Protein Family IF03448

Metagenome Isolate
181 Members
76 Samples
156 Scaffolds
489.07 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10000156|Ga0123354_100001567
Length
535 aa
Sequence
MLWLSSKRFAETVTPLNYFFVNTNIVNTIKITYRKMKSIFKIQSIVYFIFLAAYCLTACGHTNKNDSRKGDEPKTKSDVLIYVTSADRSSDFRKDSTNFSNIQNVSPTTITLDTKQRFQTMDGFGAAVTGSTAYNLLKMTPDDRNKFLKETFSVTEGMGYSYIRISIGCSDFSLSEYTCCDTKGIENFALTSEENDYVIPILKEILAINPNVKIMGSPWTCPRWMKVNNLKDLKPFDSWTSGQLNPAYYSDYGTYFVKWIQAFANAGITIYSVTPQNEPLNRGNSASLYMGWQEQRDFVKNFLTPKLKAAGLDTKVYLFDHNYNYDNISAESDYPAKIYDSGVDNAVVVGAAYHNYGGNKNELLIVHNKYPDKELVFTETSIGTWNDGRNLSVRLPDDMQEVALGTVNNWCKAVIVWNLMLDTDRGPNRDGGCQTCYGAVDIDHSNYKTITRNSHYYIIGHLSSVVRPDAIRIGTTGYSDSGVIFSAFENPDDTYAVVLLNNTTENKNITLDDGKNHFSYDVPSYSVVSYLWKK*

📊 Sample Types

Isolate 13.3%
Metagenome 86.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Blattidae 25.7%
Termitidae 18.9%
Kalotermitidae 18.9%
Rhinotermitidae 6.8%
Unclassified 6.8%
Armadillidiidae 5.4%
Termopsidae 5.4%
Drosophilidae 4.1%
Passalidae 4.1%
Formicidae 2.7%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 175
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
2 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
3 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
4 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
5 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
6 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
9 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
14 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 2940202316 Parabacteroides sp. PF5-9 Isolate Blattidae
17 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
18 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
19 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
20 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
21 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
22 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
27 2830041218 Bacteroides reticulotermitis DSM 105720 Isolate Unclassified
28 2940212447 Parabacteroides sp. PH5-16 Isolate Blattidae
29 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
30 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
31 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
32 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
33 3004672520 Bacteroides sp. 51 Isolate Blattidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
36 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
37 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
38 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
39 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
40 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
41 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
42 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
45 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
46 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
47 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
48 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
49 2609459943 Bacteroides reticulotermitis JCM 10512 Isolate Rhinotermitidae
50 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
51 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
52 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
53 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
54 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
55 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
56 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
57 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
58 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
59 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
60 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
61 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
62 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
63 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
64 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
65 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
66 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
67 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
68 3004667792 Bacteroides sp. 519 Isolate Blattidae
69 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
70 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
71 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
72 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
73 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
74 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
75 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
76 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466715_040603 3300042616 Bacteria 10251
2 Ga0123357_10016539 3300009784 Bacteria 9714
3 Ga0466691_061338 3300042593 Bacteria 12019
4 Ga0466706_110705 3300042599 Bacteria 19793
5 Ga0466713_133306 3300042602 Bacteria 44771
6 Ga0466716_339497 3300042605 Bacteria 21838
7 Ga0466722_034653 3300042609 Bacteria 13983
8 Ga0466729_275936 3300042621 Bacteria 1854
9 Ga0466735_103851 3300042624 Bacteria 2373
10 Ga0466703_192699 3300042636 Bacteria 11400
11 Ga0466703_227764 3300042636 Bacteria 13873
12 Ga0466704_182437 3300042643 Bacteria 10841
13 Ga0466704_212700 3300042643 Bacteria 10039
14 Ga0466727_032251 3300042655 Bacteria 4419
15 Ga0466727_166586 3300042655 Bacteria 7474
16 IMNBL1DRAFT_c0000489 3300000062 Bacteria 33049
17 IMNBL1DRAFT_c0007275 3300000062 Bacteria 5858
18 Ga0072941_1082637 3300005201 Bacteria 3120
19 Ga0466705_182651 3300042612 Bacteria 8376
20 Ga0466710_046582 3300042613 Bacteria 13703
21 Ga0466711_050711 3300042615 Bacteria 6568
22 Ga0466715_090180 3300042616 Bacteria 2687
23 Ga0466715_128088 3300042616 Bacteria 14703
24 Ga0466715_399512 3300042616 Bacteria 10988
25 Ga0466728_193168 3300042620 Bacteria 3681
26 Ga0123354_10001542 3300010882 Bacteria 28227
27 Ga0123354_10008691 3300010882 Bacteria 15480
28 Ga0160454_100001 3300012798 Bacteria 780029
29 Ga0466692_089185 3300042591 Bacteria 67312
30 Ga0466691_120752 3300042593 Bacteria 23371
31 Ga0466713_152985 3300042602 Bacteria 166324
32 Ga0466716_392687 3300042605 Unclassified 6245
33 Ga0466703_167217 3300042636 Unclassified 11274
34 Ga0466704_223584 3300042643 Bacteria 5304
35 Ga0466709_074792 3300042648 Bacteria 46178
36 Ga0466709_156557 3300042648 Bacteria 36692
37 Ga0466725_401203 3300042654 Bacteria 2536
38 JGI24705J35276_12227849 3300002504 Bacteria 3076
39 Ga0068302_10031530 3300005071 Bacteria 2358
40 Ga0104050_1031784 3300007153 Bacteria 11713
41 Ga0466697_258787 3300042611 Bacteria 4276
42 Ga0466705_110782 3300042612 Bacteria 9444
43 Ga0466726_020158 3300042619 Bacteria 16035
44 Ga0466729_053866 3300042621 Bacteria 17381
45 Ga0123354_10096344 3300010882 Bacteria 4042
46 Ga0466690_214111 3300042590 Bacteria 20145
47 Ga0466716_311399 3300042605 Bacteria 3464
48 Ga0466719_044042 3300042606 Bacteria 8948
49 Ga0466719_170760 3300042606 Bacteria 3158
50 Ga0466719_401753 3300042606 Bacteria 2574
51 Ga0466719_546076 3300042606 Bacteria 1924
52 Ga0466730_009837 3300042625 Bacteria 325641
53 Ga0103263_101824 3300007042 Unclassified 2705
54 Ga0104045_1005821 3300007085 Bacteria 2578
55 Ga0104045_1074519 3300007085 Unclassified 2911
56 Ga0466705_227189 3300042612 Bacteria 10083
57 Ga0466715_051292 3300042616 Bacteria 17333
58 Ga0466723_343869 3300042618 Bacteria 12632
59 Ga0466728_127610 3300042620 Bacteria 9112
60 Ga0123357_10059818 3300009784 Bacteria 5112
61 Ga0123354_10000156 3300010882 Bacteria 54363
62 Ga0160456_100113 3300012820 Bacteria 83708
63 Ga0160467_101483 3300012829 Bacteria 8823
64 Ga0466690_410176 3300042590 Bacteria 6860
65 Ga0466691_129230 3300042593 Bacteria 9052
66 Ga0466696_388363 3300042596 Bacteria 5792
67 Ga0466701_085449 3300042598 Bacteria 137112
68 Ga0466700_080044 3300042600 Bacteria 21451
69 Ga0466707_382030 3300042601 Bacteria 7414
70 Ga0466713_082133 3300042602 Bacteria 97637
71 Ga0466719_054245 3300042606 Bacteria 25604
72 Ga0466722_056177 3300042609 Bacteria 8641
73 Ga0466704_014684 3300042643 Bacteria 2918
74 Ga0466724_01368 3300042649 Unclassified 5820
75 Ga0466724_61790 3300042649 Bacteria 18096
76 Ga0466725_264850 3300042654 Bacteria 15661
77 2227063697 2225789003 Bacteria 16757
78 2227650193 2225789004 Bacteria 2007
79 JGI24702J35022_10039416 3300002462 Bacteria 2520
80 Ga0104050_1003332 3300007153 Bacteria 16120
81 Ga0104050_1005502 3300007153 Unclassified 5527
82 Ga0466723_123490 3300042618 Bacteria 7449
83 Ga0466690_167294 3300042590 Bacteria 16494
84 Ga0466707_077345 3300042601 Bacteria 10117
85 Ga0466707_121392 3300042601 Bacteria 3016
86 Ga0466713_101286 3300042602 Bacteria 33344
87 Ga0466714_018491 3300042603 Bacteria 21825
88 Ga0466716_028991 3300042605 Bacteria 12916
89 Ga0466716_545875 3300042605 Bacteria 15434
90 Ga0466722_234954 3300042609 Bacteria 6343
91 Ga0466735_050071 3300042624 Bacteria 1673
92 Ga0466704_043845 3300042643 Bacteria 2086
93 Ga0466704_228595 3300042643 Bacteria 9182
94 Ga0466708_193450 3300042652 Bacteria 26212
95 2227535755 2225789004 Bacteria 16002
96 Ga0068305_10111347 3300005083 Bacteria 5919
97 Ga0104045_1026580 3300007085 Bacteria 8353
98 Ga0466705_001946 3300042612 Bacteria 3740
99 Ga0466711_167360 3300042615 Bacteria 3975
100 Ga0466723_254080 3300042618 Bacteria 51092
101 Ga0466728_419825 3300042620 Bacteria 8715
102 Ga0123354_10016623 3300010882 Bacteria 11527
103 Ga0160455_100076 3300012837 Bacteria 171682
104 Ga0160433_100075 3300012846 Bacteria 104313
105 Ga0466696_103141 3300042596 Bacteria 30807
106 Ga0466696_281306 3300042596 Bacteria 2564
107 Ga0466716_039594 3300042605 Bacteria 7939
108 Ga0466722_032520 3300042609 Bacteria 3297
109 Ga0466730_011704 3300042625 Bacteria 164446
110 Ga0466703_102041 3300042636 Bacteria 15944
111 Ga0466703_125794 3300042636 Bacteria 18695
112 Ga0466703_396290 3300042636 Bacteria 7976
113 Ga0466709_269162 3300042648 Bacteria 15379
114 Ga0466724_66179 3300042649 Bacteria 76823
115 JGI24699J35502_11133686 3300002509 Bacteria 13530
116 Ga0104045_1001630 3300007085 Bacteria 6209
117 Ga0123357_10000256 3300009784 Bacteria 51026
118 Ga0466705_040836 3300042612 Bacteria 16662
119 Ga0466723_265347 3300042618 Bacteria 18803
120 Ga0466726_157010 3300042619 Bacteria 10718
121 Ga0466729_040173 3300042621 Bacteria 7100
122 Ga0466706_101173 3300042599 Bacteria 22786
123 Ga0466706_252554 3300042599 Bacteria 3345
124 Ga0466716_040393 3300042605 Bacteria 11253
125 Ga0466716_526199 3300042605 Bacteria 8031
126 Ga0466722_082097 3300042609 Bacteria 29584
127 Ga0466722_215783 3300042609 Bacteria 7346
128 Ga0466703_419671 3300042636 Bacteria 1782
129 Ga0466709_137796 3300042648 Bacteria 11520
130 Ga0466709_161394 3300042648 Bacteria 4667
131 Ga0466708_196794 3300042652 Bacteria 16233
132 Ga0466727_108876 3300042655 Bacteria 2178
133 Ga0072941_1134208 3300005201 Bacteria 5780
134 Ga0466705_128769 3300042612 Bacteria 7292
135 Ga0466733_024429 3300042659 Bacteria 8459
136 Ga0466711_031256 3300042615 Bacteria 16144
137 Ga0466715_217399 3300042616 Bacteria 37947
138 Ga0466715_345003 3300042616 Bacteria 11266
139 Ga0466726_478957 3300042619 Bacteria 3840
140 Ga0466729_046000 3300042621 Bacteria 1794
141 Ga0123357_10036900 3300009784 Bacteria 6651
142 Ga0466691_103760 3300042593 Bacteria 6487
143 Ga0466700_041770 3300042600 Bacteria 9697
144 Ga0466713_073530 3300042602 Bacteria 8140
145 Ga0466713_123288 3300042602 Bacteria 76789
146 Ga0466703_125750 3300042636 Bacteria 9527
147 Ga0466703_162504 3300042636 Bacteria 5528
148 Ga0466703_399369 3300042636 Bacteria 29558
149 Ga0466704_177393 3300042643 Bacteria 3755
150 Ga0466704_470775 3300042643 Bacteria 1879
151 Ga0466724_47892 3300042649 Bacteria 13937
152 Ga0466708_134462 3300042652 Bacteria 9535
153 2227521858 2225789004 Bacteria 17093
154 CVPL010W_10000093 3300002931 Bacteria 63242
155 Ga0104045_1001549 3300007085 Bacteria 5186
156 Ga0104019_1002153 3300007150 Bacteria 7193

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042643 Ga0466704_043845 Ga0466704_043845_742_2010 422
2 3300042606 Ga0466719_546076 Ga0466719_546076_13_1305 430
3 3300005201 Ga0072941_1082637 Ga0072941_10826372 442
4 3300042618 Ga0466723_265347 Ga0466723_265347_16376_17707 443
5 3300042620 Ga0466728_193168 Ga0466728_193168_1361_2698 445
6 2225789004 2227650193 2228245471 449
7 3300042652 Ga0466708_193450 Ga0466708_193450_8847_10349 450
8 3300042618 Ga0466723_343869 Ga0466723_343869_6975_8477 458
9 3300002504 JGI24705J35276_12227849 JGI24705J35276_122278492 459
10 3300042616 Ga0466715_051292 Ga0466715_051292_11808_13310 459
11 3300042618 Ga0466723_254080 Ga0466723_254080_47214_48593 459
12 3300000062 IMNBL1DRAFT_c0007275 IMNBL1DRAFT_00072755 462
13 3300007153 Ga0104050_1031784 Ga0104050_103178414 463
14 3300042596 Ga0466696_281306 Ga0466696_281306_632_2026 464
15 3300042602 Ga0466713_073530 Ga0466713_073530_6200_7669 464
16 3300000062 IMNBL1DRAFT_c0000489 IMNBL1DRAFT_000048927 465
17 3300042605 Ga0466716_311399 Ga0466716_311399_1399_2880 465
18 3300042605 Ga0466716_545875 Ga0466716_545875_4631_6031 466
19 3300042652 Ga0466708_134462 Ga0466708_134462_6220_7620 466
20 3300042648 Ga0466709_269162 Ga0466709_269162_9726_11225 468
21 3300042590 Ga0466690_214111 Ga0466690_214111_10699_12204 469
22 3300042596 Ga0466696_103141 Ga0466696_103141_8546_9955 469
23 3300042649 Ga0466724_01368 Ga0466724_01368_3637_5079 469
24 3300042598 Ga0466701_085449 Ga0466701_085449_112313_113758 470
25 3300042599 Ga0466706_101173 Ga0466706_101173_9087_10592 470
26 3300002509 JGI24699J35502_11133686 JGI24699J35502_111336864 473
27 3300042603 Ga0466714_018491 Ga0466714_018491_11198_12691 473
28 3300042643 Ga0466704_228595 Ga0466704_228595_1621_3042 473
29 3300042606 Ga0466719_401753 Ga0466719_401753_1111_2535 474
30 iso_pr_bacteria 8100166142 8100169317 474
31 3300042605 Ga0466716_526199 Ga0466716_526199_2481_3977 475
32 3300005201 Ga0072941_1134208 Ga0072941_11342085 476
33 3300042616 Ga0466715_128088 Ga0466715_128088_2349_3896 476
34 3300042602 Ga0466713_082133 Ga0466713_082133_19339_20853 477
35 3300042602 Ga0466713_101286 Ga0466713_101286_25782_27215 477
36 3300042611 Ga0466697_258787 Ga0466697_258787_2298_3731 477
37 3300042648 Ga0466709_074792 Ga0466709_074792_18990_20423 477
38 3300042636 Ga0466703_125794 Ga0466703_125794_6609_8048 479
39 3300042643 Ga0466704_177393 Ga0466704_177393_2225_3733 479
40 3300042654 Ga0466725_264850 Ga0466725_264850_6335_7804 479
41 3300042605 Ga0466716_392687 Ga0466716_392687_2038_3585 480
42 3300042618 Ga0466723_123490 Ga0466723_123490_1617_3110 480
43 3300042621 Ga0466729_040173 Ga0466729_040173_905_2347 480
44 3300042609 Ga0466722_234954 Ga0466722_234954_130_1605 481
45 3300042602 Ga0466713_123288 Ga0466713_123288_53930_55432 482
46 3300042615 Ga0466711_050711 Ga0466711_050711_105_1553 482
47 3300042655 Ga0466727_108876 Ga0466727_108876_199_1647 482
48 3300005071 Ga0068302_10031530 Ga0068302_100315303 484
49 3300042593 Ga0466691_129230 Ga0466691_129230_6157_7611 484
50 3300042625 Ga0466730_011704 Ga0466730_011704_85923_87377 484
51 3300042649 Ga0466724_47892 Ga0466724_47892_8141_9595 484
52 2225789003 2227063697 2227419624 485
53 2225789004 2227521858 2228026052 485
54 3300042606 Ga0466719_044042 Ga0466719_044042_410_1867 485
55 3300042609 Ga0466722_032520 Ga0466722_032520_288_1745 485
56 3300042654 Ga0466725_401203 Ga0466725_401203_175_1683 485
57 3300042615 Ga0466711_167360 Ga0466711_167360_1088_2548 486
58 3300042625 Ga0466730_009837 Ga0466730_009837_148554_150047 486
59 3300042655 Ga0466727_166586 Ga0466727_166586_1935_3395 486
60 3300042612 Ga0466705_001946 Ga0466705_001946_2247_3710 487
61 3300042643 Ga0466704_223584 Ga0466704_223584_3420_4883 487
62 3300042648 Ga0466709_137796 Ga0466709_137796_2274_3737 487
63 3300009784 Ga0123357_10036900 Ga0123357_100369004 488
64 3300042593 Ga0466691_103760 Ga0466691_103760_4213_5679 488
65 3300042603 Ga0466714_018491 Ga0466714_018491_9726_11192 488
66 3300042649 Ga0466724_61790 Ga0466724_61790_4648_6144 488
67 3300042590 Ga0466690_410176 Ga0466690_410176_2097_3566 489
68 3300042596 Ga0466696_388363 Ga0466696_388363_2661_4157 489
69 3300042605 Ga0466716_040393 Ga0466716_040393_8093_9562 489
70 3300042621 Ga0466729_046000 Ga0466729_046000_127_1596 489
71 3300042636 Ga0466703_192699 Ga0466703_192699_1914_3419 489
72 3300042599 Ga0466706_110705 Ga0466706_110705_15317_16822 490
73 3300042612 Ga0466705_182651 Ga0466705_182651_214_1686 490
74 3300042616 Ga0466715_090180 Ga0466715_090180_1037_2545 490
75 3300042616 Ga0466715_399512 Ga0466715_399512_383_1855 490
76 3300042636 Ga0466703_419671 Ga0466703_419671_296_1768 490
77 3300042648 Ga0466709_161394 Ga0466709_161394_1789_3261 490
78 3300042649 Ga0466724_66179 Ga0466724_66179_56285_57757 490
79 3300007085 Ga0104045_1001630 Ga0104045_10016303 491
80 3300007085 Ga0104045_1074519 Ga0104045_10745191 491
81 3300007153 Ga0104050_1003332 Ga0104050_100333211 491
82 3300042590 Ga0466690_167294 Ga0466690_167294_14419_15894 491
83 3300042605 Ga0466716_028991 Ga0466716_028991_6910_8385 491
84 3300042624 Ga0466735_050071 Ga0466735_050071_28_1503 491
85 3300042624 Ga0466735_103851 Ga0466735_103851_573_2048 491
86 iso_pr_bacteria 3004667792 3004670982 491
87 3300010882 Ga0123354_10008691 Ga0123354_100086912 492
88 3300042601 Ga0466707_077345 Ga0466707_077345_8316_9794 492
89 3300042643 Ga0466704_212700 Ga0466704_212700_1628_3127 492
90 3300002931 CVPL010W_10000093 CVPL010W_1000009326 493
91 3300010882 Ga0123354_10001542 Ga0123354_100015424 493
92 3300042593 Ga0466691_061338 Ga0466691_061338_7350_8855 493
93 3300042620 Ga0466728_419825 Ga0466728_419825_5399_6880 493
94 iso_pr_bacteria 2830041218 2830043107 493
95 iso_pr_bacteria 3004672520 3004674722 493
96 2225789004 2227535755 2228053225 494
97 3300042609 Ga0466722_215783 Ga0466722_215783_3519_5003 494
98 3300042613 Ga0466710_046582 Ga0466710_046582_7271_8755 494
99 3300042655 Ga0466727_032251 Ga0466727_032251_1210_2694 494
100 3300042601 Ga0466707_382030 Ga0466707_382030_4007_5494 495
101 3300042636 Ga0466703_167217 Ga0466703_167217_6153_7640 495
102 3300007085 Ga0104045_1005821 Ga0104045_10058212 496
103 3300042593 Ga0466691_120752 Ga0466691_120752_19759_21249 496
104 3300042609 Ga0466722_082097 Ga0466722_082097_7160_8650 496
105 3300042612 Ga0466705_110782 Ga0466705_110782_635_2125 496
106 3300042612 Ga0466705_227189 Ga0466705_227189_812_2302 496
107 3300042643 Ga0466704_014684 Ga0466704_014684_817_2307 496
108 iso_pr_bacteria 2940202316 2940205058 496
109 3300007042 Ga0103263_101824 Ga0103263_1018242 497
110 3300009784 Ga0123357_10000256 Ga0123357_1000025630 497
111 3300042600 Ga0466700_080044 Ga0466700_080044_4885_6378 497
112 3300042602 Ga0466713_152985 Ga0466713_152985_19928_21421 497
113 3300042609 Ga0466722_056177 Ga0466722_056177_1587_3080 497
114 3300042636 Ga0466703_227764 Ga0466703_227764_7976_9469 497
115 3300042643 Ga0466704_470775 Ga0466704_470775_214_1707 497
116 3300042648 Ga0466709_156557 Ga0466709_156557_18474_19967 497
117 iso_pr_bacteria 2695420314 2695472941 497
118 3300042602 Ga0466713_133306 Ga0466713_133306_21307_22803 498
119 3300042606 Ga0466719_054245 Ga0466719_054245_15803_17299 498
120 3300042621 Ga0466729_053866 Ga0466729_053866_5441_6937 498
121 3300042636 Ga0466703_399369 Ga0466703_399369_26309_27805 498
122 3300042643 Ga0466704_182437 Ga0466704_182437_6353_7849 498
123 iso_pr_bacteria 2609459943 2610740575 498
124 3300005083 Ga0068305_10111347 Ga0068305_101113478 499
125 3300007085 Ga0104045_1026580 Ga0104045_10265803 499
126 3300007153 Ga0104050_1005502 Ga0104050_10055023 499
127 3300009784 Ga0123357_10059818 Ga0123357_100598182 499
128 3300010882 Ga0123354_10016623 Ga0123354_100166232 499
129 3300010882 Ga0123354_10096344 Ga0123354_100963442 499
130 3300012798 Ga0160454_100001 Ga0160454_100001252 499
131 3300012829 Ga0160467_101483 Ga0160467_1014832 499
132 3300042600 Ga0466700_041770 Ga0466700_041770_7805_9304 499
133 3300042606 Ga0466719_170760 Ga0466719_170760_92_1591 499
134 3300042616 Ga0466715_345003 Ga0466715_345003_8065_9564 499
135 iso_pr_bacteria 2940205530 2940207559 499
136 iso_pr_bacteria 2940212447 2940214474 499
137 iso_pr_bacteria 2940298504 2940300528 499
138 iso_pr_bacteria 2940302308 2940304467 499
139 iso_pr_bacteria 2940306115 2940308030 499
140 iso_pr_bacteria 2940309933 2940311706 499
141 iso_pr_bacteria 2940313741 2940315682 499
142 iso_pr_bacteria 2940317558 2940319498 499
143 iso_pr_bacteria 2940321370 2940324909 499
144 iso_pr_bacteria 2940325180 2940327202 499
145 iso_pr_bacteria 2940328985 2940331143 499
146 iso_pr_bacteria 2940332795 2940334734 499
147 3300002462 JGI24702J35022_10039416 JGI24702J35022_100394162 500
148 3300042609 Ga0466722_034653 Ga0466722_034653_8294_9796 500
149 3300042612 Ga0466705_128769 Ga0466705_128769_5456_6958 500
150 3300042619 Ga0466726_020158 Ga0466726_020158_10104_11606 500
151 3300042636 Ga0466703_125750 Ga0466703_125750_5226_6728 500
152 3300042636 Ga0466703_162504 Ga0466703_162504_1413_2915 500
153 3300012837 Ga0160455_100076 Ga0160455_10007661 501
154 3300012846 Ga0160433_100075 Ga0160433_10007511 501
155 3300042591 Ga0466692_089185 Ga0466692_089185_17853_19358 501
156 3300042615 Ga0466711_031256 Ga0466711_031256_10489_11994 501
157 3300042605 Ga0466716_039594 Ga0466716_039594_1750_3258 502
158 3300042605 Ga0466716_339497 Ga0466716_339497_19636_21144 502
159 3300042636 Ga0466703_396290 Ga0466703_396290_1741_3249 502
160 3300012820 Ga0160456_100113 Ga0160456_1001138 503
161 3300042612 Ga0466705_040836 Ga0466705_040836_1898_3409 503
162 3300042619 Ga0466726_478957 Ga0466726_478957_644_2155 503
163 3300042620 Ga0466728_127610 Ga0466728_127610_5810_7321 503
164 3300007085 Ga0104045_1001549 Ga0104045_10015492 504
165 3300007150 Ga0104019_1002153 Ga0104019_10021534 504
166 3300009784 Ga0123357_10016539 Ga0123357_100165392 504
167 3300042601 Ga0466707_121392 Ga0466707_121392_1022_2536 504
168 3300042619 Ga0466726_157010 Ga0466726_157010_6719_8236 505
169 3300042599 Ga0466706_252554 Ga0466706_252554_1008_2528 506
170 3300042616 Ga0466715_040603 Ga0466715_040603_1553_3076 507
171 3300042636 Ga0466703_102041 Ga0466703_102041_4034_5581 507
172 3300042659 Ga0466733_024429 Ga0466733_024429_3178_4701 507
173 3300042616 Ga0466715_217399 Ga0466715_217399_14030_15556 508
174 iso_pr_bacteria 2940244548 2940248033 514
175 iso_pr_bacteria 2940248789 2940252208 514
176 iso_pr_bacteria 2940253009 2940256431 514
177 iso_pr_bacteria 2940257232 2940260633 514
178 3300042621 Ga0466729_275936 Ga0466729_275936_257_1804 515
179 3300042652 Ga0466708_196794 Ga0466708_196794_479_2038 519
180 iso_pr_bacteria 2695420314 2695472505 521
181 3300010882 Ga0123354_10000156 Ga0123354_100001567 535

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF17189 Glyco_hydro_30C Glycosyl hydrolase family 30 beta sandwich domain 469 530 0.93
PF02055 Glyco_hydro_30 Glycosyl hydrolase family 30 TIM-barrel domain 122 464 0.8
PF02057 Glyco_hydro_59 Glycosyl hydrolase family 59 122 382 0.65

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.