Protein Family IF03438
Metagenome
Isolate
360
Members
324
Samples
109
Scaffolds
223.71
Avg Length
Representative Sequence
- ID
- 3300010225|Ga0136160_1000047|Ga0136160_1000047278
- Length
- 230 aa
- Sequence
- MEHKMNYTLTKADVSNKNNKNYPRQTVESVSDPIKEYVKNNIFMGTITKLLHKLVNWGRKNSLWPYNFGLSCCYVEMVSAFTSVHDVARFGSEVLRASPRQADVMVIAGTPFIKMAPVIQRLYDQMLEPKWVISMGACANSGGMYDIYSVVQGVDKFLPVDIYIPGCPPRPEAYIQALMLLQKLIQEERRPLSWIIGEQGVYHKKMLSERVKKRRKIIDIVNLSTPEKI*
Sample Types
Isolate
69.7%
Metagenome
30.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Aphididae
17.3%
Unclassified
12.7%
Drosophilidae
8.0%
Chrysomelidae
8.0%
Anthocoridae
7.0%
Curculionidae
5.7%
Formicidae
5.0%
Muscidae
4.3%
Elmidae
4.3%
Culicidae
4.0%
Calliphoridae
3.0%
Tenebrionidae
3.0%
Aleyrodidae
2.0%
Apidae
1.7%
Termitidae
1.3%
Armadillidiidae
1.3%
Cerambycidae
1.3%
Pteromalidae
1.0%
Tephritidae
1.0%
Sarcophagidae
0.7%
Pentatomidae
0.7%
Passalidae
0.7%
Kalotermitidae
0.3%
Scarabaeidae
0.3%
Ceratophyllidae
0.3%
Trigoniulidae
0.3%
Daphniidae
0.3%
Aphrophoridae
0.3%
Hormaphididae
0.3%
Thripidae
0.3%
Anthomyiidae
0.3%
Pediculidae
0.3%
Reduviidae
0.3%
Rhopalidae
0.3%
Plutellidae
0.3%
Glossinidae
0.3%
Carabidae
0.3%
Siricidae
0.3%
Crambidae
0.3%
Gryllidae
0.3%
Taxonomy
Archaea
0
Bacteria
325
Eukaryota
0
Viruses
0
Unclassified
35
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 2 | 2519899622 | Pseudomonas sp. Ag1 | Isolate | Culicidae |
| 3 | 2524614872 | Arsenophonus nasoniae DSM 15247 | Isolate | Unclassified |
| 4 | 2529292851 | Providencia burhodogranariea DSM 19968 | Isolate | Drosophilidae |
| 5 | 2558860197 | Buchnera aphidicola F009 | Isolate | Aphididae |
| 6 | 2645727860 | Winslowiella iniecta B120 | Isolate | Aphididae |
| 7 | 2651870110 | Izhakiella capsodis N6PO6 | Isolate | Unclassified |
| 8 | 2687453754 | Pseudomonadales bacterium Cag26 | Isolate | Unclassified |
| 9 | 2703719240 | Serratia marcescens ano2 | Isolate | Unclassified |
| 10 | 2816332478 | Acetobacter tropicalis BDGP1 | Isolate | Drosophilidae |
| 11 | 2834887098 | Buchnera aphidicola LNK | Isolate | Aphididae |
| 12 | 2871771314 | Pantoea sp. Ae16 | Isolate | Culicidae |
| 13 | 2884492481 | Buchnera aphidicola BuCicurtihirsuta/3053 | Isolate | Aphididae |
| 14 | 2884492905 | Buchnera aphidicola BuCipiceae/3303 | Isolate | Aphididae |
| 15 | 2884500535 | Buchnera aphidicola BuCilaricifoliae/3058 | Isolate | Aphididae |
| 16 | 2885046828 | Erwinia sp. OLCASP19 | Isolate | Anthocoridae |
| 17 | 2885054481 | Erwinia sp. OLMDSP33 | Isolate | Anthocoridae |
| 18 | 2921842437 | Cronobacter sakazakii MOD1-Lc10s | Isolate | Calliphoridae |
| 19 | 2957730672 | Cronobacter sakazakii MOD1-Md70g | Isolate | Muscidae |
| 20 | 2967915117 | Cronobacter sakazakii MOD1-Lc10g | Isolate | Calliphoridae |
| 21 | 2979682021 | Cronobacter turicensis MOD1-Sh41s | Isolate | Sarcophagidae |
| 22 | 2998829267 | Enterobacteriaceae endosymbiont of Macroplea mutica MmutSym | Isolate | Chrysomelidae |
| 23 | 2998830690 | Enterobacteriaceae endosymbiont of Donacia dentata DdentSym | Isolate | Chrysomelidae |
| 24 | 2999135268 | Enterobacteriaceae endosymbiont of Plateumaris sericea PserSym | Isolate | Chrysomelidae |
| 25 | 3004010258 | Citrobacter sp. JGM124 | Isolate | Drosophilidae |
| 26 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 27 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 28 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 29 | 3300007149 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut | Metagenome | Drosophilidae |
| 30 | 3300009468 | Microbial communities of aphids from Rosa in Tucson, AZ, USA - Wahlgreniella nervata seqcov | Metagenome | Aphididae |
| 31 | 3300009483 | Microbial communities of aphids from Rhus glabra galls in Chiricahua Mtns, AZ, USA - Melaphis rhois NM090294 seqcov | Metagenome | |
| 32 | 3300009534 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Rhopalopisum padi seqcov | Metagenome | |
| 33 | 3300010225 | Sitobion avenae (English Grain Aphid) hemolymph microbial communities from Shanxi Taiyuan, China - Region1 | Metagenome | Aphididae |
| 34 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 643348520 | Buchnera aphidicola 5A | Isolate | Aphididae |
| 37 | 643348521 | Buchnera aphidicola Cc | Isolate | Aphididae |
| 38 | 644736334 | Candidatus Hamiltonella defensa 5AT | Isolate | Aphididae |
| 39 | 648276708 | Pantoea sp. aB | Isolate | Unclassified |
| 40 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 41 | 8006199443 | Yersinia pestis M-1763 | Isolate | Ceratophyllidae |
| 42 | 8011329375 | Pseudomonas sp. S31 | Isolate | Curculionidae |
| 43 | 8011357093 | Pseudomonas schmalbachii Milli4 | Isolate | Trigoniulidae |
| 44 | 8073124432 | Escherichia coli MOD1-EC294 | Isolate | Unclassified |
| 45 | 8074292191 | Tatumella sp. JGM94 | Isolate | Drosophilidae |
| 46 | 8101676404 | Providencia sp. JGM172 | Isolate | Drosophilidae |
| 47 | 2065487013 | Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm | Metagenome | |
| 48 | 2511231158 | Buchnera aphidicola Ua | Isolate | Aphididae |
| 49 | 2531839602 | Shimwellia blattae NBRC 105725 | Isolate | Unclassified |
| 50 | 2548876931 | Candidatus Hamiltonella defensa MED (Bemisia tabaci) | Isolate | Aleyrodidae |
| 51 | 2558860195 | Buchnera aphidicola G002 | Isolate | Aphididae |
| 52 | 2574179716 | Serratia sp. DD3 | Isolate | Daphniidae |
| 53 | 2585428135 | Sodalis-like symbiont of Philaenus spumarius PSPU | Isolate | Aphrophoridae |
| 54 | 2597489903 | Providencia sneebia DSM 19967 | Isolate | Drosophilidae |
| 55 | 2654587723 | Buchnera aphidicola (Aphis glycines) BAg | Isolate | Aphididae |
| 56 | 2718217944 | Serratia marcescens AS1 | Isolate | Culicidae |
| 57 | 2765235945 | Kosakonia cowanii Esp_Z | Isolate | Culicidae |
| 58 | 2858089842 | Acetobacter tropicalis DmW_042 | Isolate | Drosophilidae |
| 59 | 2864739902 | Pseudomonas viridiflavia S00001 | Isolate | Elmidae |
| 60 | 2864764899 | Aeromonas fluvialis S00019 | Isolate | Elmidae |
| 61 | 2864768727 | Aeromonas veronii S00020 | Isolate | Elmidae |
| 62 | 2864853652 | Pseudomonas rhodesiae S00114 | Isolate | Elmidae |
| 63 | 2874434233 | Serratia marcescens ADJS-2C_Red | Isolate | Unclassified |
| 64 | 2961232173 | Serratia sp. OLLOLW30 | Isolate | Anthocoridae |
| 65 | 2970791725 | Serratia sp. OLBL1 | Isolate | Anthocoridae |
| 66 | 2977691992 | Cronobacter malonaticus MOD1-Md27g | Isolate | Muscidae |
| 67 | 2977745872 | Cronobacter sakazakii MOD1-Md1g | Isolate | Muscidae |
| 68 | 2996467878 | Serratia sp. OLFL2 | Isolate | Anthocoridae |
| 69 | 2999135777 | Enterobacteriaceae endosymbiont of Donacia tomentosa DtomSym | Isolate | Chrysomelidae |
| 70 | 3002300227 | Buchnera aphidicola (Nipponaphis monzeni) Nmo | Isolate | Hormaphididae |
| 71 | 3300002732 | Whitefly associated endosymbiont microbial communities from Neve Yaar, Israel Sample - Wolbechia Contigs | Metagenome | |
| 72 | 3300002934 | Ant worker gut metagenome for colony PL005 | Metagenome | Formicidae |
| 73 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 74 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 75 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 76 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 77 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 78 | 3300009456 | Microbial communities of aphids from Ribes sp. in Pocatello, ID, USA - Hyperomyzus lactucae CVD94-86 seqcov | Metagenome | |
| 79 | 3300009458 | Microbial communities of aphids from Asclepias tuberosa in Tucson, AZ, USA - Aphis nerii NM100509 seqcov | Metagenome | |
| 80 | 3300009533 | Microbial communities of aphids from Crataegus sp. in NC, USA - Muscaphis stroyani CVD02-21 seqcov | Metagenome | |
| 81 | 3300009535 | Microbial communities of aphids from Calyophus hartwegii in Tucson, AZ, USA - Macrosiphum gaurae seqcov | Metagenome | Aphididae |
| 82 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 83 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 84 | 650377915 | Buchnera aphidicola JF98 | Isolate | Aphididae |
| 85 | 650377916 | Buchnera aphidicola JF99 | Isolate | Aphididae |
| 86 | 8076031238 | Erwinia haradaeae ErCicurtihirsuta/3053 | Isolate | Aphididae |
| 87 | 8100176769 | Kosakonia sp. S57 | Isolate | Curculionidae |
| 88 | 2507262057 | Enterobacteriaceae bacterium FGI 57 | Isolate | Unclassified |
| 89 | 2512047025 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 90 | 2518645538 | Candidatus Portiera aleyrodidarum BT-QVLC | Isolate | Aleyrodidae |
| 91 | 2551306516 | Enterobacter hormaechei YT3 | Isolate | Tenebrionidae |
| 92 | 2599185261 | Thorsellia anophelis DSM 18579 | Isolate | Unclassified |
| 93 | 2603880173 | Pseudomonas SP. | Isolate | Unclassified |
| 94 | 2687453755 | Pseudomonadales bacterium Cag27 | Isolate | Unclassified |
| 95 | 2718218137 | Buchnera aphidicola (Diuraphis noxia) | Isolate | Aphididae |
| 96 | 2841821538 | Psychrobacter sp. YP14 | Isolate | Unclassified |
| 97 | 2846861257 | Buchnera aphidicola LSU | Isolate | Aphididae |
| 98 | 2864903489 | Pseudomonas aeuginosa S00161 | Isolate | Elmidae |
| 99 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 100 | 2871760914 | Pantoea ananatis PANS 01-2 | Isolate | Thripidae |
| 101 | 2887836388 | Buchnera aphidicola BuCisplendens/3004 | Isolate | Aphididae |
| 102 | 2921816052 | Cronobacter sakazakii MOD1-Anth48g | Isolate | Anthomyiidae |
| 103 | 2922113941 | Serratia sp. OLEL1 | Isolate | Anthocoridae |
| 104 | 2937427229 | Cronobacter malonaticus MOD1-Md99g | Isolate | Muscidae |
| 105 | 2937751072 | Serratia sp. OLMTLW26 | Isolate | Anthocoridae |
| 106 | 2958255616 | Serratia marcescens TM | Isolate | |
| 107 | 2965197371 | Serratia sp. OLCL1 | Isolate | Anthocoridae |
| 108 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 109 | 2998827899 | Enterobacteriaceae endosymbiont of Donacia cincticornis DcincSym | Isolate | Chrysomelidae |
| 110 | 2998831142 | Enterobacteriaceae endosymbiont of Macroplea appendiculata MappSym | Isolate | Chrysomelidae |
| 111 | 2998834864 | Enterobacteriaceae endosymbiont of Donacia bicoloricornis DbicSym | Isolate | Chrysomelidae |
| 112 | 3001459110 | Tatumella sp. JGM118 | Isolate | Drosophilidae |
| 113 | 3300007130 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 4 gut | Metagenome | Drosophilidae |
| 114 | 3300009459 | Microbial communities of aphids from Hamamelis virginiana in Wilton, CT, USA - Hamamelistes spinosus NM072310_02 seqcov | Metagenome | |
| 115 | 3300009477 | Microbial communities of aphids from Cirsium sp. in Ottawa, Ontario, CA - Brachycaudus cardui CNC#HEM061370 seqcov | Metagenome | |
| 116 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 117 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 118 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 119 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 120 | 641522603 | Acinetobacter baumannii SDF | Isolate | Pediculidae |
| 121 | 651324086 | Plautia crossota stali symbiont | Isolate | Unclassified |
| 122 | 8001059720 | Tenebrionicola larvae YMB-R22 | Isolate | Tenebrionidae |
| 123 | 8062647588 | Nissabacter archeti JGM97 | Isolate | Drosophilidae |
| 124 | 8071333649 | Escherichia coli PN108 | Isolate | Calliphoridae |
| 125 | 8071338694 | Escherichia coli PN87 | Isolate | Calliphoridae |
| 126 | 8102982778 | Erwinia sp. S63 | Isolate | Curculionidae |
| 127 | 2044078006 | Dendroctonus frontalis bacterial communities from Mississippi, USA | Metagenome | Curculionidae |
| 128 | 2510065003 | Arsenophonus triatominarum ArT | Isolate | Reduviidae |
| 129 | 2515154046 | Candidatus Portiera aleyrodidarum | Isolate | Aleyrodidae |
| 130 | 2588253732 | Klebsiella pneumoniae pneumoniae KP5-1 | Isolate | Pentatomidae |
| 131 | 2824588292 | Yokenella regensburgei WCD67 | Isolate | Rhopalidae |
| 132 | 2841175817 | Komagataeibacter saccharivorans JH1 | Isolate | Unclassified |
| 133 | 2847708326 | Serratia liquefaciens P2ACOL2 | Isolate | Cerambycidae |
| 134 | 2856068565 | Cronobacter sakazakii MOD1-Md35s | Isolate | Muscidae |
| 135 | 2864745180 | Pseudomonas rhodesiae S00002 | Isolate | Elmidae |
| 136 | 2864791955 | Aeromonas veronii S00030 | Isolate | Elmidae |
| 137 | 2864847319 | Pseudomonas alcaligenes S00099 | Isolate | Elmidae |
| 138 | 2874504452 | Serratia marcescens ADJS-2C_Purple | Isolate | Unclassified |
| 139 | 2884498641 | Buchnera aphidicola BuCicurvipes/3402 | Isolate | Aphididae |
| 140 | 2884500114 | Buchnera aphidicola BuCicuneomaculata/2628 | Isolate | Aphididae |
| 141 | 2885058212 | Erwinia sp. OLTSP20 | Isolate | Anthocoridae |
| 142 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 143 | 2967924226 | Cronobacter malonaticus MOD1-Md25g | Isolate | Muscidae |
| 144 | 2970322301 | Cronobacter sakazakii MOD1-Md33g | Isolate | Muscidae |
| 145 | 2996406003 | Serratia sp. OLJL1 | Isolate | Anthocoridae |
| 146 | 2998829729 | Enterobacteriaceae endosymbiont of Donacia sparganii DsparSym | Isolate | Chrysomelidae |
| 147 | 2998830186 | Enterobacteriaceae endosymbiont of Plateumaris pusilla PpusSym | Isolate | Chrysomelidae |
| 148 | 2999134321 | Enterobacteriaceae endosymbiont of Donacia piscatrix DpisSym | Isolate | Chrysomelidae |
| 149 | 3001462594 | Tatumella sp. JGM91 | Isolate | Drosophilidae |
| 150 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 151 | 3300009531 | Microbial communities of aphids from cabbage in Tucson, AZ, USA - Lipaphis pseudobrassicae NM032704 seqcov | Metagenome | Aphididae |
| 152 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 153 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 154 | 637000045 | Buchnera aphidicola Sg | Isolate | Aphididae |
| 155 | 637000270 | Sodalis glossinidius morsitans | Isolate | Glossinidae |
| 156 | 643348522 | Buchnera aphidicola Tuc7 | Isolate | Aphididae |
| 157 | 8004118532 | Citrobacter amalonaticus ku-bf3 | Isolate | Carabidae |
| 158 | 8052469819 | Pseudomonas putida DZ-F23 | Isolate | |
| 159 | 8071343737 | Escherichia coli PN119 | Isolate | Calliphoridae |
| 160 | 8074288691 | Tatumella sp. JGM82 | Isolate | Drosophilidae |
| 161 | 8076028257 | Erwinia haradaeae ErCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 162 | 8076047169 | Erwinia haradaeae ErCipseudotsugae/2889 | Isolate | Aphididae |
| 163 | 8101683685 | Providencia sp. JGM181 | Isolate | Drosophilidae |
| 164 | 2100351016 | Sirex noctilio microbial communities from Pennsylvania, USA - adult community | Metagenome | Siricidae |
| 165 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 166 | 2551306531 | Enterobacter hormaechei YT2 | Isolate | Tenebrionidae |
| 167 | 2731957969 | Proteus mirabilis Wood | Isolate | Calliphoridae |
| 168 | 2744054871 | Candidatus Arsenophonus triatominarum ATi | Isolate | Unclassified |
| 169 | 2756170277 | Enterobacillus tribolii DSM 103736 | Isolate | Unclassified |
| 170 | 2833053935 | Buttiauxella sp. 3AFRM03 | Isolate | Cerambycidae |
| 171 | 2837516909 | Rahnella bruchi DSM 27398 | Isolate | Unclassified |
| 172 | 2841132873 | Buchnera aphidicola BTs Pazieg | Isolate | Aphididae |
| 173 | 2841260384 | Providencia alcalifaciens Dmel2 | Isolate | Drosophilidae |
| 174 | 2854536247 | Acetobacter senegalensis DmL_050 | Isolate | Drosophilidae |
| 175 | 2864944480 | Pseudomonas fluvialis S00202 | Isolate | Elmidae |
| 176 | 2878947168 | Serratia marcescens ADJS-2D_White | Isolate | Unclassified |
| 177 | 2885043073 | Erwinia sp. OLSSP12 | Isolate | Anthocoridae |
| 178 | 2896187957 | Providencia stuartii Crippen | Isolate | Calliphoridae |
| 179 | 2937735258 | Serratia marcescens KZ11 | Isolate | Apidae |
| 180 | 2961247850 | Serratia sp. OLAL2 | Isolate | Anthocoridae |
| 181 | 3300038942 | Host-associated microbial communities from haemolymph of Banana aphid from Africa - Madagascar | Metagenome | Aphididae |
| 182 | 2970335472 | Cronobacter muytjensii MOD1-Md1s | Isolate | Muscidae |
| 183 | 2977727922 | Cronobacter sakazakii MOD1-Md33s | Isolate | Muscidae |
| 184 | 2978102237 | Serratia fonticola AeS1 | Isolate | Culicidae |
| 185 | 2997878596 | Pseudomonas bohemica IA9 | Isolate | Unclassified |
| 186 | 2998828810 | Enterobacteriaceae endosymbiont of Donacia simplex DsimSym | Isolate | Chrysomelidae |
| 187 | 2998832964 | Enterobacteriaceae endosymbiont of Plateumaris rustica PrusSym | Isolate | Chrysomelidae |
| 188 | 2998833461 | Enterobacteriaceae endosymbiont of Donacia marginata DmarSym | Isolate | Chrysomelidae |
| 189 | 3007994558 | Escherichia alba B35 | Isolate | Tenebrionidae |
| 190 | 3300002464 | Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 | Metagenome | Culicidae |
| 191 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 192 | 3300009461 | Microbial communities of aphids from Rhamnus cathartica in Ottawa, Ontario, CA - Aphis nasturtii CNC#HEM071789 seqcov | Metagenome | |
| 193 | 3300009463 | Microbial communities of aphids from fava bean in Tucson, AZ, USA - Aphis craccivora NM101509 seqcov | Metagenome | |
| 194 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 195 | 3300009539 | Microbial communities of aphids from Brassica oleracea in Tucson, AZ, USA - Brevicoryne brassicae seqcov | Metagenome | Aphididae |
| 196 | 3300012819 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG | Metagenome | Armadillidiidae |
| 197 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 198 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 199 | 8004307473 | Serratia sp. OLIL2 | Isolate | Anthocoridae |
| 200 | 8004571736 | Serratia sp. OLDL1 | Isolate | Anthocoridae |
| 201 | 8021535516 | Klebsiella sp. Kd70 TUC-EEAOC | Isolate | Crambidae |
| 202 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 203 | 8076029720 | Erwinia haradaeae ErCisplendens/3004 | Isolate | Aphididae |
| 204 | 8100181737 | Kosakonia sp. S58 | Isolate | Curculionidae |
| 205 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 206 | 2511231206 | Buchnera aphidicola Ak | Isolate | Aphididae |
| 207 | 2518285522 | Photorhabdus khanii NC19 | Isolate | Unclassified |
| 208 | 2547132185 | Enterobacter cancerogenus YZ1 | Isolate | Tenebrionidae |
| 209 | 2619619082 | Pantoea agglomerans SL1_M5 | Isolate | Unclassified |
| 210 | 2751185823 | Erwinia haradaeae 3056 | Isolate | Aphididae |
| 211 | 2778261152 | Escherichia coli MOD1-EC284 | Isolate | Unclassified |
| 212 | 2822856742 | Enterobacter cancerogenus CR-Eb1 | Isolate | Unclassified |
| 213 | 2848317263 | Arsenophonus endosymbiont of Aleurodicus floccissimus ARAF | Isolate | Aleyrodidae |
| 214 | 2850131454 | Providencia rettgeri NVIT03 | Isolate | Pteromalidae |
| 215 | 2864777284 | Aeromonas hydrophila S00023 | Isolate | Elmidae |
| 216 | 2864796242 | Aeromonas hydrophilia S00040 | Isolate | Elmidae |
| 217 | 2874880541 | Enterobacter hormaechei E3442 | Isolate | Unclassified |
| 218 | 2884499693 | Buchnera aphidicola BuCikochiana/2762 | Isolate | Aphididae |
| 219 | 2964846109 | Cronobacter sakazakii MOD1-Md5g | Isolate | Muscidae |
| 220 | 2964859436 | Cronobacter sakazakii MOD1-Md40g | Isolate | Muscidae |
| 221 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 222 | 2978161719 | Serratia marcescens KZ2 | Isolate | Apidae |
| 223 | 2998828354 | Enterobacteriaceae endosymbiont of Donacia vulgaris DvulSym | Isolate | Chrysomelidae |
| 224 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 225 | 2999138033 | Enterobacteriaceae endosymbiont of Donacia provostii DprovSym | Isolate | Chrysomelidae |
| 226 | 3000861951 | Budvicia diplopodorum D9 | Isolate | |
| 227 | 3004364956 | Cronobacter sakazakii MOD1-Md5s | Isolate | Muscidae |
| 228 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 229 | 3300002938 | Larval gut metagenome for colony PL005 | Metagenome | Formicidae |
| 230 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 231 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 232 | 3300009482 | Microbial communities of aphids from from Chrysanthemum sp. in New Haven, CT, USA - Macrosiphoniella sanborni NM102210_03 seqcov | Metagenome | |
| 233 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 234 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 235 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 236 | 639633012 | Buchnera aphidicola Bp | Isolate | Aphididae |
| 237 | 8018312681 | Enterobacter sp. OLF | Isolate | Tephritidae |
| 238 | 8021540981 | Klebsiella sp. Kpp | Isolate | Tephritidae |
| 239 | 8028002147 | Enterobacter sp. 10-1 | Isolate | Cerambycidae |
| 240 | 8076032775 | Erwinia haradaeae ErCicurvipes/3402 | Isolate | Aphididae |
| 241 | 8099192374 | Erwinia typographi IC4 | Isolate | Curculionidae |
| 242 | 8110023836 | Enterobacterales bacterium BIT-L3 | Isolate | Tenebrionidae |
| 243 | 2513020017 | Shimwellia blattae DSM 4481 | Isolate | Unclassified |
| 244 | 2517093038 | Candidatus Portiera aleyrodidarum BT-B | Isolate | Aleyrodidae |
| 245 | 2558860196 | Buchnera aphidicola W106 | Isolate | Aphididae |
| 246 | 2597489902 | Providencia rettgeri Dmel1 | Isolate | Drosophilidae |
| 247 | 2687453756 | Pseudomonadales bacterium Cag32 | Isolate | Unclassified |
| 248 | 2836714267 | Shimwellia blattae NCTC10965 | Isolate | |
| 249 | 2836755666 | Arsenophonus nasoniae FIN | Isolate | Pteromalidae |
| 250 | 2846386538 | Rahnella sp. AN3-3W3 | Isolate | Pentatomidae |
| 251 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 252 | 2876358570 | Cronobacter sakazakii MOD1-Ls15g | Isolate | Calliphoridae |
| 253 | 2937387794 | Cronobacter turicensis MOD1-Sh41g | Isolate | Sarcophagidae |
| 254 | 2938192669 | Citrobacter sp. TSA-1 | Isolate | Unclassified |
| 255 | 2971189173 | Yersinia pestis A-1249 | Isolate | Unclassified |
| 256 | 2990166910 | Pseudomonas typographi CA3A | Isolate | Curculionidae |
| 257 | 2998832060 | Enterobacteriaceae endosymbiont of Donacia proxima DproxSym | Isolate | Chrysomelidae |
| 258 | 2998832509 | Enterobacteriaceae endosymbiont of Donacia cinerea DcinSym | Isolate | Chrysomelidae |
| 259 | 2998834370 | Enterobacteriaceae endosymbiont of Plateumaris consimilis PconSym | Isolate | Chrysomelidae |
| 260 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 261 | 3007478678 | Pseudomonas sp. S37 | Isolate | Curculionidae |
| 262 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 263 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 264 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 265 | 3300009457 | Microbial communities of aphids from Cornus stolonifera in Ithaca, NY, USA - Anoecia oenotherae NM10041110_01 seqcov | Metagenome | |
| 266 | 3300030930 | Ant gut bacterial community from Pseudomyrmex nigropilosus larvae, the Area de Conservacion Guanacaste, Costa Rica - colony BER0554 | Metagenome | Formicidae |
| 267 | 637000043 | Buchnera aphidicola APS | Isolate | Aphididae |
| 268 | 637000219 | Pseudomonas entomophila L48 | Isolate | Unclassified |
| 269 | 650377918 | Buchnera aphidicola TLW03 | Isolate | Aphididae |
| 270 | 8021546568 | Klebsiella sp. Kps | Isolate | Tephritidae |
| 271 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 272 | 8065462725 | Tatumella sp. JGM100 | Isolate | Drosophilidae |
| 273 | 8065466226 | Tatumella sp. JGM130 | Isolate | Drosophilidae |
| 274 | 8065469765 | Tatumella sp. JGM16 | Isolate | Drosophilidae |
| 275 | 8071322446 | Escherichia coli PN122 | Isolate | Calliphoridae |
| 276 | 8076033509 | Erwinia haradaeae ErCicuneomaculata/2628 | Isolate | Aphididae |
| 277 | 8100171289 | Kosakonia sp. S42 | Isolate | Curculionidae |
| 278 | 8101680043 | Providencia sp. JGM178 | Isolate | Drosophilidae |
| 279 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 280 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 281 | 2510065002 | Arsenophonus sp. ArN | Isolate | Pteromalidae |
| 282 | 2519899623 | Enterobacter sp. Ag1 | Isolate | Culicidae |
| 283 | 2537561600 | Salmonella enterica enterica sv. Newport CVM 19443 | Isolate | Unclassified |
| 284 | 2558860194 | Buchnera aphidicola USDA | Isolate | Aphididae |
| 285 | 2588253791 | Yokenella regensburgei F. Haas DC-1, ATCC 49455 | Isolate | Unclassified |
| 286 | 2648501209 | Winslowiella iniecta B149 | Isolate | Aphididae |
| 287 | 2703719239 | Serratia marcescens ano1 | Isolate | Unclassified |
| 288 | 2778261153 | Escherichia coli MOD1-EC286 | Isolate | Unclassified |
| 289 | 2835335304 | Rahnella sp. Larv3_ips | Isolate | Curculionidae |
| 290 | 2859315706 | Serratia sp. 3ACOL1 | Isolate | Cerambycidae |
| 291 | 2864926767 | Pseudomonas nitritireducens S00179 | Isolate | Elmidae |
| 292 | 2872745489 | Buchnera aphidicola LSR1 | Isolate | Aphididae |
| 293 | 2876334352 | Cronobacter sakazakii MOD1-Md6g | Isolate | Muscidae |
| 294 | 2884497005 | Buchnera aphidicola BuCisplendens/pseudotsugae/3390 | Isolate | Aphididae |
| 295 | 2885050628 | Erwinia sp. OLMTSP26 | Isolate | Anthocoridae |
| 296 | 2885061987 | Erwinia sp. OLFS4 | Isolate | Anthocoridae |
| 297 | 2885065815 | Erwinia sp. OAMSP11 | Isolate | Anthocoridae |
| 298 | 2898991528 | Erwinia sp. OLMDLW33 | Isolate | Anthocoridae |
| 299 | 2961206375 | Serratia sp. OMLW3 | Isolate | Anthocoridae |
| 300 | 2843639003 | Buchnera aphidicola BuCistrobi/3249 | Isolate | Aphididae |
| 301 | 2986970932 | Candidatus Fukatsuia symbiotica 5D | Isolate | Unclassified |
| 302 | 2998827396 | Enterobacteriaceae endosymbiont of Plateumaris braccata PbraSym | Isolate | Chrysomelidae |
| 303 | 2998831604 | Enterobacteriaceae endosymbiont of Donacia thalassina DthaSym | Isolate | Chrysomelidae |
| 304 | 2998979428 | Enterobacteriaceae endosymbiont of Donacia fulgens DfulgSym | Isolate | Chrysomelidae |
| 305 | 2999134809 | Enterobacteriaceae endosymbiont of Donacia crassipes DcraSym | Isolate | Chrysomelidae |
| 306 | 2999270917 | Enterobacteriaceae endosymbiont of Neohaemonia nigricornis NnigSym | Isolate | Chrysomelidae |
| 307 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 308 | 3300005318 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 2 gut | Metagenome | Drosophilidae |
| 309 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 310 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 311 | 3300009471 | Microbial communities of aphids from galls on Rhus javanica in Mt Takao, Hachioji, Japan - Schlechtendalia chinensis CVD94-71 seqcov | Metagenome | |
| 312 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 313 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 314 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 315 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 316 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 317 | 650377917 | Buchnera aphidicola LL01 | Isolate | Aphididae |
| 318 | 651285005 | Serratia symbiotica Tuscon | Isolate | Aphididae |
| 319 | 8004285568 | Serratia sp. OLHL2 | Isolate | Anthocoridae |
| 320 | 8004541719 | Serratia marcescens KZ19 | Isolate | Apidae |
| 321 | 8004582426 | Serratia sp. OSPLW9 | Isolate | Anthocoridae |
| 322 | 8035422605 | Pseudomonas monteilii CY06 | Isolate | |
| 323 | 8076030444 | Erwinia haradaeae ErCilaricifoliae/3058 | Isolate | Aphididae |
| 324 | 8076031980 | Erwinia haradaeae ErCikochiana/2762 | Isolate | Aphididae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466730_058244 | 3300042625 | Unclassified | 8672 |
| 2 | HBC_ctgsDRAFT_1005214 | 3300000333 | Bacteria | 3034 |
| 3 | Ga0160460_100023 | 3300012845 | Bacteria | 338828 |
| 4 | Ga0160434_109696 | 3300012850 | Unclassified | 1571 |
| 5 | Ga0466724_50173 | 3300042649 | Unclassified | 11684 |
| 6 | SPBB_contig00370 | 2044078006 | Bacteria | 118424 |
| 7 | FGTW_contig01631 | 2065487013 | Unclassified | 3899 |
| 8 | 2227080778 | 2225789004 | Bacteria | 173705 |
| 9 | WW0001_100290 | 3300002732 | Bacteria | 20374 |
| 10 | CVPL010L_1000828 | 3300002932 | Bacteria | 6793 |
| 11 | CVPL005W_1000138 | 3300002934 | Bacteria | 31350 |
| 12 | Ga0063521_1018293 | 3300003973 | Unclassified | 1694 |
| 13 | Ga0103268_1000059 | 3300007192 | Bacteria | 65552 |
| 14 | Ga0127530_101176 | 3300009468 | Bacteria | 30064 |
| 15 | Ga0127526_1000110 | 3300009535 | Bacteria | 643549 |
| 16 | Ga0160458_114756 | 3300012832 | Bacteria | 844 |
| 17 | Ga0265387_1000027 | 3300024582 | Bacteria | 58359 |
| 18 | Ga0316159_11062 | 3300030930 | Bacteria | 5902 |
| 19 | Ga0466701_012048 | 3300042598 | Bacteria | 19642 |
| 20 | Ga0562377_0003 | 3300056842 | Bacteria | 3990310 |
| 21 | Ga0466730_015935 | 3300042625 | Unclassified | 1340 |
| 22 | Ga0466724_45516 | 3300042649 | Unclassified | 1955 |
| 23 | Ga0466713_140012 | 3300042602 | Bacteria | 490520 |
| 24 | IMNBL1DRAFT_c0000200 | 3300000062 | Bacteria | 52540 |
| 25 | Meta3P_1001730 | 3300002464 | Bacteria | 17058 |
| 26 | Ga0063521_1000125 | 3300003973 | Bacteria | 59060 |
| 27 | Ga0103265_1005445 | 3300007068 | Unclassified | 1758 |
| 28 | Ga0102734_1000619 | 3300007129 | Bacteria | 20649 |
| 29 | Ga0104019_1198155 | 3300007150 | Unclassified | 1037 |
| 30 | Ga0103267_1000796 | 3300007190 | Bacteria | 8314 |
| 31 | Ga0127656_100608 | 3300009453 | Bacteria | 40192 |
| 32 | Ga0127646_100058 | 3300009458 | Bacteria | 571963 |
| 33 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 34 | Ga0127522_100011 | 3300009477 | Bacteria | 644448 |
| 35 | Ga0127528_1000015 | 3300009533 | Bacteria | 619772 |
| 36 | Ga0160435_1003919 | 3300012857 | Unclassified | 3484 |
| 37 | Ga0466701_007373 | 3300042598 | Bacteria | 34210 |
| 38 | Ga0466730_011334 | 3300042625 | Bacteria | 62089 |
| 39 | Ga0466709_322776 | 3300042648 | Bacteria | 2773 |
| 40 | DPOL_contig00054 | 2035918003 | Bacteria | 117603 |
| 41 | DPOL_contig15051 | 2035918003 | Bacteria | 14596 |
| 42 | Meta3P_1000074 | 3300002464 | Bacteria | 143082 |
| 43 | CVPL005L_10018591 | 3300002938 | Bacteria | 3841 |
| 44 | Ga0127655_1000129 | 3300009459 | Bacteria | 209565 |
| 45 | Ga0127530_101175 | 3300009468 | Bacteria | 35475 |
| 46 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 47 | Ga0316159_12197 | 3300030930 | Unclassified | 3924 |
| 48 | Ga0562377_0035 | 3300056842 | Bacteria | 679350 |
| 49 | Ga0466724_15730 | 3300042649 | Bacteria | 19654 |
| 50 | Ga0123353_10035823 | 3300010167 | Bacteria | 7765 |
| 51 | Ga0063521_1027638 | 3300003973 | Bacteria | 1340 |
| 52 | Ga0103266_1000235 | 3300007067 | Bacteria | 28667 |
| 53 | Ga0104042_1034794 | 3300007130 | Unclassified | 5812 |
| 54 | Ga0104042_1126990 | 3300007130 | Unclassified | 1155 |
| 55 | Ga0103264_1000099 | 3300007188 | Bacteria | 118917 |
| 56 | Ga0103267_1000005 | 3300007190 | Bacteria | 104420 |
| 57 | Ga0103268_1000001 | 3300007192 | Bacteria | 136024 |
| 58 | Ga0127657_100003 | 3300009457 | Bacteria | 550482 |
| 59 | Ga0127644_100036 | 3300009463 | Bacteria | 636219 |
| 60 | Ga0127651_100210 | 3300009483 | Bacteria | 383772 |
| 61 | Ga0160441_109716 | 3300012825 | Unclassified | 1185 |
| 62 | Ga0160444_110110 | 3300012841 | Unclassified | 1154 |
| 63 | Ga0160436_1008184 | 3300012861 | Unclassified | 2360 |
| 64 | Ga0562377_0511 | 3300056842 | Bacteria | 61567 |
| 65 | Ga0466730_088336 | 3300042625 | Bacteria | 22497 |
| 66 | Ga0466724_68220 | 3300042649 | Unclassified | 29433 |
| 67 | Ga0466707_004354 | 3300042601 | Bacteria | 82691 |
| 68 | SPBB_contig01100 | 2044078006 | Unclassified | 17182 |
| 69 | SWWA_contig00831__length_2709___numreads_49 | 2100351016 | Unclassified | 2709 |
| 70 | Meta3P_1002422 | 3300002464 | Unclassified | 6302 |
| 71 | Ga0102735_1000687 | 3300007080 | Bacteria | 6441 |
| 72 | Ga0102739_1000987 | 3300007095 | Unclassified | 4975 |
| 73 | Ga0102740_1005177 | 3300007140 | Unclassified | 2475 |
| 74 | Ga0127523_100016 | 3300009456 | Bacteria | 642955 |
| 75 | Ga0127657_102179 | 3300009457 | Bacteria | 33619 |
| 76 | Ga0127653_100020 | 3300009471 | Bacteria | 389096 |
| 77 | Ga0127648_100010 | 3300009534 | Bacteria | 473475 |
| 78 | Ga0127521_100003 | 3300009539 | Bacteria | 647534 |
| 79 | Ga0160443_108157 | 3300012848 | Unclassified | 1268 |
| 80 | Ga0120204_000020 | 3300038942 | Bacteria | 8460 |
| 81 | Ga0562379_0404 | 3300056790 | Unclassified | 95515 |
| 82 | Ga0562375_0065 | 3300056856 | Bacteria | 412749 |
| 83 | Ga0466724_10332 | 3300042649 | Unclassified | 5233 |
| 84 | Ga0466724_23904 | 3300042649 | Unclassified | 2596 |
| 85 | Ga0136160_1000047 | 3300010225 | Bacteria | 637579 |
| 86 | DPOL_contig13564 | 2035918003 | Unclassified | 3621 |
| 87 | Ga0063521_1000002 | 3300003973 | Bacteria | 391466 |
| 88 | Ga0063521_1000026 | 3300003973 | Bacteria | 128736 |
| 89 | Ga0103264_1000285 | 3300007188 | Bacteria | 30763 |
| 90 | Ga0105553_1075703 | 3300007767 | Unclassified | 4795 |
| 91 | Ga0127645_100025 | 3300009461 | Bacteria | 631301 |
| 92 | Ga0127527_100008 | 3300009482 | Bacteria | 420258 |
| 93 | Ga0127525_100070 | 3300009531 | Bacteria | 646221 |
| 94 | Ga0160433_123895 | 3300012846 | Unclassified | 709 |
| 95 | Ga0466730_084626 | 3300042625 | Unclassified | 1952 |
| 96 | Ga0466724_34529 | 3300042649 | Unclassified | 1130 |
| 97 | Ga0136160_1000054 | 3300010225 | Bacteria | 31690 |
| 98 | SWWA_contig31735__length_11175___numreads_627 | 2100351016 | Unclassified | 11175 |
| 99 | HBC_ctgsDRAFT_1000121 | 3300000333 | Bacteria | 19364 |
| 100 | Ga0063521_1000229 | 3300003973 | Bacteria | 38732 |
| 101 | Ga0074188_1039644 | 3300005318 | Bacteria | 3273 |
| 102 | Ga0102736_1001174 | 3300007052 | Unclassified | 4678 |
| 103 | Ga0102737_1002126 | 3300007142 | Unclassified | 5066 |
| 104 | Ga0104040_1045723 | 3300007149 | Bacteria | 1818 |
| 105 | Ga0127656_101283 | 3300009453 | Bacteria | 22238 |
| 106 | Ga0160468_100825 | 3300012819 | Unclassified | 9905 |
| 107 | Ga0160433_100146 | 3300012846 | Bacteria | 60976 |
| 108 | Ga0247289_0024 | 3300035363 | Bacteria | 47947 |
| 109 | Ga0466701_011093 | 3300042598 | Bacteria | 75772 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01058 | Oxidored_q6 | NADH ubiquinone oxidoreductase, 20 Kd subunit | 72 | 180 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01058 | GO:0051536 | iron-sulfur cluster binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.55 | 0.71 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.