Protein Family IF03444

Metagenome Isolate
172 Members
50 Samples
167 Scaffolds
440.94 Avg Length

🧬 Representative Sequence

ID
3300010882|Ga0123354_10000042|Ga0123354_1000004243
Length
424 aa
Sequence
MSRIIVDFNKVFGFVSEQQIFDRAERAESANIELENGTGKGSDFLGWLHLPSSTMEAGLNEVLETADELRARCEVVVIIGIGGSYLGARAVIDALSGSFDGLSNKKPVIVYAGHQIGEDYLHELTEYLTGKSFGIINISKSGTTTEPALAFRLLKKQLENAVGIDEARKRIIAITDRERGALRTLATRERYKTFVIPDDVGGRFSVLTLVGLLPIAVAGIDIQQLIAGAVEMEKATGTTVPFAKNPAAMYAVVRNELYLQGKKMEILANFNSKLHYVGEWWKQLFGESEGKENKGIFPAAVDIQEGERTIFETVLSVAQSRYTVEVPEDKADLDGLNYLAGKRVDYVNKMAELGTQQAHVAGGVPNIRIEIPELNEYCLGQLLYFFERACAISGYLLGVNPFDQPGVEAYKNNMFALLKKPGS*

📊 Sample Types

Isolate 2.9%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.7%
Kalotermitidae 28.6%
Unclassified 12.2%
Rhinotermitidae 8.2%
Termopsidae 6.1%
Passalidae 4.1%
Hodotermitidae 2.0%
Blattidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 169
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
4 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
10 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
11 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
12 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
15 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
19 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
20 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
21 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
22 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
25 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
26 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
27 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
28 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
29 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
30 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
31 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
35 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
36 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
37 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
38 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
39 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
40 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
41 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_395852 3300042612 Bacteria 5761
2 Ga0466705_460214 3300042612 Bacteria 4146
3 Ga0466711_155555 3300042615 Bacteria 4619
4 Ga0466723_113260 3300042618 Bacteria 45589
5 Ga0466726_344729 3300042619 Bacteria 4000
6 Ga0123354_10003084 3300010882 Bacteria 22749
7 Ga0466690_100077 3300042590 Bacteria 8481
8 Ga0466704_283999 3300042643 Bacteria 25730
9 Ga0466709_076850 3300042648 Bacteria 50213
10 Ga0466709_223600 3300042648 Bacteria 9989
11 Ga0466727_119437 3300042655 Bacteria 3624
12 Ga0466701_052708 3300042598 Bacteria 25914
13 Ga0466713_077436 3300042602 Bacteria 22165
14 Ga0466713_077669 3300042602 Bacteria 61043
15 Ga0466722_194750 3300042609 Bacteria 1759
16 2227403034 2225789004 Bacteria 5762
17 JGI24702J35022_10002702 3300002462 Bacteria 10763
18 JGI24705J35276_12221522 3300002504 Bacteria 2348
19 JGI24699J35502_11134154 3300002509 Bacteria 38326
20 Ga0123357_10001158 3300009784 Bacteria 27473
21 Ga0466705_164201 3300042612 Bacteria 2962
22 Ga0466715_165271 3300042616 Bacteria 2692
23 Ga0123357_10003901 3300009784 Bacteria 17309
24 Ga0123357_10010080 3300009784 Bacteria 11986
25 Ga0123357_10064000 3300009784 Unclassified 4917
26 Ga0123357_10117385 3300009784 Bacteria 3366
27 Ga0123356_10044868 3300010049 Bacteria 4114
28 Ga0123354_10002434 3300010882 Bacteria 24588
29 Ga0456237_0000003 3300041968 Bacteria 82299
30 Ga0466692_167919 3300042591 Bacteria 2540
31 Ga0466691_023288 3300042593 Bacteria 1649
32 Ga0466696_363248 3300042596 Bacteria 7847
33 Ga0466703_416209 3300042636 Bacteria 1814
34 Ga0466703_416796 3300042636 Bacteria 12962
35 Ga0466719_266385 3300042606 Bacteria 2231
36 Ga0466722_035543 3300042609 Bacteria 116913
37 Ga0466722_090744 3300042609 Bacteria 26452
38 IMNBL1DRAFT_c0001556 3300000062 Bacteria 17073
39 IMNBL1DRAFT_c0014079 3300000062 Bacteria 3553
40 JGI24699J35502_11133987 3300002509 Bacteria 22805
41 Ga0466715_317199 3300042616 Bacteria 12833
42 Ga0466715_372014 3300042616 Bacteria 24656
43 Ga0466723_043699 3300042618 Bacteria 2743
44 Ga0123357_10006419 3300009784 Bacteria 14343
45 Ga0123356_10096010 3300010049 Bacteria 2834
46 Ga0466690_039144 3300042590 Bacteria 6565
47 Ga0466690_165220 3300042590 Bacteria 1889
48 Ga0466690_262488 3300042590 Bacteria 4855
49 Ga0466695_265771 3300042595 Bacteria 4950
50 Ga0466696_323034 3300042596 Bacteria 3448
51 Ga0466704_243318 3300042643 Bacteria 32973
52 Ga0466708_073591 3300042652 Bacteria 6339
53 Ga0466713_049733 3300042602 Bacteria 2829
54 Ga0466713_071386 3300042602 Bacteria 40802
55 Ga0466716_276433 3300042605 Bacteria 12747
56 IMNBL1DRAFT_c0000345 3300000062 Bacteria 39398
57 JGI24705J35276_12233952 3300002504 Bacteria 5158
58 Ga0123357_10000419 3300009784 Bacteria 40548
59 Ga0466705_223226 3300042612 Bacteria 4215
60 Ga0466733_154955 3300042659 Bacteria 10677
61 Ga0466715_079087 3300042616 Bacteria 12214
62 Ga0466715_314614 3300042616 Bacteria 16526
63 Ga0466723_227268 3300042618 Bacteria 8623
64 Ga0466723_326767 3300042618 Bacteria 7130
65 Ga0466726_228066 3300042619 Bacteria 10586
66 Ga0466728_202574 3300042620 Bacteria 4984
67 Ga0466692_014618 3300042591 Bacteria 107882
68 Ga0466696_094699 3300042596 Bacteria 13208
69 Ga0466729_265332 3300042621 Bacteria 5556
70 Ga0466731_116772 3300042622 Bacteria 3810
71 Ga0466703_113183 3300042636 Bacteria 4402
72 Ga0466703_262133 3300042636 Bacteria 48736
73 Ga0466704_472212 3300042643 Bacteria 2972
74 Ga0466727_132693 3300042655 Bacteria 19237
75 Ga0466727_144655 3300042655 Bacteria 5084
76 Ga0466700_057887 3300042600 Bacteria 2800
77 Ga0466700_276650 3300042600 Bacteria 9365
78 Ga0466707_121228 3300042601 Bacteria 26661
79 Ga0466713_098111 3300042602 Bacteria 9321
80 Ga0466717_210207 3300042604 Bacteria 5538
81 Ga0466719_114028 3300042606 Bacteria 2627
82 Ga0466722_073992 3300042609 Bacteria 7758
83 JGI24702J35022_10001513 3300002462 Bacteria 14438
84 Ga0466728_034686 3300042620 Bacteria 6820
85 Ga0123357_10029046 3300009784 Bacteria 7495
86 Ga0123357_10118262 3300009784 Bacteria 3350
87 Ga0466692_027305 3300042591 Bacteria 7885
88 Ga0466725_078911 3300042654 Bacteria 22676
89 Ga0466727_098929 3300042655 Bacteria 2855
90 Ga0466706_242325 3300042599 Bacteria 5121
91 Ga0466700_257615 3300042600 Bacteria 7856
92 Ga0466707_075198 3300042601 Bacteria 13033
93 Ga0466713_040847 3300042602 Bacteria 12526
94 Ga0466714_148664 3300042603 Bacteria 2504
95 Ga0466714_157225 3300042603 Bacteria 12577
96 Ga0466716_025263 3300042605 Bacteria 7895
97 Ga0466716_415709 3300042605 Bacteria 17767
98 Ga0466722_097757 3300042609 Bacteria 5004
99 Ga0466722_122978 3300042609 Bacteria 2564
100 Ga0466698_304711 3300042610 Bacteria 1902
101 2227578523 2225789004 Unclassified 2535
102 IMNBL1DRAFT_c0000303 3300000062 Bacteria 41914
103 JGI24699J35502_11134073 3300002509 Bacteria 28326
104 Ga0123357_10001146 3300009784 Bacteria 27559
105 Ga0466705_316488 3300042612 Bacteria 1799
106 Ga0466733_019356 3300042659 Bacteria 61537
107 Ga0466710_067859 3300042613 Bacteria 1521
108 Ga0466723_029341 3300042618 Bacteria 7756
109 Ga0123357_10204752 3300009784 Bacteria 2235
110 Ga0123356_10036045 3300010049 Bacteria 4619
111 Ga0264413_149562 3300024493 Bacteria 3168
112 Ga0466690_241027 3300042590 Bacteria 13320
113 Ga0466690_341355 3300042590 Bacteria 23370
114 Ga0466691_195596 3300042593 Bacteria 68522
115 Ga0466696_344053 3300042596 Bacteria 20178
116 Ga0466735_013107 3300042624 Bacteria 3896
117 Ga0466704_256082 3300042643 Bacteria 3552
118 Ga0466704_445869 3300042643 Bacteria 10104
119 Ga0466709_407672 3300042648 Bacteria 84536
120 Ga0466698_443351 3300042610 Bacteria 1742
121 Ga0466697_013266 3300042611 Bacteria 1895
122 JGI24699J35502_11134225 3300002509 Bacteria 74107
123 Ga0466733_150986 3300042659 Unclassified 4299
124 Ga0466715_016119 3300042616 Bacteria 2246
125 Ga0466715_274705 3300042616 Bacteria 6072
126 Ga0466723_027644 3300042618 Bacteria 14041
127 Ga0466723_083949 3300042618 Bacteria 18458
128 Ga0466723_318795 3300042618 Bacteria 24156
129 Ga0466728_082257 3300042620 Bacteria 106309
130 Ga0123353_10046986 3300010167 Bacteria 6863
131 Ga0123354_10000042 3300010882 Bacteria 95103
132 Ga0466690_004552 3300042590 Bacteria 6148
133 Ga0466690_046251 3300042590 Bacteria 8970
134 Ga0466691_133902 3300042593 Bacteria 22965
135 Ga0466729_212660 3300042621 Bacteria 2366
136 Ga0466703_073365 3300042636 Bacteria 4727
137 Ga0466704_568650 3300042643 Bacteria 15350
138 Ga0466708_334452 3300042652 Bacteria 8300
139 Ga0466706_142882 3300042599 Bacteria 78904
140 Ga0466707_063004 3300042601 Bacteria 15160
141 Ga0466707_135985 3300042601 Bacteria 9923
142 Ga0466713_102957 3300042602 Bacteria 7684
143 Ga0466714_155104 3300042603 Bacteria 5063
144 Ga0466719_095502 3300042606 Bacteria 4988
145 Ga0466719_176141 3300042606 Bacteria 20840
146 Ga0466719_344761 3300042606 Bacteria 8775
147 Ga0466722_257304 3300042609 Bacteria 3941
148 Ga0466705_108901 3300042612 Bacteria 9778
149 Ga0466710_354966 3300042613 Bacteria 1858
150 Ga0466711_051038 3300042615 Bacteria 19046
151 Ga0466711_275090 3300042615 Bacteria 26757
152 Ga0466726_146641 3300042619 Bacteria 10357
153 Ga0466729_134083 3300042621 Bacteria 2961
154 Ga0123354_10004553 3300010882 Bacteria 19666
155 Ga0123354_10037989 3300010882 Bacteria 7482
156 Ga0466692_113976 3300042591 Bacteria 14367
157 Ga0466691_032806 3300042593 Bacteria 1619
158 Ga0466735_094639 3300042624 Bacteria 4379
159 Ga0466735_234997 3300042624 Bacteria 6166
160 Ga0466703_075593 3300042636 Bacteria 5222
161 Ga0466706_015749 3300042599 Bacteria 23160
162 Ga0466707_026105 3300042601 Bacteria 2745
163 Ga0466707_221100 3300042601 Bacteria 5235
164 Ga0466714_084201 3300042603 Bacteria 1571
165 Ga0466719_016366 3300042606 Bacteria 2665
166 Ga0466722_184008 3300042609 Bacteria 25711
167 JGI24705J35276_12236490 3300002504 Bacteria 8183

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10037989 Ga0123354_100379897 415
2 3300042590 Ga0466690_262488 Ga0466690_262488_15_1262 415
3 3300010882 Ga0123354_10000042 Ga0123354_1000004243 424
4 3300010049 Ga0123356_10096010 Ga0123356_100960102 425
5 3300042602 Ga0466713_102957 Ga0466713_102957_2672_3964 430
6 3300042609 Ga0466722_035543 Ga0466722_035543_58783_60075 430
7 3300042621 Ga0466729_212660 Ga0466729_212660_681_1973 430
8 3300009784 Ga0123357_10204752 Ga0123357_102047522 431
9 3300042590 Ga0466690_100077 Ga0466690_100077_6005_7348 431
10 3300042600 Ga0466700_257615 Ga0466700_257615_768_2063 431
11 3300042602 Ga0466713_077669 Ga0466713_077669_26651_27946 431
12 3300042624 Ga0466735_234997 Ga0466735_234997_2143_3438 431
13 3300042590 Ga0466690_046251 Ga0466690_046251_6838_8136 432
14 3300042596 Ga0466696_094699 Ga0466696_094699_900_2198 432
15 3300042596 Ga0466696_344053 Ga0466696_344053_8710_10059 432
16 3300042605 Ga0466716_025263 Ga0466716_025263_3288_4586 432
17 3300042609 Ga0466722_194750 Ga0466722_194750_327_1625 432
18 3300042612 Ga0466705_164201 Ga0466705_164201_13_1311 432
19 3300042618 Ga0466723_043699 Ga0466723_043699_673_1971 432
20 3300042636 Ga0466703_416209 Ga0466703_416209_301_1599 432
21 3300042643 Ga0466704_445869 Ga0466704_445869_7052_8350 432
22 iso_pr_bacteria 2820759988 2820762589 432
23 3300002509 JGI24699J35502_11134225 JGI24699J35502_1113422513 433
24 3300009784 Ga0123357_10001158 Ga0123357_1000115824 433
25 3300010049 Ga0123356_10044868 Ga0123356_100448682 433
26 3300010882 Ga0123354_10003084 Ga0123354_1000308413 433
27 3300042590 Ga0466690_004552 Ga0466690_004552_1062_2363 433
28 3300042591 Ga0466692_014618 Ga0466692_014618_82828_84129 433
29 3300042619 Ga0466726_228066 Ga0466726_228066_6916_8217 433
30 3300042655 Ga0466727_119437 Ga0466727_119437_512_1813 433
31 2225789004 2227403034 2227846141 434
32 2225789004 2227578523 2228128762 434
33 3300002509 JGI24699J35502_11134154 JGI24699J35502_1113415414 434
34 3300009784 Ga0123357_10006419 Ga0123357_1000641913 434
35 3300009784 Ga0123357_10064000 Ga0123357_100640002 434
36 3300009784 Ga0123357_10117385 Ga0123357_101173853 434
37 3300009784 Ga0123357_10118262 Ga0123357_101182622 434
38 3300010882 Ga0123354_10004553 Ga0123354_100045535 434
39 3300042600 Ga0466700_276650 Ga0466700_276650_498_1802 434
40 3300042601 Ga0466707_026105 Ga0466707_026105_963_2267 434
41 3300042601 Ga0466707_121228 Ga0466707_121228_2681_3985 434
42 3300042601 Ga0466707_135985 Ga0466707_135985_3823_5127 434
43 3300042606 Ga0466719_095502 Ga0466719_095502_2904_4208 434
44 3300042609 Ga0466722_122978 Ga0466722_122978_396_1700 434
45 3300042615 Ga0466711_275090 Ga0466711_275090_1021_2325 434
46 3300042616 Ga0466715_314614 Ga0466715_314614_6361_7665 434
47 3300042619 Ga0466726_344729 Ga0466726_344729_928_2232 434
48 3300042652 Ga0466708_073591 Ga0466708_073591_4304_5608 434
49 3300042655 Ga0466727_132693 Ga0466727_132693_3481_4785 434
50 3300000062 IMNBL1DRAFT_c0000303 IMNBL1DRAFT_000030311 435
51 3300000062 IMNBL1DRAFT_c0000345 IMNBL1DRAFT_00003458 435
52 3300002504 JGI24705J35276_12236490 JGI24705J35276_122364903 435
53 3300009784 Ga0123357_10003901 Ga0123357_1000390113 435
54 3300010882 Ga0123354_10002434 Ga0123354_100024348 435
55 3300042590 Ga0466690_241027 Ga0466690_241027_7706_9013 435
56 3300042624 Ga0466735_013107 Ga0466735_013107_799_2106 435
57 3300009784 Ga0123357_10000419 Ga0123357_1000041924 436
58 3300009784 Ga0123357_10001146 Ga0123357_100011467 436
59 3300042601 Ga0466707_075198 Ga0466707_075198_6452_7762 436
60 3300042620 Ga0466728_082257 Ga0466728_082257_66300_67610 436
61 3300042655 Ga0466727_144655 Ga0466727_144655_1859_3169 436
62 3300042598 Ga0466701_052708 Ga0466701_052708_2647_3960 437
63 3300042600 Ga0466700_057887 Ga0466700_057887_1181_2494 437
64 iso_pr_bacteria 2820762746 2820763977 437
65 3300002509 JGI24699J35502_11134073 JGI24699J35502_1113407321 438
66 3300042591 Ga0466692_167919 Ga0466692_167919_1058_2398 438
67 3300042602 Ga0466713_049733 Ga0466713_049733_699_2015 438
68 3300042590 Ga0466690_165220 Ga0466690_165220_208_1527 439
69 3300042602 Ga0466713_040847 Ga0466713_040847_5578_6897 439
70 3300042602 Ga0466713_098111 Ga0466713_098111_7150_8469 439
71 3300042616 Ga0466715_372014 Ga0466715_372014_20343_21662 439
72 3300042619 Ga0466726_146641 Ga0466726_146641_2755_4074 439
73 3300042636 Ga0466703_075593 Ga0466703_075593_3818_5137 439
74 3300042655 Ga0466727_098929 Ga0466727_098929_27_1346 439
75 3300042609 Ga0466722_184008 Ga0466722_184008_22104_23426 440
76 3300042593 Ga0466691_195596 Ga0466691_195596_66398_67723 441
77 3300042606 Ga0466719_114028 Ga0466719_114028_16_1341 441
78 3300042606 Ga0466719_176141 Ga0466719_176141_64_1389 441
79 3300042609 Ga0466722_257304 Ga0466722_257304_2295_3620 441
80 3300042611 Ga0466697_013266 Ga0466697_013266_316_1641 441
81 3300042613 Ga0466710_354966 Ga0466710_354966_494_1819 441
82 3300042616 Ga0466715_016119 Ga0466715_016119_336_1661 441
83 3300042616 Ga0466715_079087 Ga0466715_079087_6985_8310 441
84 3300042616 Ga0466715_165271 Ga0466715_165271_456_1781 441
85 3300042620 Ga0466728_034686 Ga0466728_034686_1451_2776 441
86 3300042621 Ga0466729_134083 Ga0466729_134083_998_2323 441
87 3300002462 JGI24702J35022_10002702 JGI24702J35022_100027027 442
88 3300042591 Ga0466692_113976 Ga0466692_113976_11578_12906 442
89 3300042603 Ga0466714_084201 Ga0466714_084201_53_1381 442
90 3300042610 Ga0466698_443351 Ga0466698_443351_173_1501 442
91 3300009784 Ga0123357_10010080 Ga0123357_100100804 443
92 3300042596 Ga0466696_363248 Ga0466696_363248_4084_5415 443
93 3300042599 Ga0466706_142882 Ga0466706_142882_63208_64539 443
94 3300042606 Ga0466719_266385 Ga0466719_266385_850_2181 443
95 3300042648 Ga0466709_076850 Ga0466709_076850_41244_42575 443
96 3300042648 Ga0466709_223600 Ga0466709_223600_1422_2753 443
97 3300042648 Ga0466709_407672 Ga0466709_407672_27796_29127 443
98 3300042659 Ga0466733_154955 Ga0466733_154955_7749_9080 443
99 3300002504 JGI24705J35276_12221522 JGI24705J35276_122215223 444
100 3300042604 Ga0466717_210207 Ga0466717_210207_3416_4750 444
101 3300042609 Ga0466722_073992 Ga0466722_073992_3046_4380 444
102 3300042610 Ga0466698_304711 Ga0466698_304711_384_1718 444
103 3300042612 Ga0466705_223226 Ga0466705_223226_2825_4159 444
104 3300042612 Ga0466705_395852 Ga0466705_395852_171_1505 444
105 3300042613 Ga0466710_067859 Ga0466710_067859_58_1392 444
106 3300042659 Ga0466733_150986 Ga0466733_150986_1455_2789 444
107 3300002462 JGI24702J35022_10001513 JGI24702J35022_1000151310 445
108 3300002504 JGI24705J35276_12233952 JGI24705J35276_122339523 445
109 3300010049 Ga0123356_10036045 Ga0123356_100360452 445
110 3300024493 Ga0264413_149562 Ga0264413_1495621 445
111 3300042599 Ga0466706_015749 Ga0466706_015749_15091_16428 445
112 3300042603 Ga0466714_157225 Ga0466714_157225_9846_11183 445
113 3300042609 Ga0466722_090744 Ga0466722_090744_7297_8634 445
114 3300042643 Ga0466704_283999 Ga0466704_283999_21987_23324 445
115 3300000062 IMNBL1DRAFT_c0014079 IMNBL1DRAFT_00140792 446
116 3300010167 Ga0123353_10046986 Ga0123353_100469862 446
117 3300042590 Ga0466690_341355 Ga0466690_341355_10790_12130 446
118 3300042593 Ga0466691_023288 Ga0466691_023288_277_1617 446
119 3300042601 Ga0466707_221100 Ga0466707_221100_50_1390 446
120 3300042615 Ga0466711_155555 Ga0466711_155555_649_1989 446
121 3300042618 Ga0466723_027644 Ga0466723_027644_7542_8882 446
122 3300042618 Ga0466723_029341 Ga0466723_029341_5647_6987 446
123 3300042618 Ga0466723_326767 Ga0466723_326767_1082_2422 446
124 3300042622 Ga0466731_116772 Ga0466731_116772_1218_2558 446
125 3300042624 Ga0466735_094639 Ga0466735_094639_740_2080 446
126 3300042643 Ga0466704_243318 Ga0466704_243318_11990_13330 446
127 3300042643 Ga0466704_472212 Ga0466704_472212_1282_2622 446
128 iso_pr_bacteria 2940216256 2940216401 446
129 3300042593 Ga0466691_133902 Ga0466691_133902_16344_17687 447
130 3300042596 Ga0466696_323034 Ga0466696_323034_1062_2405 447
131 3300042603 Ga0466714_148664 Ga0466714_148664_647_1990 447
132 3300042603 Ga0466714_155104 Ga0466714_155104_2605_3948 447
133 3300042605 Ga0466716_415709 Ga0466716_415709_2554_3897 447
134 3300042615 Ga0466711_051038 Ga0466711_051038_12257_13600 447
135 3300042616 Ga0466715_317199 Ga0466715_317199_4230_5573 447
136 3300042618 Ga0466723_113260 Ga0466723_113260_35785_37128 447
137 3300042620 Ga0466728_202574 Ga0466728_202574_1299_2642 447
138 3300042621 Ga0466729_265332 Ga0466729_265332_2957_4300 447
139 3300042636 Ga0466703_113183 Ga0466703_113183_2720_4063 447
140 3300042636 Ga0466703_416796 Ga0466703_416796_2171_3514 447
141 3300042643 Ga0466704_568650 Ga0466704_568650_1399_2742 447
142 3300042652 Ga0466708_334452 Ga0466708_334452_5666_7009 447
143 iso_pr_bacteria 2820757377 2820758264 447
144 3300002509 JGI24699J35502_11133987 JGI24699J35502_1113398710 448
145 3300042593 Ga0466691_032806 Ga0466691_032806_195_1541 448
146 3300042595 Ga0466695_265771 Ga0466695_265771_1545_2891 448
147 3300042602 Ga0466713_071386 Ga0466713_071386_7184_8530 448
148 3300042609 Ga0466722_097757 Ga0466722_097757_3061_4407 448
149 3300042612 Ga0466705_460214 Ga0466705_460214_241_1587 448
150 3300042616 Ga0466715_274705 Ga0466715_274705_997_2343 448
151 3300042618 Ga0466723_227268 Ga0466723_227268_6280_7626 448
152 3300042636 Ga0466703_073365 Ga0466703_073365_1822_3168 448
153 3300000062 IMNBL1DRAFT_c0001556 IMNBL1DRAFT_00015569 449
154 3300009784 Ga0123357_10029046 Ga0123357_100290462 449
155 3300042602 Ga0466713_077436 Ga0466713_077436_14881_16230 449
156 3300042606 Ga0466719_016366 Ga0466719_016366_520_1869 449
157 3300042606 Ga0466719_344761 Ga0466719_344761_5068_6417 449
158 3300042612 Ga0466705_108901 Ga0466705_108901_330_1679 449
159 3300042618 Ga0466723_318795 Ga0466723_318795_16728_18077 449
160 3300042643 Ga0466704_256082 Ga0466704_256082_1274_2623 449
161 3300042654 Ga0466725_078911 Ga0466725_078911_17415_18764 449
162 3300042591 Ga0466692_027305 Ga0466692_027305_6156_7508 450
163 3300042590 Ga0466690_039144 Ga0466690_039144_4950_6308 452
164 3300042599 Ga0466706_242325 Ga0466706_242325_2778_4136 452
165 3300042601 Ga0466707_063004 Ga0466707_063004_813_2171 452
166 3300041968 Ga0456237_0000003 Ga0456237_0000003_15439_16800 453
167 3300042612 Ga0466705_316488 Ga0466705_316488_180_1541 453
168 iso_pr_bacteria 643348524 643423295 453
169 3300042618 Ga0466723_083949 Ga0466723_083949_13894_15261 455
170 3300042605 Ga0466716_276433 Ga0466716_276433_10722_12098 458
171 3300042659 Ga0466733_019356 Ga0466733_019356_32558_33937 459
172 3300042636 Ga0466703_262133 Ga0466703_262133_949_2424 491

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00342 PGI Phosphoglucose isomerase 360 412 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.