFLPYSDKFAYLNTSKIAPYLLSGLGITAAPGTNRTFVGVHFSLGAGVKYKVRNRINLGMEYAVHKLFNDSFDAPNKEGFGLDNPYHIQSGLFKNKDWYNTLMFSVTWDFGPNDRKCTNE*

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 26.8%
Kalotermitidae 25.0%
Blattidae 16.1%
Unclassified 12.5%
Rhinotermitidae 7.1%
Termopsidae 7.1%
Passalidae 5.4%

🌳 Taxonomy

Archaea 0
Bacteria 142
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
2 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
10 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
11 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
12 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
13 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
16 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
19 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
20 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
21 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
22 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
25 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
26 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
27 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
28 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
29 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
30 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
31 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
32 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
33 2910959314 Dysgonomonas sp. 511 Isolate Blattidae
34 2923982719 Parabacteroides sp. 52 Isolate Blattidae
35 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
40 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
50 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
51 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
52 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
53 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
54 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
55 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
56 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
57 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_043093 3300042612 Bacteria 9025
2 Ga0466726_329892 3300042619 Bacteria 2615
3 Ga0466703_287337 3300042636 Bacteria 2262
4 Ga0466708_172971 3300042652 Bacteria 8554
5 Ga0466727_325914 3300042655 Bacteria 9208
6 Ga0466707_234828 3300042601 Bacteria 7158
7 Ga0466713_091714 3300042602 Bacteria 189911
8 Ga0466719_260307 3300042606 Bacteria 4508
9 2227066938 2225789003 Bacteria 3148
10 JGI24699J35502_11134035 3300002509 Bacteria 25887
11 Ga0068305_10034950 3300005083 Unclassified 5042
12 Ga0068305_10472138 3300005083 Unclassified 4729
13 Ga0123357_10000787 3300009784 Bacteria 32023
14 Ga0466733_197998 3300042659 Bacteria 7532
15 Ga0466711_096187 3300042615 Bacteria 1770
16 Ga0466715_497593 3300042616 Bacteria 37962
17 Ga0466723_001361 3300042618 Bacteria 10124
18 Ga0466726_024523 3300042619 Bacteria 4994
19 Ga0466729_099483 3300042621 Bacteria 41214
20 Ga0123357_10010391 3300009784 Bacteria 11836
21 Ga0123356_10008869 3300010049 Bacteria 9954
22 Ga0123354_10006042 3300010882 Bacteria 17852
23 Ga0123354_10188498 3300010882 Bacteria 2321
24 Ga0466690_185521 3300042590 Bacteria 30034
25 Ga0466690_216745 3300042590 Bacteria 23549
26 Ga0466692_118376 3300042591 Bacteria 10859
27 Ga0466701_014469 3300042598 Bacteria 1526
28 Ga0466735_002450 3300042624 Bacteria 6642
29 Ga0466704_045307 3300042643 Bacteria 4459
30 Ga0466709_018758 3300042648 Bacteria 13325
31 Ga0466700_058504 3300042600 Bacteria 32871
32 Ga0466700_112686 3300042600 Bacteria 21617
33 Ga0466707_037465 3300042601 Bacteria 2612
34 Ga0466713_038979 3300042602 Bacteria 83101
35 Ga0466719_053407 3300042606 Bacteria 18979
36 Ga0466719_542956 3300042606 Bacteria 5164
37 Ga0466722_163169 3300042609 Bacteria 19178
38 2227541300 2225789004 Bacteria 15639
39 Ga0466733_075256 3300042659 Bacteria 1870
40 Ga0466733_145317 3300042659 Unclassified 4830
41 Ga0466711_180096 3300042615 Unclassified 23272
42 Ga0466711_236714 3300042615 Bacteria 18403
43 Ga0466715_149260 3300042616 Bacteria 1121
44 Ga0123357_10265164 3300009784 Bacteria 1807
45 Ga0466692_061204 3300042591 Bacteria 5151
46 Ga0466696_128038 3300042596 Bacteria 6937
47 Ga0466734_154301 3300042623 Bacteria 3826
48 Ga0466703_254723 3300042636 Bacteria 12800
49 Ga0466709_309597 3300042648 Bacteria 40669
50 Ga0466713_062540 3300042602 Bacteria 9887
51 Ga0466716_259952 3300042605 Bacteria 5711
52 Ga0466719_520472 3300042606 Bacteria 5754
53 2227266902 2225789004 Bacteria 6953
54 IMNBL1DRAFT_c0000975 3300000062 Bacteria 22090
55 Ga0466733_100739 3300042659 Bacteria 15317
56 Ga0466711_109799 3300042615 Bacteria 7548
57 Ga0466729_183964 3300042621 Bacteria 7155
58 Ga0123357_10003925 3300009784 Bacteria 17272
59 Ga0123357_10119754 3300009784 Unclassified 3321
60 Ga0123357_10628816 3300009784 Bacteria 807
61 Ga0466696_012607 3300042596 Bacteria 6679
62 Ga0466708_348735 3300042652 Bacteria 36830
63 Ga0466700_156640 3300042600 Bacteria 23709
64 Ga0466707_096168 3300042601 Bacteria 11351
65 Ga0466707_149294 3300042601 Bacteria 10479
66 Ga0466722_056837 3300042609 Bacteria 4959
67 Ga0466722_155549 3300042609 Bacteria 11886
68 Ga0123357_10001231 3300009784 Bacteria 26869
69 Ga0466705_397833 3300042612 Bacteria 11678
70 Ga0466715_194856 3300042616 Bacteria 22933
71 Ga0466715_224707 3300042616 Unclassified 19215
72 Ga0466726_165433 3300042619 Bacteria 15218
73 Ga0123357_10009557 3300009784 Bacteria 12247
74 Ga0123353_10043806 3300010167 Bacteria 7092
75 Ga0123354_10048319 3300010882 Bacteria 6472
76 Ga0123354_10177061 3300010882 Unclassified 2453
77 Ga0466693_132179 3300042592 Bacteria 1466
78 Ga0466735_018360 3300042624 Bacteria 3225
79 Ga0466703_306816 3300042636 Bacteria 6824
80 Ga0466704_575482 3300042643 Bacteria 4038
81 Ga0466707_008342 3300042601 Bacteria 15169
82 Ga0466713_099033 3300042602 Bacteria 1110
83 Ga0466722_109642 3300042609 Bacteria 9365
84 IMNBL1DRAFT_c0008505 3300000062 Bacteria 5215
85 JGI24699J35502_11134117 3300002509 Bacteria 33021
86 Ga0466697_133863 3300042611 Bacteria 5422
87 Ga0466711_049091 3300042615 Bacteria 25116
88 Ga0466715_374257 3300042616 Bacteria 10809
89 Ga0466728_141584 3300042620 Bacteria 11233
90 Ga0123357_10089879 3300009784 Unclassified 4008
91 Ga0123354_10010405 3300010882 Bacteria 14326
92 Ga0123354_10274034 3300010882 Bacteria 1654
93 Ga0466692_157293 3300042591 Bacteria 55644
94 Ga0466692_173525 3300042591 Bacteria 2885
95 Ga0466694_006315 3300042594 Bacteria 1179
96 Ga0466704_186888 3300042643 Bacteria 12934
97 Ga0466709_133488 3300042648 Bacteria 69029
98 Ga0466727_118531 3300042655 Bacteria 4066
99 Ga0466707_220247 3300042601 Bacteria 7948
100 Ga0466716_467442 3300042605 Bacteria 25909
101 IMNBL1DRAFT_c0000119 3300000062 Bacteria 71190
102 JGI24702J35022_10008203 3300002462 Bacteria 5929
103 JGI24699J35502_11134138 3300002509 Bacteria 36202
104 Ga0072941_1097517 3300005201 Bacteria 1345
105 Ga0123357_10000375 3300009784 Bacteria 42298
106 Ga0466733_015574 3300042659 Bacteria 3205
107 Ga0123357_10021213 3300009784 Bacteria 8696
108 Ga0123354_10000458 3300010882 Bacteria 40359
109 Ga0123354_10036002 3300010882 Bacteria 7724
110 Ga0123354_10230834 3300010882 Bacteria 1935
111 Ga0466691_115668 3300042593 Bacteria 14219
112 Ga0466694_051997 3300042594 Bacteria 2381
113 Ga0466703_186435 3300042636 Bacteria 25415
114 Ga0466727_235389 3300042655 Bacteria 27915
115 Ga0466719_172039 3300042606 Bacteria 5339
116 2227582984 2225789004 Unclassified 2491
117 2227659898 2225789004 Bacteria 1954
118 IMNBL1DRAFT_c0000748 3300000062 Bacteria 25790
119 JGI24702J35022_10000676 3300002462 Bacteria 20761
120 JGI24705J35276_12235304 3300002504 Bacteria 6389
121 Ga0466710_222176 3300042613 Bacteria 1178
122 Ga0466715_043485 3300042616 Bacteria 21637
123 Ga0123357_10042483 3300009784 Bacteria 6182
124 Ga0123354_10002122 3300010882 Bacteria 25659
125 Ga0123354_10186431 3300010882 Bacteria 2344
126 Ga0466693_169304 3300042592 Bacteria 1485
127 Ga0466729_290129 3300042621 Bacteria 6069
128 Ga0466735_138089 3300042624 Bacteria 1935
129 Ga0466735_217611 3300042624 Bacteria 5726
130 Ga0466703_126683 3300042636 Bacteria 1060
131 Ga0466704_236177 3300042643 Bacteria 26887
132 Ga0466704_482235 3300042643 Bacteria 12517
133 Ga0466727_154212 3300042655 Bacteria 9784
134 Ga0466701_043672 3300042598 Bacteria 1218
135 2227203021 2225789004 Bacteria 7746
136 Ga0068302_10125648 3300005071 Unclassified 3665
137 Ga0123357_10000572 3300009784 Bacteria 36340

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042594 Ga0466694_006315 Ga0466694_006315_317_985 192
2 3300009784 Ga0123357_10628816 Ga0123357_106288161 193
3 3300042609 Ga0466722_056837 Ga0466722_056837_2706_3371 195
4 3300042643 Ga0466704_045307 Ga0466704_045307_3130_3786 195
5 3300042616 Ga0466715_043485 Ga0466715_043485_12225_12932 208
6 3300042598 Ga0466701_014469 Ga0466701_014469_256_966 209
7 3300042621 Ga0466729_183964 Ga0466729_183964_927_1640 210
8 3300042636 Ga0466703_287337 Ga0466703_287337_44_691 210
9 3300042643 Ga0466704_236177 Ga0466704_236177_18823_19533 210
10 3300009784 Ga0123357_10010391 Ga0123357_100103912 211
11 2225789003 2227066938 2227425445 212
12 3300042605 Ga0466716_259952 Ga0466716_259952_2801_3514 212
13 3300000062 IMNBL1DRAFT_c0000748 IMNBL1DRAFT_000074814 213
14 3300042609 Ga0466722_155549 Ga0466722_155549_2902_3612 214
15 3300042659 Ga0466733_100739 Ga0466733_100739_4745_5449 214
16 3300009784 Ga0123357_10001231 Ga0123357_1000123119 215
17 3300042606 Ga0466719_520472 Ga0466719_520472_1557_2204 215
18 3300042636 Ga0466703_186435 Ga0466703_186435_15290_16000 215
19 3300042643 Ga0466704_482235 Ga0466704_482235_8748_9458 215
20 3300042609 Ga0466722_163169 Ga0466722_163169_3110_3820 216
21 3300042611 Ga0466697_133863 Ga0466697_133863_3501_4151 216
22 3300042636 Ga0466703_306816 Ga0466703_306816_1405_2094 216
23 3300009784 Ga0123357_10021213 Ga0123357_100212133 217
24 3300010882 Ga0123354_10230834 Ga0123354_102308342 217
25 3300042596 Ga0466696_128038 Ga0466696_128038_731_1384 217
26 3300042652 Ga0466708_348735 Ga0466708_348735_6404_7057 217
27 3300042659 Ga0466733_075256 Ga0466733_075256_683_1387 217
28 3300042600 Ga0466700_112686 Ga0466700_112686_14005_14715 218
29 3300042616 Ga0466715_224707 Ga0466715_224707_1351_2061 218
30 3300042648 Ga0466709_133488 Ga0466709_133488_52983_53693 218
31 3300042659 Ga0466733_145317 Ga0466733_145317_417_1127 218
32 3300042598 Ga0466701_043672 Ga0466701_043672_346_1005 219
33 3300042615 Ga0466711_236714 Ga0466711_236714_4727_5449 219
34 3300042643 Ga0466704_186888 Ga0466704_186888_7718_8377 219
35 3300005083 Ga0068305_10034950 Ga0068305_100349503 220
36 3300042592 Ga0466693_169304 Ga0466693_169304_155_817 220
37 3300042624 Ga0466735_018360 Ga0466735_018360_642_1304 220
38 iso_pr_bacteria 2820759988 2820761524 220
39 3300000062 IMNBL1DRAFT_c0000975 IMNBL1DRAFT_000097510 221
40 3300002509 JGI24699J35502_11134138 JGI24699J35502_111341389 221
41 3300010049 Ga0123356_10008869 Ga0123356_1000886910 221
42 3300002462 JGI24702J35022_10000676 JGI24702J35022_1000067612 222
43 3300002509 JGI24699J35502_11134035 JGI24699J35502_111340359 222
44 3300042601 Ga0466707_037465 Ga0466707_037465_246_914 222
45 3300042612 Ga0466705_043093 Ga0466705_043093_79_789 223
46 3300042636 Ga0466703_254723 Ga0466703_254723_3713_4423 224
47 3300042591 Ga0466692_061204 Ga0466692_061204_52_747 226
48 3300010167 Ga0123353_10043806 Ga0123353_100438062 227
49 3300010882 Ga0123354_10188498 Ga0123354_101884982 227
50 3300042591 Ga0466692_173525 Ga0466692_173525_949_1632 227
51 3300042643 Ga0466704_575482 Ga0466704_575482_2284_2967 227
52 3300042591 Ga0466692_118376 Ga0466692_118376_7172_7861 229
53 3300042600 Ga0466700_156640 Ga0466700_156640_6913_7602 229
54 3300042606 Ga0466719_260307 Ga0466719_260307_2299_2988 229
55 3300042615 Ga0466711_096187 Ga0466711_096187_161_850 229
56 3300042619 Ga0466726_329892 Ga0466726_329892_343_1032 229
57 3300042648 Ga0466709_018758 Ga0466709_018758_3538_4227 229
58 3300042648 Ga0466709_309597 Ga0466709_309597_4633_5322 229
59 3300042652 Ga0466708_172971 Ga0466708_172971_6782_7471 229
60 3300042655 Ga0466727_118531 Ga0466727_118531_1571_2260 229
61 3300042655 Ga0466727_154212 Ga0466727_154212_338_1027 229
62 3300009784 Ga0123357_10089879 Ga0123357_100898794 231
63 3300042616 Ga0466715_374257 Ga0466715_374257_8570_9265 231
64 3300042602 Ga0466713_062540 Ga0466713_062540_4445_5143 232
65 3300042616 Ga0466715_149260 Ga0466715_149260_327_1025 232
66 iso_pr_bacteria 2910959314 2910960226 232
67 3300009784 Ga0123357_10000375 Ga0123357_1000037535 233
68 3300009784 Ga0123357_10000572 Ga0123357_1000057212 233
69 3300009784 Ga0123357_10000787 Ga0123357_1000078715 233
70 3300009784 Ga0123357_10003925 Ga0123357_1000392512 233
71 3300009784 Ga0123357_10042483 Ga0123357_100424833 233
72 3300009784 Ga0123357_10119754 Ga0123357_101197542 233
73 3300010882 Ga0123354_10006042 Ga0123354_100060426 233
74 3300010882 Ga0123354_10036002 Ga0123354_100360026 233
75 3300010882 Ga0123354_10177061 Ga0123354_101770613 233
76 3300042615 Ga0466711_049091 Ga0466711_049091_22571_23272 233
77 iso_pr_bacteria 2940209341 2940209604 233
78 3300005083 Ga0068305_10472138 Ga0068305_104721384 234
79 3300042592 Ga0466693_132179 Ga0466693_132179_538_1242 234
80 3300042601 Ga0466707_096168 Ga0466707_096168_7676_8380 234
81 3300042601 Ga0466707_149294 Ga0466707_149294_6675_7379 234
82 3300042624 Ga0466735_002450 Ga0466735_002450_5055_5759 234
83 3300042659 Ga0466733_197998 Ga0466733_197998_4839_5543 234
84 iso_pr_bacteria 2695420314 2695472457 234
85 iso_pr_bacteria 2923982719 2923984626 234
86 3300005201 Ga0072941_1097517 Ga0072941_10975172 235
87 3300042590 Ga0466690_185521 Ga0466690_185521_9597_10304 235
88 3300042590 Ga0466690_216745 Ga0466690_216745_4323_5030 235
89 3300042602 Ga0466713_038979 Ga0466713_038979_34324_35031 235
90 3300042602 Ga0466713_091714 Ga0466713_091714_101274_101981 235
91 3300042605 Ga0466716_467442 Ga0466716_467442_7829_8536 235
92 3300042612 Ga0466705_397833 Ga0466705_397833_7708_8415 235
93 3300042616 Ga0466715_194856 Ga0466715_194856_5435_6142 235
94 3300042659 Ga0466733_015574 Ga0466733_015574_2156_2863 235
95 iso_pr_bacteria 2820778767 2820781517 235
96 iso_pr_bacteria 2910942425 2910943384 235
97 iso_pr_bacteria 2940244548 2940246479 235
98 iso_pr_bacteria 2940248789 2940250553 235
99 iso_pr_bacteria 2940253009 2940254619 235
100 iso_pr_bacteria 2940257232 2940258788 235
101 2225789004 2227203021 2227629286 236
102 2225789004 2227541300 2228063182 236
103 3300002504 JGI24705J35276_12235304 JGI24705J35276_122353043 236
104 3300010882 Ga0123354_10002122 Ga0123354_100021229 236
105 3300042591 Ga0466692_157293 Ga0466692_157293_52851_53561 236
106 3300042593 Ga0466691_115668 Ga0466691_115668_5417_6127 236
107 3300042600 Ga0466700_058504 Ga0466700_058504_14349_15059 236
108 3300042606 Ga0466719_053407 Ga0466719_053407_11723_12433 236
109 3300042606 Ga0466719_172039 Ga0466719_172039_2762_3472 236
110 3300042620 Ga0466728_141584 Ga0466728_141584_7006_7716 236
111 3300042621 Ga0466729_290129 Ga0466729_290129_754_1464 236
112 3300042623 Ga0466734_154301 Ga0466734_154301_2178_2888 236
113 3300042636 Ga0466703_126683 Ga0466703_126683_239_949 236
114 iso_pr_bacteria 8100166142 8100169722 236
115 3300000062 IMNBL1DRAFT_c0000119 IMNBL1DRAFT_000011952 237
116 3300002462 JGI24702J35022_10008203 JGI24702J35022_100082033 237
117 3300009784 Ga0123357_10009557 Ga0123357_100095579 237
118 3300009784 Ga0123357_10265164 Ga0123357_102651642 237
119 3300010882 Ga0123354_10010405 Ga0123354_100104057 237
120 3300010882 Ga0123354_10048319 Ga0123354_100483192 237
121 3300010882 Ga0123354_10186431 Ga0123354_101864312 237
122 3300010882 Ga0123354_10274034 Ga0123354_102740342 237
123 3300042596 Ga0466696_012607 Ga0466696_012607_3519_4232 237
124 3300042601 Ga0466707_008342 Ga0466707_008342_9620_10333 237
125 3300042601 Ga0466707_220247 Ga0466707_220247_2972_3685 237
126 3300042602 Ga0466713_099033 Ga0466713_099033_387_1100 237
127 3300042606 Ga0466719_542956 Ga0466719_542956_3796_4509 237
128 3300042609 Ga0466722_109642 Ga0466722_109642_4076_4789 237
129 3300042615 Ga0466711_109799 Ga0466711_109799_4151_4864 237
130 3300042615 Ga0466711_180096 Ga0466711_180096_11368_12081 237
131 3300042616 Ga0466715_497593 Ga0466715_497593_25592_26305 237
132 3300042624 Ga0466735_217611 Ga0466735_217611_3207_3920 237
133 iso_pr_bacteria 2820778767 2820780627 237
134 3300042601 Ga0466707_234828 Ga0466707_234828_3457_4173 238
135 3300042619 Ga0466726_165433 Ga0466726_165433_9761_10477 238
136 3300042655 Ga0466727_235389 Ga0466727_235389_18317_19033 238
137 3300042655 Ga0466727_325914 Ga0466727_325914_3194_3910 238
138 iso_pr_bacteria 2820762746 2820764078 238
139 3300002509 JGI24699J35502_11134117 JGI24699J35502_1113411722 239
140 3300005071 Ga0068302_10125648 Ga0068302_101256482 239
141 3300042594 Ga0466694_051997 Ga0466694_051997_1444_2163 239
142 3300042619 Ga0466726_024523 Ga0466726_024523_802_1521 239
143 2225789004 2227659898 2228259869 241
144 3300042621 Ga0466729_099483 Ga0466729_099483_34534_35259 241
145 iso_pr_bacteria 2940371297 2940372085 250
146 3300042624 Ga0466735_138089 Ga0466735_138089_753_1508 251
147 2225789004 2227266902 2227714779 254
148 2225789004 2227582984 2228136417 254
149 3300000062 IMNBL1DRAFT_c0008505 IMNBL1DRAFT_00085056 255
150 3300042618 Ga0466723_001361 Ga0466723_001361_3970_4740 256
151 3300042613 Ga0466710_222176 Ga0466710_222176_131_907 258
152 3300010882 Ga0123354_10000458 Ga0123354_1000045829 263

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19573 DUF6089 Domain of unknown function (DUF6089) 39 260 0.87
PF13505 OMP_b-brl Outer membrane protein beta-barrel domain 42 224 0.69

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.74 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.