Protein Family IF03450

Metagenome Isolate
130 Members
72 Samples
115 Scaffolds
385.15 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10000306|Ga0123354_1000030624
Length
408 aa
Sequence
MSVTEKINKPDAPKTSFPMNGVDEALRKQIAILGSTGSIGTQALEVIEEQSDRFEVYALTANNNADLLIAQARKFEPEIVVIANEAKYDYVKESLKDLPIKVFAGTNSIAEVAEMQPVDIVLTAMVGYSGLQPTIHAVKAGKTIALANKETLVVAGDLICELAERHKSAILPVDSEHSAVFQCLAGEISPVEKIILTASGGPFRGKDRKFLEKVTPACALKHPNWEMGSKITIDSASLMNKGFEVIEAKWLFGVRPEQIEVVIHPQSLIHSMVQFEDGSIKAQIGLPDMKLPIQYAFAYPERIRNNYPRVDFFNCQSFTFEKPDLEVFRNLTFAYEAMRQKGNMPCILNAANEVVVAAFLQEQIGFLQMPDIIEKTMQIASYIAKPTYEEYVMTDKEAREIALSLCK*

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 31.0%
Kalotermitidae 18.3%
Unclassified 16.9%
Armadillidiidae 11.3%
Blattidae 7.0%
Passalidae 4.2%
Rhinotermitidae 4.2%
Hodotermitidae 1.4%
Termopsidae 1.4%
Hydrophilidae 1.4%
Culicidae 1.4%
Drosophilidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 126
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
2 2910949487 Dysgonomonas sp. 520 Isolate Blattidae
3 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
6 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
7 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
8 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
9 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
10 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
13 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
14 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
19 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
20 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
21 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
22 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
23 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
26 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
32 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
33 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
34 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
35 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
36 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
37 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
38 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
39 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
40 2820350530 Unclassified Firmicutes Nt197P3bin37 Isolate Unclassified
41 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
42 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
43 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
44 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
45 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
50 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
51 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
52 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
56 2920168565 Paludibacter sp. 221 Isolate Blattidae
57 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
58 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
59 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
60 2910930387 Dysgonomonas sp. 216 Isolate Blattidae
61 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
62 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
63 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
64 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
65 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
66 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
67 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
70 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
71 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
72 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_087900 3300042612 Bacteria 15463
2 Ga0466730_039992 3300042625 Bacteria 1355215
3 Ga0466711_204784 3300042615 Bacteria 3896
4 Ga0466711_299592 3300042615 Bacteria 3610
5 Ga0466719_099656 3300042606 Bacteria 8244
6 Ga0160432_100012 3300012818 Bacteria 390104
7 Ga0160433_100257 3300012846 Unclassified 37091
8 Ga0466657_019668 3300042582 Bacteria 3625
9 Ga0466691_070652 3300042593 Bacteria 38932
10 Ga0466696_220816 3300042596 Bacteria 2259
11 2227541589 2225789004 Bacteria 2983
12 Ga0104041_1000036 3300007106 Bacteria 3330
13 Ga0466705_015572 3300042612 Bacteria 13659
14 Ga0466703_212909 3300042636 Bacteria 7708
15 Ga0466703_417664 3300042636 Bacteria 8952
16 Ga0466710_087623 3300042613 Bacteria 2382
17 Ga0466729_028506 3300042621 Bacteria 1468
18 Ga0123353_10121508 3300010167 Bacteria 4199
19 Ga0123353_10196311 3300010167 Bacteria 3181
20 Ga0466707_106635 3300042601 Bacteria 10385
21 Ga0160445_101765 3300012847 Bacteria 5663
22 Ga0466690_388556 3300042590 Bacteria 11669
23 Ga0466694_195710 3300042594 Bacteria 1519
24 Ga0466696_161539 3300042596 Bacteria 37941
25 Ga0466704_175619 3300042643 Bacteria 30013
26 Ga0466718_120149 3300042617 Bacteria 10097
27 Ga0466723_285590 3300042618 Bacteria 4883
28 Ga0123355_10405283 3300009826 Bacteria 1755
29 Ga0466707_017877 3300042601 Bacteria 16904
30 Ga0466716_430332 3300042605 Bacteria 14125
31 Ga0466722_227624 3300042609 Bacteria 1806
32 Ga0466690_339108 3300042590 Bacteria 4175
33 Ga0466695_028814 3300042595 Bacteria 17443
34 Ga0068305_10070135 3300005083 Bacteria 5925
35 Ga0466705_071253 3300042612 Bacteria 10568
36 Ga0466734_018994 3300042623 Bacteria 8431
37 Ga0466704_234533 3300042643 Bacteria 9049
38 Ga0466711_023105 3300042615 Bacteria 1959
39 Ga0466715_341035 3300042616 Bacteria 3158
40 Ga0123355_10001479 3300009826 Bacteria 32715
41 Ga0123355_10006840 3300009826 Bacteria 16974
42 Ga0123353_10000110 3300010167 Bacteria 95473
43 Ga0123354_10129765 3300010882 Bacteria 3191
44 Ga0466706_139141 3300042599 Bacteria 4620
45 Ga0466714_154443 3300042603 Bacteria 8680
46 Ga0466722_048054 3300042609 Bacteria 48867
47 Ga0160469_102309 3300012824 Unclassified 3677
48 Ga0160445_101419 3300012847 Bacteria 6850
49 Ga0160443_100326 3300012848 Bacteria 44284
50 Ga0466692_008187 3300042591 Bacteria 121981
51 Ga0466733_073127 3300042659 Bacteria 14245
52 Ga0466733_173696 3300042659 Bacteria 6562
53 Ga0466704_030571 3300042643 Bacteria 29418
54 Ga0466724_22590 3300042649 Bacteria 29057
55 Ga0466727_032254 3300042655 Bacteria 4921
56 Ga0123357_10037575 3300009784 Bacteria 6592
57 Ga0123355_10055197 3300009826 Bacteria 6433
58 Ga0123353_10260671 3300010167 Bacteria 2678
59 Ga0466706_015316 3300042599 Bacteria 50470
60 Ga0466700_147394 3300042600 Bacteria 3761
61 Ga0466713_020244 3300042602 Bacteria 9360
62 Ga0466713_143719 3300042602 Bacteria 5199
63 Ga0466698_076124 3300042610 Bacteria 2655
64 Ga0160457_1000009 3300012858 Bacteria 506736
65 Ga0466657_234260 3300042582 Bacteria 4253
66 IMNBL1DRAFT_c0003107 3300000062 Bacteria 10953
67 JGI24696J40584_12961581 3300002834 Bacteria 22280
68 Ga0466703_092827 3300042636 Bacteria 5772
69 Ga0466708_135441 3300042652 Bacteria 21711
70 Ga0466727_157863 3300042655 Bacteria 1617
71 Ga0466723_091519 3300042618 Bacteria 9163
72 Ga0466728_016849 3300042620 Bacteria 12533
73 Ga0123357_10005111 3300009784 Bacteria 15639
74 Ga0123355_10263587 3300009826 Bacteria 2406
75 Ga0123354_10000306 3300010882 Bacteria 45162
76 Ga0466701_048164 3300042598 Unclassified 17037
77 Ga0466706_267636 3300042599 Bacteria 11078
78 Ga0466714_113270 3300042603 Bacteria 1615
79 Ga0160433_100727 3300012846 Unclassified 12304
80 Ga0160443_102292 3300012848 Bacteria 4462
81 Ga0466657_012559 3300042582 Bacteria 6171
82 Ga0466692_162937 3300042591 Bacteria 7543
83 Ga0466696_191055 3300042596 Bacteria 25014
84 2227422480 2225789004 Bacteria 5619
85 IMNBL1DRAFT_c0004399 3300000062 Bacteria 8494
86 Ga0466732_103073 3300042656 Bacteria 41421
87 Ga0466703_135582 3300042636 Bacteria 15359
88 Ga0466704_530160 3300042643 Bacteria 4341
89 Ga0466705_421129 3300042612 Bacteria 8060
90 Ga0123353_10539975 3300010167 Bacteria 1685
91 Ga0466701_057824 3300042598 Bacteria 22348
92 Ga0466713_095526 3300042602 Bacteria 106941
93 Ga0160455_100069 3300012837 Bacteria 184978
94 Ga0160444_102784 3300012841 Bacteria 2610
95 IMNBGM34_c003021 3300000036 Bacteria 2365
96 JGI24702J35022_10008793 3300002462 Bacteria 5703
97 Ga0466733_204380 3300042659 Bacteria 28684
98 Ga0466729_257542 3300042621 Bacteria 1429
99 Ga0466704_067672 3300042643 Bacteria 8450
100 Ga0466727_207362 3300042655 Bacteria 6971
101 Ga0466715_384796 3300042616 Bacteria 6467
102 Ga0466723_112761 3300042618 Bacteria 2383
103 Ga0123355_10000179 3300009826 Bacteria 78580
104 Ga0123355_10026896 3300009826 Bacteria 9286
105 Ga0123356_10056569 3300010049 Bacteria 3655
106 Ga0123356_10149632 3300010049 Bacteria 2316
107 Ga0123353_10000082 3300010167 Bacteria 106066
108 Ga0466713_029503 3300042602 Bacteria 16241
109 Ga0466714_082006 3300042603 Bacteria 191145
110 Ga0466716_028761 3300042605 Bacteria 9318
111 Ga0160467_100749 3300012829 Bacteria 23302
112 Ga0160459_105286 3300012831 Bacteria 1693
113 Ga0160443_100015 3300012848 Bacteria 436093
114 Ga0466656_054582 3300042550 Bacteria 6382
115 Ga0466694_160746 3300042594 Bacteria 6982

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 iso_pr_bacteria 2820750388 2820750796 343
2 3300042656 Ga0466732_103073 Ga0466732_103073_22801_23859 352
3 3300042582 Ga0466657_019668 Ga0466657_019668_1625_2770 357
4 3300010167 Ga0123353_10121508 Ga0123353_101215082 360
5 3300000062 IMNBL1DRAFT_c0004399 IMNBL1DRAFT_00043993 362
6 3300042590 Ga0466690_388556 Ga0466690_388556_1620_2783 365
7 3300042609 Ga0466722_227624 Ga0466722_227624_288_1442 367
8 3300042652 Ga0466708_135441 Ga0466708_135441_3945_5129 368
9 3300042594 Ga0466694_195710 Ga0466694_195710_110_1219 369
10 3300042612 Ga0466705_421129 Ga0466705_421129_2371_3546 369
11 2225789004 2227541589 2228063862 372
12 3300042605 Ga0466716_430332 Ga0466716_430332_1520_2677 372
13 3300009826 Ga0123355_10006840 Ga0123355_1000684011 375
14 3300042618 Ga0466723_091519 Ga0466723_091519_6026_7192 375
15 3300042615 Ga0466711_299592 Ga0466711_299592_1565_2734 376
16 3300010882 Ga0123354_10129765 Ga0123354_101297653 378
17 iso_pr_bacteria 2820792843 2820792905 378
18 iso_pr_bacteria 2820797595 2820799234 378
19 3300002834 JGI24696J40584_12961581 JGI24696J40584_1296158115 379
20 3300042601 Ga0466707_017877 Ga0466707_017877_10923_12077 379
21 2225789004 2227422480 2227863397 380
22 3300042612 Ga0466705_087900 Ga0466705_087900_4071_5216 381
23 3300042616 Ga0466715_341035 Ga0466715_341035_811_1956 381
24 3300042643 Ga0466704_234533 Ga0466704_234533_3761_4906 381
25 iso_pr_bacteria 2873600114 2873600533 381
26 iso_pr_bacteria 2940193328 2940193997 381
27 iso_pr_bacteria 2940336608 2940337274 381
28 3300005083 Ga0068305_10070135 Ga0068305_100701353 382
29 3300042591 Ga0466692_162937 Ga0466692_162937_3075_4223 382
30 3300042598 Ga0466701_057824 Ga0466701_057824_18817_19965 382
31 3300042613 Ga0466710_087623 Ga0466710_087623_578_1726 382
32 3300042615 Ga0466711_204784 Ga0466711_204784_2495_3643 382
33 3300042636 Ga0466703_212909 Ga0466703_212909_2366_3514 382
34 iso_pr_bacteria 2910930387 2910930725 382
35 3300002462 JGI24702J35022_10008793 JGI24702J35022_100087932 383
36 3300010049 Ga0123356_10149632 Ga0123356_101496322 383
37 3300010167 Ga0123353_10000082 Ga0123353_1000008279 383
38 3300042596 Ga0466696_220816 Ga0466696_220816_867_2018 383
39 3300042600 Ga0466700_147394 Ga0466700_147394_688_1839 383
40 3300042601 Ga0466707_106635 Ga0466707_106635_558_1709 383
41 3300042603 Ga0466714_082006 Ga0466714_082006_111164_112315 383
42 3300042615 Ga0466711_023105 Ga0466711_023105_82_1233 383
43 3300042616 Ga0466715_384796 Ga0466715_384796_5042_6193 383
44 3300042636 Ga0466703_092827 Ga0466703_092827_3876_5027 383
45 3300042636 Ga0466703_135582 Ga0466703_135582_10374_11525 383
46 iso_pr_bacteria 2820770630 2820771205 383
47 3300000062 IMNBL1DRAFT_c0003107 IMNBL1DRAFT_00031072 384
48 3300009784 Ga0123357_10037575 Ga0123357_100375752 384
49 3300010167 Ga0123353_10000110 Ga0123353_100001102 384
50 3300010167 Ga0123353_10260671 Ga0123353_102606713 384
51 3300012858 Ga0160457_1000009 Ga0160457_10000098 384
52 3300042623 Ga0466734_018994 Ga0466734_018994_5497_6651 384
53 3300042636 Ga0466703_417664 Ga0466703_417664_3881_5035 384
54 3300042643 Ga0466704_067672 Ga0466704_067672_2577_3731 384
55 3300042643 Ga0466704_530160 Ga0466704_530160_2085_3239 384
56 3300042655 Ga0466727_207362 Ga0466727_207362_4090_5244 384
57 3300042659 Ga0466733_173696 Ga0466733_173696_4212_5366 384
58 iso_pr_bacteria 2910949487 2910952879 384
59 iso_pr_bacteria 2920168565 2920169261 384
60 3300012818 Ga0160432_100012 Ga0160432_100012289 385
61 3300012829 Ga0160467_100749 Ga0160467_10074920 385
62 3300012837 Ga0160455_100069 Ga0160455_100069101 385
63 3300012846 Ga0160433_100257 Ga0160433_10025714 385
64 3300042590 Ga0466690_339108 Ga0466690_339108_394_1551 385
65 3300042593 Ga0466691_070652 Ga0466691_070652_17411_18568 385
66 3300042595 Ga0466695_028814 Ga0466695_028814_1981_3138 385
67 3300042598 Ga0466701_048164 Ga0466701_048164_9682_10839 385
68 3300042605 Ga0466716_028761 Ga0466716_028761_1733_2890 385
69 3300042609 Ga0466722_048054 Ga0466722_048054_36071_37228 385
70 3300042610 Ga0466698_076124 Ga0466698_076124_710_1867 385
71 3300042617 Ga0466718_120149 Ga0466718_120149_5741_6898 385
72 3300042625 Ga0466730_039992 Ga0466730_039992_1131985_1133142 385
73 3300042649 Ga0466724_22590 Ga0466724_22590_12030_13187 385
74 3300042659 Ga0466733_204380 Ga0466733_204380_17400_18557 385
75 3300007106 Ga0104041_1000036 Ga0104041_10000363 386
76 3300009826 Ga0123355_10055197 Ga0123355_100551979 386
77 3300042596 Ga0466696_191055 Ga0466696_191055_5422_6582 386
78 3300042602 Ga0466713_029503 Ga0466713_029503_12916_14076 386
79 3300042603 Ga0466714_113270 Ga0466714_113270_348_1508 386
80 3300042621 Ga0466729_257542 Ga0466729_257542_127_1287 386
81 3300012831 Ga0160459_105286 Ga0160459_1052862 387
82 3300042582 Ga0466657_012559 Ga0466657_012559_4257_5420 387
83 3300042582 Ga0466657_234260 Ga0466657_234260_3073_4236 387
84 3300042591 Ga0466692_008187 Ga0466692_008187_53832_54995 387
85 3300042599 Ga0466706_015316 Ga0466706_015316_28439_29602 387
86 3300042599 Ga0466706_139141 Ga0466706_139141_876_2078 387
87 3300042599 Ga0466706_267636 Ga0466706_267636_3014_4177 387
88 3300042602 Ga0466713_095526 Ga0466713_095526_101175_102338 387
89 3300042655 Ga0466727_157863 Ga0466727_157863_71_1234 387
90 iso_pr_bacteria 643348524 643423027 387
91 3300010167 Ga0123353_10539975 Ga0123353_105399752 388
92 3300042594 Ga0466694_160746 Ga0466694_160746_804_1970 388
93 3300042596 Ga0466696_161539 Ga0466696_161539_33308_34474 388
94 3300042602 Ga0466713_020244 Ga0466713_020244_7735_8901 388
95 3300042602 Ga0466713_143719 Ga0466713_143719_1695_2861 388
96 3300042603 Ga0466714_154443 Ga0466714_154443_3175_4341 388
97 3300042606 Ga0466719_099656 Ga0466719_099656_3881_5047 388
98 3300042621 Ga0466729_028506 Ga0466729_028506_243_1409 388
99 iso_pr_bacteria 2820788205 2820789383 388
100 3300009826 Ga0123355_10001479 Ga0123355_100014799 389
101 3300010049 Ga0123356_10056569 Ga0123356_100565693 389
102 3300042612 Ga0466705_015572 Ga0466705_015572_6816_7985 389
103 3300012848 Ga0160443_100326 Ga0160443_10032617 390
104 iso_pr_bacteria 2820785563 2820785952 390
105 3300009826 Ga0123355_10000179 Ga0123355_1000017912 391
106 3300042618 Ga0466723_285590 Ga0466723_285590_1567_2742 391
107 3300042643 Ga0466704_175619 Ga0466704_175619_5893_7068 391
108 3300042659 Ga0466733_073127 Ga0466733_073127_2872_4047 391
109 3300042612 Ga0466705_071253 Ga0466705_071253_6081_7259 392
110 3300042618 Ga0466723_112761 Ga0466723_112761_539_1717 392
111 3300000036 IMNBGM34_c003021 IMNBGM34_0030212 393
112 3300042655 Ga0466727_032254 Ga0466727_032254_1129_2310 393
113 3300009784 Ga0123357_10005111 Ga0123357_1000511114 395
114 3300009826 Ga0123355_10405283 Ga0123355_104052832 395
115 3300012841 Ga0160444_102784 Ga0160444_1027842 396
116 3300012846 Ga0160433_100727 Ga0160433_1007272 396
117 3300012847 Ga0160445_101765 Ga0160445_1017655 396
118 3300012848 Ga0160443_100015 Ga0160443_100015393 396
119 3300012824 Ga0160469_102309 Ga0160469_1023092 397
120 3300012847 Ga0160445_101419 Ga0160445_1014196 397
121 3300012848 Ga0160443_102292 Ga0160443_1022924 397
122 3300009826 Ga0123355_10026896 Ga0123355_100268969 400
123 iso_pr_bacteria 2820350530 2820351933 400
124 iso_pr_bacteria 2820525019 2820525587 400
125 3300010167 Ga0123353_10196311 Ga0123353_101963111 404
126 3300042643 Ga0466704_030571 Ga0466704_030571_3397_4614 405
127 3300009826 Ga0123355_10263587 Ga0123355_102635872 407
128 3300010882 Ga0123354_10000306 Ga0123354_1000030624 408
129 3300042620 Ga0466728_016849 Ga0466728_016849_4195_5427 410
130 3300042550 Ga0466656_054582 Ga0466656_054582_3555_4964 435

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase 30 156 0.99
PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain 170 252 0.98
PF13288 DXPR_C DXP reductoisomerase C-terminal domain 284 400 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02670 GO:0070402 NADPH binding MF
PF08436 GO:0005515 protein binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.9 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.