Protein Family IF03441
Metagenome
Isolate
317
Members
235
Samples
109
Scaffolds
498.52
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10000011|Ga0123354_10000011122
- Length
- 496 aa
- Sequence
- MAFILSLDQGTTSSRALVFDADSHVVAMAQQEFPQRFPQPGWVEHDPMAIWSTQMAVLHGALAKAHLRLRDIAAIGITNQRETTLVWDKKTGAPLAPAIVWQDRRTAGLCDRLRAQGFAETLRAKTGLELDAYFSASKLQWLLDNVSGLRARAERGEIAFGTVDSWLVWQLTRGREHLTDISNASRTLLYNIHDQRWDDELLALFDIPATMLPRVVPSSGHLAEAEFDGERVPIAGIAGDQQAALFGQACHRPGLAKNTYGTGCFLLRHTGEAPVTSAHRLISTIAWQCGNRSTQYALEGSVFIGGAVVQWLRDGLKIIRNAADIEALAQKVPDNGGVYFVPAFAGLGAPHWDAYARGAIIGLTRGTQDTHLARAALEAIALQSADMLEAMNRDTGEALTELRVDGGAAANNLLMQIQADFLGVPVVRPKNQETTALGAAQLAGLAVGYWRDAETLAARWEVDRVFEPTLSADQRETVRAQWRRAVERAKGWESA*
Sample Types
Isolate
65.6%
Metagenome
34.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Coreidae
34.1%
Blattidae
6.2%
Termitidae
6.2%
Unclassified
5.8%
Cryptocercidae
5.3%
Kalotermitidae
5.3%
Blaberidae
4.0%
Culicidae
3.5%
Elmidae
3.1%
Blattellidae
3.1%
Formicidae
2.7%
Drosophilidae
2.2%
Pseudophyllodromiidae
1.8%
Passalidae
1.8%
Armadillidiidae
1.8%
Corydiidae
1.3%
Rhinotermitidae
1.3%
Apidae
0.9%
Termopsidae
0.9%
Largidae
0.9%
Berytidae
0.9%
Anaplectidae
0.9%
Ectobiidae
0.9%
Nyctiboridae
0.9%
Hydrophilidae
0.4%
Daphniidae
0.4%
Hodotermitidae
0.4%
Noctuidae
0.4%
Bombycidae
0.4%
Alydidae
0.4%
Tenebrionidae
0.4%
Tryonicidae
0.4%
Curculionidae
0.4%
Lamproblattidae
0.4%
Taxonomy
Archaea
0
Bacteria
309
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2833033236 | Blattabacterium sp. CKYod | Isolate | Cryptocercidae |
| 2 | 2833047020 | Blattabacterium punctulatus CPUbt | Isolate | Cryptocercidae |
| 3 | 2833050843 | Blattabacterium punctulatus CPUmc | Isolate | Cryptocercidae |
| 4 | 2864948220 | Elizabethkingia anophelis S00205 | Isolate | Elmidae |
| 5 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 6 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 7 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 8 | 2590828803 | Pedobacter glucosidilyticus DD6b | Isolate | Daphniidae |
| 9 | 2695420314 | Dysgonomonas sp. BGC7 | Isolate | Unclassified |
| 10 | 2785510743 | Apibacter sp. ESL0404 | Isolate | Apidae |
| 11 | 2518645548 | Blattabacterium sp. (Blaberus giganteus) | Isolate | Blaberidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 14 | 8025650824 | Caballeronia hypogeia LZ032 | Isolate | Coreidae |
| 15 | 8025671076 | Caballeronia cordobensis LZ034LL | Isolate | Coreidae |
| 16 | 8025735396 | Caballeronia zhejiangensis LZ016 | Isolate | Coreidae |
| 17 | 8102047609 | Caballeronia sp. GACF5 | Isolate | Coreidae |
| 18 | 8102074813 | Caballeronia sp. GAWG1-1 | Isolate | Coreidae |
| 19 | 8102081745 | Caballeronia sp. GAWG1-5s-s | Isolate | Coreidae |
| 20 | 8102117041 | Caballeronia sp. INML3 | Isolate | Coreidae |
| 21 | 8102131453 | Caballeronia sp. INML5 | Isolate | Coreidae |
| 22 | 8102138357 | Caballeronia sp. INSB1 | Isolate | Coreidae |
| 23 | 8102216467 | Caballeronia sp. LZ033 | Isolate | Coreidae |
| 24 | 8102230706 | Caballeronia sp. LZ035 | Isolate | Coreidae |
| 25 | 8102239244 | Caballeronia sp. LZ043 | Isolate | Coreidae |
| 26 | 650716011 | Blattabacterium sp. Bge | Isolate | Blattellidae |
| 27 | 3002002726 | Blattabacterium cuenoti PARATEMsp | Isolate | Blattellidae |
| 28 | 3002027480 | Blattabacterium cuenoti SCHULTlam | Isolate | Unclassified |
| 29 | 3002031819 | Blattabacterium cuenoti SHELFORDIsp | Isolate | Pseudophyllodromiidae |
| 30 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 31 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 34 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2864812326 | Chitinimonas taiwanensis S00057 | Isolate | Elmidae |
| 37 | 2864874997 | Acinetobacter lwoffii S00127 | Isolate | Elmidae |
| 38 | 2896330536 | Sphingobacterium sp. xlx-96 | Isolate | |
| 39 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 40 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 41 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 42 | 2529292732 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 43 | 8023757577 | Caballeronia peredens LP006 | Isolate | Coreidae |
| 44 | 8025678175 | Caballeronia hypogeia LZ043 | Isolate | Coreidae |
| 45 | 8025728939 | Caballeronia telluris LZ024 | Isolate | Coreidae |
| 46 | 8025747911 | Caballeronia peredens LZ003 | Isolate | Coreidae |
| 47 | 8069755105 | Caballeronia sp. LZ003 | Isolate | Coreidae |
| 48 | 8069775773 | Caballeronia sp. LZ062 | Isolate | Coreidae |
| 49 | 8101951471 | Caballeronia sp. AAUFL_F1_KS45 | Isolate | Coreidae |
| 50 | 8101974301 | Caballeronia sp. ASUFL_F2_KS49 | Isolate | Coreidae |
| 51 | 8101981714 | Caballeronia sp. ATUFL_F1_KS39 | Isolate | Coreidae |
| 52 | 8102020860 | Caballeronia sp. AZ10_KS36 | Isolate | Coreidae |
| 53 | 8102026984 | Caballeronia sp. AZ1_KS37 | Isolate | Coreidae |
| 54 | 8102067727 | Caballeronia sp. GAFFF3 | Isolate | Coreidae |
| 55 | 3002026852 | Blattabacterium cuenoti BEYBkur | Isolate | Blattellidae |
| 56 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 57 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 58 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 59 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 60 | 8114076984 | Elizabethkingia anophelis R26 | Isolate | Culicidae |
| 61 | 2833030225 | Blattabacterium punctulatus CPUmp | Isolate | Cryptocercidae |
| 62 | 2864788197 | Elizabethkingia anophelis S00027 | Isolate | Elmidae |
| 63 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 64 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 65 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 66 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 67 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 68 | 8021899934 | Acinetobacter sp. AR2-3 | Isolate | Culicidae |
| 69 | 8025716094 | Caballeronia zhejiangensis LZ028 | Isolate | Coreidae |
| 70 | 8101960468 | Caballeronia sp. AAUFL_F2_KS46 | Isolate | Coreidae |
| 71 | 8101988189 | Caballeronia sp. ATUFL_F1_KS4A | Isolate | Coreidae |
| 72 | 8102014801 | Caballeronia sp. ATUFL_M2_KS44 | Isolate | Coreidae |
| 73 | 8102060671 | Caballeronia sp. GAFFF2 | Isolate | Coreidae |
| 74 | 8102208438 | Caballeronia sp. LZ032 | Isolate | Coreidae |
| 75 | 8102251710 | Caballeronia sp. LZ065 | Isolate | Coreidae |
| 76 | 8102279326 | Caballeronia sp. NCTM1 | Isolate | Coreidae |
| 77 | 3002024525 | Blattabacterium cuenoti EPILAmay | Isolate | Blaberidae |
| 78 | 3002026254 | Blattabacterium cuenoti BALTAsp | Isolate | Pseudophyllodromiidae |
| 79 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 80 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 81 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 82 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 83 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 84 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 85 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 86 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 87 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 88 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 89 | 2833044002 | Blattabacterium punctulatus CPUbr | Isolate | Cryptocercidae |
| 90 | 2864808494 | Chitinimonas taiwanensis S00056 | Isolate | Elmidae |
| 91 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 92 | 2531839311 | Acinetobacter sp. HA | Isolate | Noctuidae |
| 93 | 2579779088 | Sphingobacterium paucimobilis HER1398 | Isolate | Bombycidae |
| 94 | 2597489944 | Caballeronia insecticola RPE64 | Isolate | Alydidae |
| 95 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 96 | 2511231112 | Blattabacterium punctulatus Cpu | Isolate | Cryptocercidae |
| 97 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 98 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 99 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 100 | 8023752828 | Caballeronia grimmiae LZ062 | Isolate | Coreidae |
| 101 | 8024019580 | Caballeronia sp. Lep1P3 | Isolate | Coreidae |
| 102 | 8024044713 | Caballeronia sp. Sq4a | Isolate | Coreidae |
| 103 | 8069763219 | Caballeronia sp. LZ008 | Isolate | Coreidae |
| 104 | 8102001125 | Caballeronia sp. ATUFL_F2_KS9A | Isolate | Coreidae |
| 105 | 8102169119 | Caballeronia sp. LZ016 | Isolate | Coreidae |
| 106 | 8102181083 | Caballeronia sp. LZ025 | Isolate | Coreidae |
| 107 | 8102271933 | Caballeronia sp. NCF4 | Isolate | Coreidae |
| 108 | 8071415077 | Blattabacterium cuenoti MACROPArhi | Isolate | Blaberidae |
| 109 | 3002003370 | Blattabacterium cuenoti THEREAreg | Isolate | Corydiidae |
| 110 | 3002005207 | Blattabacterium cuenoti MELANOZsp | Isolate | Blattidae |
| 111 | 3002007112 | Blattabacterium cuenoti CYRTOsp | Isolate | Blaberidae |
| 112 | 3002008367 | Blattabacterium cuenoti PARANAUcir | Isolate | Blaberidae |
| 113 | 3002023256 | Blattabacterium cuenoti RHABDOBsp | Isolate | Blaberidae |
| 114 | 3002028747 | Blattabacterium cuenoti ESCALves | Isolate | Blattellidae |
| 115 | 3002030550 | Blattabacterium cuenoti NEOLAXmac | Isolate | Blaberidae |
| 116 | 3003878002 | Paraburkholderia sp. PGU19 | Isolate | Largidae |
| 117 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 118 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 119 | 2832298047 | Apibacter sp. wkB309 | Isolate | Apidae |
| 120 | 2833043393 | Blattabacterium clevelandi CCLhc | Isolate | Cryptocercidae |
| 121 | 2847090942 | Elizabethkingia anophelis Ag1 | Isolate | Culicidae |
| 122 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 123 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 124 | 2225789003 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) | Metagenome | Passalidae |
| 125 | 2687453786 | Chryseobacterium culicis DSM 23031 | Isolate | Unclassified |
| 126 | 8024014383 | Caballeronia sp. SL2Y3 | Isolate | Berytidae |
| 127 | 8025740903 | Caballeronia zhejiangensis LZ008 | Isolate | Coreidae |
| 128 | 8069748016 | Caballeronia sp. LP003 | Isolate | Coreidae |
| 129 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 130 | 8102033761 | Caballeronia sp. AZ7_KS35 | Isolate | Coreidae |
| 131 | 8102094248 | Caballeronia sp. GaOx3 | Isolate | Coreidae |
| 132 | 8102109360 | Caballeronia sp. INML2 | Isolate | Coreidae |
| 133 | 8102145433 | Caballeronia sp. LP006 | Isolate | Coreidae |
| 134 | 8102186987 | Caballeronia sp. LZ028 | Isolate | Coreidae |
| 135 | 8102223607 | Caballeronia sp. LZ034LL | Isolate | Coreidae |
| 136 | 8102286609 | Caballeronia sp. NCTM5 | Isolate | Coreidae |
| 137 | 3001995955 | Blattabacterium cuenoti ANAPcal | Isolate | Anaplectidae |
| 138 | 3002008998 | Blattabacterium cuenoti PARCOBvir | Isolate | Blattellidae |
| 139 | 3002022645 | Blattabacterium cuenoti TRYONIpar | Isolate | Tryonicidae |
| 140 | 3002025161 | Blattabacterium cuenoti MEDIASdel | Isolate | Pseudophyllodromiidae |
| 141 | 3002029927 | Blattabacterium cuenoti CHORISOsp | Isolate | Pseudophyllodromiidae |
| 142 | 3002031185 | Blattabacterium cuenoti OPISTHori | Isolate | Blaberidae |
| 143 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 144 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 145 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 146 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 147 | 2833037493 | Blattabacterium punctulatus CPUsv | Isolate | Cryptocercidae |
| 148 | 2833042786 | Blattabacterium punctulatus CPUsm | Isolate | Cryptocercidae |
| 149 | 2833051446 | Blattabacterium punctulatus CPUml | Isolate | Cryptocercidae |
| 150 | 2848339753 | Ephemeroptericola cinctiostellae F02 | Isolate | Unclassified |
| 151 | 2864923010 | Elizabethkingia anophelis S00177 | Isolate | Elmidae |
| 152 | 2864973726 | Acinetobacter schindleri S00243 | Isolate | Elmidae |
| 153 | 2896321640 | Sphingobacterium sp. xlx-130 | Isolate | |
| 154 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 155 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 156 | 2861449170 | Desulfovibrio intestinalis DSM 11275 | Isolate | Unclassified |
| 157 | 8023724303 | Caballeronia zhejiangensis LP003 | Isolate | Coreidae |
| 158 | 8024001094 | Caballeronia sp. TF1N1 | Isolate | Berytidae |
| 159 | 8025666332 | Caballeronia grimmiae LZ050 | Isolate | Coreidae |
| 160 | 8025694439 | Caballeronia cordobensis LZ033 | Isolate | Coreidae |
| 161 | 8025701579 | Caballeronia telluris LZ031 | Isolate | Coreidae |
| 162 | 8101967387 | Caballeronia sp. AAUFL_F3_KS11A | Isolate | Coreidae |
| 163 | 8102007614 | Caballeronia sp. ATUFL_M1_KS5A | Isolate | Coreidae |
| 164 | 8102087471 | Caballeronia sp. GAWG2-1 | Isolate | Coreidae |
| 165 | 8102201977 | Caballeronia sp. LZ031 | Isolate | Coreidae |
| 166 | 8102264549 | Caballeronia sp. NCF2 | Isolate | Coreidae |
| 167 | 3002002099 | Blattabacterium cuenoti ECTONUhan | Isolate | Ectobiidae |
| 168 | 3002004002 | Blattabacterium cuenoti EUPOLsin | Isolate | Corydiidae |
| 169 | 3002006476 | Blattabacterium cuenoti GYNAcap | Isolate | Blaberidae |
| 170 | 3002032411 | Blattabacterium cuenoti POLYPHAGsp | Isolate | Corydiidae |
| 171 | 3006190525 | Acinetobacter sp. S54 | Isolate | Curculionidae |
| 172 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 173 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 174 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 175 | 3300012831 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG | Metagenome | Culicidae |
| 176 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 177 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 178 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 179 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 180 | 2833034481 | Blattabacterium punctulatus CPUwf | Isolate | Cryptocercidae |
| 181 | 2894649344 | Allomuricauda alvinocaridis SCR12 | Isolate | Unclassified |
| 182 | 2898741527 | Sphingobacterium sp. xlx-73 | Isolate | |
| 183 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 184 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 185 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 186 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 187 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 188 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 189 | 8020009074 | Elizabethkingia anophelis MSU001 | Isolate | Culicidae |
| 190 | 8023747282 | Caballeronia zhejiangensis LZ019 | Isolate | Coreidae |
| 191 | 8024025509 | Caballeronia grimmiae Lep1A1 | Isolate | Coreidae |
| 192 | 8024037630 | Caballeronia zhejiangensis A33_M4_a | Isolate | Coreidae |
| 193 | 8025685901 | Caballeronia fortuita LZ035 | Isolate | Coreidae |
| 194 | 8025723035 | Caballeronia grimmiae LZ025 | Isolate | Coreidae |
| 195 | 8025756023 | Caballeronia peredens LZ002 | Isolate | Coreidae |
| 196 | 8078130113 | Caballeronia sp. INDeC2 | Isolate | Coreidae |
| 197 | 8102054868 | Caballeronia sp. GAFFF1 | Isolate | Coreidae |
| 198 | 8102102351 | Caballeronia sp. INML1 | Isolate | Coreidae |
| 199 | 8102161003 | Caballeronia sp. LZ002 | Isolate | Coreidae |
| 200 | 8102174626 | Caballeronia sp. LZ024 | Isolate | Coreidae |
| 201 | 8102246966 | Caballeronia sp. LZ050 | Isolate | Coreidae |
| 202 | 646311912 | Blattabacterium sp. BPLAN | Isolate | Blattidae |
| 203 | 3001995318 | Blattabacterium cuenoti DYAKIkur | Isolate | Blattellidae |
| 204 | 3002004631 | Blattabacterium cuenoti ANAPome | Isolate | Anaplectidae |
| 205 | 3002033046 | Blattabacterium cuenoti ANALLAmet | Isolate | Blattellidae |
| 206 | 3003178663 | Psychrobacter fulvigenes KC-40 | Isolate | Unclassified |
| 207 | 3003869270 | Paraburkholderia sp. PGU16 | Isolate | Largidae |
| 208 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 209 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 210 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 211 | 2833033875 | Blattabacterium punctulatus CPUpc | Isolate | Cryptocercidae |
| 212 | 2896350215 | Sphingobacterium sp. xlx-183 | Isolate | |
| 213 | 2799112231 | Apibacter sp. ESL0432 | Isolate | Unclassified |
| 214 | 2561511170 | Blattabacterium sp. (Blatta orientalis) Tarazona | Isolate | Unclassified |
| 215 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 216 | 8025658853 | Caballeronia temeraria LZ065 | Isolate | Coreidae |
| 217 | 8025708040 | Caballeronia jiangsuensis LZ029 | Isolate | Coreidae |
| 218 | 8069770227 | Caballeronia sp. LZ019 | Isolate | Coreidae |
| 219 | 8101994502 | Caballeronia sp. ATUFL_F2_KS42 | Isolate | Coreidae |
| 220 | 8102124461 | Caballeronia sp. INML3B | Isolate | Coreidae |
| 221 | 8102193924 | Caballeronia sp. LZ029 | Isolate | Coreidae |
| 222 | 8102312426 | Caballeronia sp. AAUFL_F1_KS47 | Isolate | Coreidae |
| 223 | 2998907766 | Penaeicola halotolerans LMIT005 | Isolate | |
| 224 | 3002005847 | Blattabacterium cuenoti ECTOBIsp | Isolate | Ectobiidae |
| 225 | 3002007740 | Blattabacterium cuenoti NYCTIBsp | Isolate | Nyctiboridae |
| 226 | 3002023891 | Blattabacterium cuenoti MEGALOsp | Isolate | Nyctiboridae |
| 227 | 3002028123 | Blattabacterium cuenoti LAMPROsp | Isolate | Lamproblattidae |
| 228 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 229 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 230 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 231 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 232 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 233 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 234 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 235 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0160472_100014 | 3300012839 | Bacteria | 407408 |
| 2 | Ga0466656_189887 | 3300042550 | Bacteria | 2174 |
| 3 | Ga0466711_163087 | 3300042615 | Bacteria | 3714 |
| 4 | Ga0466735_022220 | 3300042624 | Bacteria | 2209 |
| 5 | Ga0466730_064246 | 3300042625 | Bacteria | 22251 |
| 6 | Ga0466713_048475 | 3300042602 | Bacteria | 59892 |
| 7 | IMNBL1DRAFT_c0001626 | 3300000062 | Bacteria | 16653 |
| 8 | JGI24702J35022_10000930 | 3300002462 | Bacteria | 18284 |
| 9 | Ga0102736_1000038 | 3300007052 | Bacteria | 38146 |
| 10 | Ga0102734_1000001 | 3300007129 | Bacteria | 111616 |
| 11 | Ga0102740_1000844 | 3300007140 | Bacteria | 8320 |
| 12 | Ga0466657_182179 | 3300042582 | Bacteria | 126315 |
| 13 | Ga0466690_172552 | 3300042590 | Bacteria | 16249 |
| 14 | Ga0466693_000290 | 3300042592 | Bacteria | 4175 |
| 15 | Ga0466711_141279 | 3300042615 | Bacteria | 13831 |
| 16 | Ga0466704_036945 | 3300042643 | Bacteria | 10208 |
| 17 | Ga0466709_304970 | 3300042648 | Bacteria | 8243 |
| 18 | Ga0466724_27614 | 3300042649 | Bacteria | 4260 |
| 19 | Ga0160466_100003 | 3300012809 | Bacteria | 533375 |
| 20 | Ga0466706_037523 | 3300042599 | Bacteria | 6561 |
| 21 | Ga0466713_121119 | 3300042602 | Bacteria | 29592 |
| 22 | Ga0466713_139066 | 3300042602 | Bacteria | 109882 |
| 23 | Ga0466716_014899 | 3300042605 | Bacteria | 5101 |
| 24 | Ga0466722_063593 | 3300042609 | Bacteria | 9439 |
| 25 | IMNBL1DRAFT_c0005131 | 3300000062 | Bacteria | 7610 |
| 26 | JGI24698J34947_10019122 | 3300002449 | Bacteria | 3698 |
| 27 | Ga0104048_1004318 | 3300007143 | Bacteria | 5865 |
| 28 | Ga0104019_1000278 | 3300007150 | Bacteria | 6800 |
| 29 | Ga0562377_0004 | 3300056842 | Bacteria | 3525959 |
| 30 | Ga0160453_100001 | 3300012814 | Bacteria | 1272344 |
| 31 | Ga0160472_100031 | 3300012839 | Bacteria | 275018 |
| 32 | Ga0466704_468019 | 3300042643 | Bacteria | 4426 |
| 33 | Ga0466724_09429 | 3300042649 | Bacteria | 389876 |
| 34 | Ga0466725_372140 | 3300042654 | Bacteria | 27057 |
| 35 | Ga0160465_100022 | 3300012803 | Bacteria | 240640 |
| 36 | Ga0160465_100215 | 3300012803 | Bacteria | 44010 |
| 37 | Ga0466713_076223 | 3300042602 | Bacteria | 4762 |
| 38 | 2227144701 | 2225789004 | Bacteria | 8654 |
| 39 | IMNBGM34_c000075 | 3300000036 | Bacteria | 27871 |
| 40 | JGI24702J35022_10000047 | 3300002462 | Bacteria | 51139 |
| 41 | CVPL010W_10000077 | 3300002931 | Bacteria | 66144 |
| 42 | Ga0068305_10007915 | 3300005083 | Bacteria | 15522 |
| 43 | Ga0104045_1008422 | 3300007085 | Bacteria | 4723 |
| 44 | Ga0104019_1001560 | 3300007150 | Bacteria | 2180 |
| 45 | Ga0103264_1000036 | 3300007188 | Bacteria | 135516 |
| 46 | Ga0160456_100113 | 3300012820 | Bacteria | 83708 |
| 47 | Ga0160459_100026 | 3300012831 | Bacteria | 340969 |
| 48 | Ga0160434_100061 | 3300012850 | Bacteria | 75989 |
| 49 | Ga0466656_113307 | 3300042550 | Bacteria | 12941 |
| 50 | Ga0466657_129717 | 3300042582 | Bacteria | 2448 |
| 51 | Ga0466696_051274 | 3300042596 | Bacteria | 75898 |
| 52 | Ga0466696_273741 | 3300042596 | Bacteria | 2969 |
| 53 | Ga0466715_256528 | 3300042616 | Bacteria | 31335 |
| 54 | Ga0123353_10160454 | 3300010167 | Bacteria | 3580 |
| 55 | Ga0123354_10000011 | 3300010882 | Bacteria | 166906 |
| 56 | Ga0160464_100009 | 3300012805 | Bacteria | 325341 |
| 57 | Ga0466719_310007 | 3300042606 | Bacteria | 11914 |
| 58 | Ga0466722_240465 | 3300042609 | Bacteria | 2864 |
| 59 | JGI24702J35022_10008056 | 3300002462 | Unclassified | 5998 |
| 60 | Ga0160455_100001 | 3300012837 | Bacteria | 1265300 |
| 61 | Ga0466701_014363 | 3300042598 | Bacteria | 236823 |
| 62 | Ga0466728_148023 | 3300042620 | Bacteria | 8986 |
| 63 | Ga0466703_165671 | 3300042636 | Bacteria | 7972 |
| 64 | Ga0466724_27476 | 3300042649 | Bacteria | 555291 |
| 65 | Ga0466713_016019 | 3300042602 | Bacteria | 439221 |
| 66 | Ga0466713_116260 | 3300042602 | Bacteria | 47144 |
| 67 | Ga0466716_067317 | 3300042605 | Bacteria | 9638 |
| 68 | Ga0466722_060520 | 3300042609 | Bacteria | 33238 |
| 69 | JGI24702J35022_10003657 | 3300002462 | Bacteria | 9259 |
| 70 | Ga0104050_1000782 | 3300007153 | Unclassified | 2744 |
| 71 | Ga0160472_100669 | 3300012839 | Unclassified | 16904 |
| 72 | Ga0466657_387454 | 3300042582 | Bacteria | 3739 |
| 73 | Ga0466711_106724 | 3300042615 | Unclassified | 14338 |
| 74 | Ga0466703_139829 | 3300042636 | Unclassified | 8267 |
| 75 | Ga0466709_249842 | 3300042648 | Bacteria | 4974 |
| 76 | Ga0123353_10152623 | 3300010167 | Bacteria | 3686 |
| 77 | Ga0466701_089314 | 3300042598 | Bacteria | 182031 |
| 78 | Ga0466719_220903 | 3300042606 | Bacteria | 3551 |
| 79 | Ga0466722_155944 | 3300042609 | Unclassified | 2462 |
| 80 | Ga0068305_10000087 | 3300005083 | Bacteria | 586632 |
| 81 | Ga0068305_10035500 | 3300005083 | Bacteria | 13274 |
| 82 | Ga0104045_1001142 | 3300007085 | Unclassified | 10810 |
| 83 | Ga0104019_1002413 | 3300007150 | Bacteria | 8600 |
| 84 | Ga0160467_103168 | 3300012829 | Bacteria | 2969 |
| 85 | Ga0466710_195819 | 3300042613 | Bacteria | 3133 |
| 86 | Ga0466729_109379 | 3300042621 | Bacteria | 8920 |
| 87 | Ga0466734_027964 | 3300042623 | Bacteria | 2996 |
| 88 | Ga0466708_048150 | 3300042652 | Bacteria | 8140 |
| 89 | Ga0123353_10115024 | 3300010167 | Bacteria | 4330 |
| 90 | Ga0466713_049815 | 3300042602 | Bacteria | 24986 |
| 91 | Ga0466713_085543 | 3300042602 | Bacteria | 51640 |
| 92 | Ga0466713_149830 | 3300042602 | Bacteria | 16575 |
| 93 | Ga0466722_229846 | 3300042609 | Bacteria | 6659 |
| 94 | Ga0103265_1000001 | 3300007068 | Bacteria | 182519 |
| 95 | Ga0104050_1003329 | 3300007153 | Bacteria | 12045 |
| 96 | Ga0105553_1007592 | 3300007767 | Bacteria | 4800 |
| 97 | Ga0466705_139978 | 3300042612 | Bacteria | 6061 |
| 98 | Ga0466733_165496 | 3300042659 | Bacteria | 147790 |
| 99 | Ga0160457_1002562 | 3300012858 | Bacteria | 3666 |
| 100 | Ga0466701_006567 | 3300042598 | Bacteria | 2618 |
| 101 | Ga0466715_499819 | 3300042616 | Bacteria | 11901 |
| 102 | Ga0466709_144300 | 3300042648 | Bacteria | 37983 |
| 103 | Ga0466727_140140 | 3300042655 | Bacteria | 5890 |
| 104 | Ga0466706_085634 | 3300042599 | Bacteria | 10188 |
| 105 | 2227069687 | 2225789003 | Bacteria | 13273 |
| 106 | 2227466301 | 2225789004 | Bacteria | 24591 |
| 107 | JGI24702J35022_10015563 | 3300002462 | Bacteria | 4181 |
| 108 | Ga0068305_10014013 | 3300005083 | Unclassified | 7721 |
| 109 | Ga0104045_1075305 | 3300007085 | Bacteria | 2051 |
Family Sequences
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.94 | 0.94 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.