Protein Family IF03412

Metagenome Isolate
143 Members
68 Samples
116 Scaffolds
142.27 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_12136199|Ga0123353_121361991
Length
161 aa
Sequence
MKRYGLSDKIVKVKFNKEQTYMTILPYVRKAQFYETDQMGVIHHSNYIRWFEEARVDFLEQAGFPYEKVESMGITLAVLGLSCEYKAPVVFGDTVHVQARPKACSHSRMSMDYEVMDAATGELRTTGETHHFFFRKEDARPVSLKKAIPELYDLFRSFMI*

📊 Sample Types

Isolate 18.9%
Metagenome 81.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.2%
Unclassified 23.1%
Kalotermitidae 16.9%
Blattidae 9.2%
Tenebrionidae 6.2%
Drosophilidae 4.6%
Passalidae 3.1%
Termopsidae 3.1%
Rhinotermitidae 1.5%
Vespidae 1.5%
Bombycidae 1.5%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
2 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
3 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
4 2820582954 Unclassified Firmicutes Emb289P3bin119 Isolate Unclassified
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300005319 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut Metagenome Drosophilidae
10 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
11 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
14 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
15 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
16 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 2820001644 Unclassified Synergistetes Th196P3bin106 Isolate Unclassified
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
23 8007223943 Enterococcus sp. MSG2901 Isolate
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
32 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
33 2820373881 Unclassified Firmicutes Nt197P3bin10 Isolate Unclassified
34 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
35 8114555646 Enterococcus sp. DIV1094 Isolate
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
38 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
39 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
40 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
41 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
42 2820275298 Unclassified Firmicutes Th196P3bin17 Isolate Unclassified
43 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
44 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
45 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
46 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
47 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
48 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
49 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
50 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
51 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
52 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
53 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
54 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
55 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
56 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
57 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
58 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
59 2622736579 Desemzia incerta DSM 20581 Isolate Unclassified
60 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
61 8108568626 Enterococcus sp. DIV1094 Isolate
62 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
63 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
64 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
65 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
66 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
67 2820666966 Unclassified Firmicutes Co191P3bin39 Isolate Unclassified
68 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466708_206063 3300042652 Bacteria 61475
2 JGI24695J34938_10196709 3300002450 Bacteria 839
3 Ga0562376_0927 3300056857 Bacteria 45710
4 Ga0123357_10203980 3300009784 Archaea 2242
5 Ga0123357_10774458 3300009784 Bacteria 658
6 Ga0123355_10112807 3300009826 Bacteria 4242
7 Ga0123355_11265486 3300009826 Bacteria 745
8 Ga0123353_10573980 3300010167 Unclassified 1620
9 Ga0466723_011522 3300042618 Bacteria 9062
10 Ga0415639_000782 3300038395 Bacteria 15597
11 Ga0415639_025418 3300038395 Bacteria 4058
12 Ga0415639_132245 3300038395 Bacteria 4484
13 Ga0466696_036444 3300042596 Bacteria 6356
14 Ga0466699_193343 3300042597 Bacteria 1048
15 Ga0466700_279896 3300042600 Bacteria 50851
16 Ga0466714_096906 3300042603 Bacteria 1447
17 Ga0466721_332798 3300042608 Bacteria 1201
18 Ga0466722_228939 3300042609 Bacteria 13697
19 2227155809 2225789004 Bacteria 8449
20 JGI24695J34938_10000001 3300002450 Bacteria 290906
21 Ga0123356_10236061 3300010049 Bacteria 1896
22 Ga0123356_11039157 3300010049 Bacteria 989
23 Ga0123353_10093178 3300010167 Bacteria 4854
24 Ga0123353_10093921 3300010167 Bacteria 4833
25 Ga0123353_10725664 3300010167 Bacteria 1389
26 Ga0123354_10368244 3300010882 Bacteria 1257
27 Ga0466711_212527 3300042615 Bacteria 14136
28 Ga0466715_417946 3300042616 Bacteria 1368
29 Ga0415639_067238 3300038395 Bacteria 19616
30 Ga0466700_053694 3300042600 Bacteria 1270
31 Ga0466717_137760 3300042604 Bacteria 1296
32 2227507959 2225789004 Bacteria 65570
33 JGI24695J34938_10016137 3300002450 Bacteria 3812
34 JGI24702J35022_10095146 3300002462 Bacteria 1625
35 Ga0123356_10000006 3300010049 Bacteria 247371
36 Ga0123356_10013934 3300010049 Bacteria 7741
37 Ga0123356_10202474 3300010049 Bacteria 2026
38 Ga0123356_10839918 3300010049 Bacteria 1090
39 Ga0123356_11446236 3300010049 Bacteria 846
40 Ga0415639_000202 3300038395 Bacteria 104098
41 Ga0415639_016078 3300038395 Bacteria 3943
42 Ga0415639_045249 3300038395 Unclassified 4869
43 Ga0466693_168798 3300042592 Bacteria 2537
44 Ga0466700_283576 3300042600 Bacteria 6458
45 Ga0466704_470122 3300042643 Bacteria 6966
46 Ga0466727_182730 3300042655 Bacteria 2200
47 JGI24695J34938_10002049 3300002450 Bacteria 15900
48 JGI24695J34938_10126093 3300002450 Bacteria 1043
49 Ga0466733_121626 3300042659 Bacteria 1123
50 Ga0562374_0683 3300057007 Bacteria 50941
51 Ga0123357_10907482 3300009784 Bacteria 568
52 Ga0123356_10008372 3300010049 Bacteria 10283
53 Ga0123356_10800353 3300010049 Bacteria 1114
54 Ga0123356_10975879 3300010049 Bacteria 1018
55 Ga0123353_10221582 3300010167 Bacteria 2957
56 Ga0123353_10885307 3300010167 Bacteria 1218
57 Ga0123353_11193839 3300010167 Bacteria 999
58 Ga0466718_044170 3300042617 Bacteria 4468
59 Ga0415639_001362 3300038395 Bacteria 26288
60 Ga0466696_446307 3300042596 Bacteria 18945
61 Ga0466722_119174 3300042609 Bacteria 35813
62 Ga0466722_210579 3300042609 Bacteria 3052
63 Ga0466708_353409 3300042652 Bacteria 7207
64 Ga0105553_1110576 3300007767 Bacteria 4135
65 Ga0123353_10000551 3300010167 Bacteria 46124
66 Ga0123353_10581246 3300010167 Bacteria 1607
67 Ga0415639_281494 3300038395 Bacteria 1757
68 Ga0466719_045961 3300042606 Bacteria 1863
69 Ga0466721_084896 3300042608 Bacteria 14749
70 Ga0466703_030712 3300042636 Bacteria 23598
71 Ga0562378_0589 3300056814 Bacteria 58112
72 Ga0123357_10504443 3300009784 Bacteria 1002
73 Ga0123356_10010282 3300010049 Bacteria 9193
74 Ga0123356_10031092 3300010049 Bacteria 4997
75 Ga0123356_12122855 3300010049 Bacteria 702
76 Ga0123353_10240665 3300010167 Bacteria 2812
77 Ga0123353_11201124 3300010167 Bacteria 995
78 Ga0123353_11584904 3300010167 Bacteria 828
79 Ga0466712_017838 3300042614 Bacteria 2814
80 Ga0466711_028838 3300042615 Bacteria 3859
81 Ga0466714_007762 3300042603 Bacteria 3425
82 Ga0466719_534721 3300042606 Bacteria 4603
83 Ga0466703_400018 3300042636 Bacteria 6355
84 Ga0466725_042710 3300042654 Bacteria 6913
85 IMNBL1DRAFT_c0000867 3300000062 Bacteria 23600
86 Ga0562378_0039 3300056814 Bacteria 444185
87 Ga0562375_0159 3300056856 Bacteria 198506
88 Ga0123357_10161878 3300009784 Bacteria 2680
89 Ga0123356_10024576 3300010049 Bacteria 5668
90 Ga0123356_10048288 3300010049 Bacteria 3961
91 Ga0123353_10841725 3300010167 Unclassified 1259
92 Ga0123353_11908010 3300010167 Bacteria 732
93 Ga0466705_389509 3300042612 Bacteria 5824
94 Ga0466690_156306 3300042590 Bacteria 2349
95 Ga0466693_143708 3300042592 Bacteria 4562
96 Ga0466714_012954 3300042603 Bacteria 18148
97 Ga0466717_302819 3300042604 Bacteria 3553
98 Ga0466705_118955 3300042612 Bacteria 7950
99 Ga0466724_37783 3300042649 Bacteria 3697
100 IMNBL1DRAFT_c0000033 3300000062 Bacteria 123013
101 JGI24695J34938_10029829 3300002450 Bacteria 2546
102 JGI24695J34938_10048380 3300002450 Unclassified 1873
103 Ga0074304_1173717 3300005319 Bacteria 651
104 Ga0123355_10297395 3300009826 Bacteria 2206
105 Ga0123355_10579376 3300009826 Bacteria 1342
106 Ga0123356_10302559 3300010049 Bacteria 1705
107 Ga0123356_10546201 3300010049 Bacteria 1319
108 Ga0123356_11243233 3300010049 Bacteria 910
109 Ga0123356_12740076 3300010049 Bacteria 617
110 Ga0123353_10253273 3300010167 Bacteria 2725
111 Ga0123353_10255061 3300010167 Bacteria 2713
112 Ga0123353_11233989 3300010167 Bacteria 978
113 Ga0123353_12136199 3300010167 Bacteria 680
114 Ga0466715_428262 3300042616 Bacteria 3771
115 Ga0466726_286329 3300042619 Bacteria 1942
116 Ga0466691_032537 3300042593 Bacteria 5007

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_10573980 Ga0123353_105739801 120
2 3300042606 Ga0466719_534721 Ga0466719_534721_301_681 126
3 3300042616 Ga0466715_417946 Ga0466715_417946_834_1214 126
4 3300042596 Ga0466696_446307 Ga0466696_446307_13917_14300 127
5 2225789004 2227155809 2227563491 132
6 3300000062 IMNBL1DRAFT_c0000033 IMNBL1DRAFT_000003313 133
7 3300010167 Ga0123353_10725664 Ga0123353_107256642 135
8 3300038395 Ga0415639_281494 Ga0415639_281494_1112_1522 136
9 3300038395 Ga0415639_067238 Ga0415639_067238_5597_6010 137
10 3300042659 Ga0466733_121626 Ga0466733_121626_578_991 137
11 iso_pr_bacteria 2940218408 2940219595 137
12 iso_pr_bacteria 2940261461 2940262642 137
13 3300010167 Ga0123353_11908010 Ga0123353_119080102 138
14 3300038395 Ga0415639_000782 Ga0415639_000782_10997_11413 138
15 3300042592 Ga0466693_143708 Ga0466693_143708_2763_3179 138
16 3300042592 Ga0466693_168798 Ga0466693_168798_1511_1927 138
17 iso_pr_bacteria 2820582954 2820583924 138
18 iso_pr_bacteria 2820666966 2820667044 138
19 2225789004 2227507959 2227998790 139
20 3300002450 JGI24695J34938_10000001 JGI24695J34938_1000000178 139
21 3300010049 Ga0123356_11446236 Ga0123356_114462362 139
22 3300010049 Ga0123356_12740076 Ga0123356_127400762 139
23 3300038395 Ga0415639_000202 Ga0415639_000202_230_649 139
24 3300038395 Ga0415639_025418 Ga0415639_025418_1028_1447 139
25 3300038395 Ga0415639_045249 Ga0415639_045249_2380_2799 139
26 3300038395 Ga0415639_132245 Ga0415639_132245_2567_2986 139
27 3300042603 Ga0466714_007762 Ga0466714_007762_1730_2149 139
28 3300042603 Ga0466714_096906 Ga0466714_096906_405_824 139
29 3300042636 Ga0466703_400018 Ga0466703_400018_1929_2348 139
30 iso_pr_bacteria 2820001644 2820003820 139
31 iso_pr_bacteria 2820254385 2820255546 139
32 iso_pr_bacteria 2820294436 2820295924 139
33 iso_pr_bacteria 2820463629 2820464846 139
34 iso_pr_bacteria 2820570671 2820571030 139
35 3300002450 JGI24695J34938_10029829 JGI24695J34938_100298293 140
36 3300010049 Ga0123356_10000006 Ga0123356_10000006114 140
37 3300010049 Ga0123356_10010282 Ga0123356_100102824 140
38 3300010049 Ga0123356_10013934 Ga0123356_100139348 140
39 3300010049 Ga0123356_10048288 Ga0123356_100482883 140
40 3300010049 Ga0123356_11039157 Ga0123356_110391572 140
41 3300010049 Ga0123356_12122855 Ga0123356_121228551 140
42 3300010167 Ga0123353_10240665 Ga0123353_102406652 140
43 3300010167 Ga0123353_10253273 Ga0123353_102532732 140
44 3300010167 Ga0123353_10581246 Ga0123353_105812461 140
45 3300010167 Ga0123353_10841725 Ga0123353_108417252 140
46 3300010167 Ga0123353_11201124 Ga0123353_112011242 140
47 3300010167 Ga0123353_11233989 Ga0123353_112339892 140
48 3300010882 Ga0123354_10368244 Ga0123354_103682442 140
49 3300042606 Ga0466719_045961 Ga0466719_045961_46_468 140
50 3300042609 Ga0466722_228939 Ga0466722_228939_224_646 140
51 3300042615 Ga0466711_028838 Ga0466711_028838_3403_3825 140
52 3300042615 Ga0466711_212527 Ga0466711_212527_434_856 140
53 3300042616 Ga0466715_428262 Ga0466715_428262_1680_2102 140
54 iso_pr_bacteria 2820453354 2820454390 140
55 3300000062 IMNBL1DRAFT_c0000867 IMNBL1DRAFT_00008679 141
56 3300009784 Ga0123357_10504443 Ga0123357_105044432 141
57 3300010049 Ga0123356_10839918 Ga0123356_108399182 141
58 3300010167 Ga0123353_10000551 Ga0123353_1000055151 141
59 3300038395 Ga0415639_016078 Ga0415639_016078_689_1114 141
60 3300042596 Ga0466696_036444 Ga0466696_036444_2943_3368 141
61 3300042600 Ga0466700_053694 Ga0466700_053694_630_1055 141
62 3300042608 Ga0466721_084896 Ga0466721_084896_12291_12716 141
63 3300042608 Ga0466721_332798 Ga0466721_332798_695_1120 141
64 3300042612 Ga0466705_389509 Ga0466705_389509_2055_2480 141
65 3300042643 Ga0466704_470122 Ga0466704_470122_242_667 141
66 3300042654 Ga0466725_042710 Ga0466725_042710_4596_5021 141
67 iso_pr_bacteria 2820275298 2820276537 141
68 iso_pr_bacteria 2820560510 2820563039 141
69 3300009784 Ga0123357_10161878 Ga0123357_101618783 142
70 3300009826 Ga0123355_10297395 Ga0123355_102973952 142
71 3300009826 Ga0123355_10579376 Ga0123355_105793762 142
72 3300010049 Ga0123356_10008372 Ga0123356_100083724 142
73 3300042600 Ga0466700_283576 Ga0466700_283576_5402_5830 142
74 3300042604 Ga0466717_137760 Ga0466717_137760_397_825 142
75 3300042612 Ga0466705_118955 Ga0466705_118955_4233_4661 142
76 3300042617 Ga0466718_044170 Ga0466718_044170_1033_1461 142
77 iso_pr_bacteria 2820257794 2820258901 142
78 iso_pr_bacteria 2820373881 2820375212 142
79 3300002450 JGI24695J34938_10002049 JGI24695J34938_100020497 143
80 3300002462 JGI24702J35022_10095146 JGI24702J35022_100951463 143
81 3300009826 Ga0123355_11265486 Ga0123355_112654861 143
82 3300010049 Ga0123356_10236061 Ga0123356_102360613 143
83 3300010049 Ga0123356_10546201 Ga0123356_105462012 143
84 3300010049 Ga0123356_10975879 Ga0123356_109758792 143
85 3300010167 Ga0123353_10885307 Ga0123353_108853072 143
86 3300010167 Ga0123353_11193839 Ga0123353_111938391 143
87 3300010167 Ga0123353_11584904 Ga0123353_115849042 143
88 3300042604 Ga0466717_302819 Ga0466717_302819_591_1022 143
89 3300042609 Ga0466722_119174 Ga0466722_119174_12987_13418 143
90 3300042636 Ga0466703_030712 Ga0466703_030712_12712_13143 143
91 3300042655 Ga0466727_182730 Ga0466727_182730_471_902 143
92 3300002450 JGI24695J34938_10016137 JGI24695J34938_100161374 144
93 3300002450 JGI24695J34938_10048380 JGI24695J34938_100483802 144
94 3300002450 JGI24695J34938_10126093 JGI24695J34938_101260932 144
95 3300002450 JGI24695J34938_10196709 JGI24695J34938_101967091 144
96 3300009784 Ga0123357_10203980 Ga0123357_102039803 144
97 3300009784 Ga0123357_10774458 Ga0123357_107744582 144
98 3300010049 Ga0123356_10202474 Ga0123356_102024742 144
99 3300010049 Ga0123356_10302559 Ga0123356_103025592 144
100 3300010049 Ga0123356_11243233 Ga0123356_112432332 144
101 3300010167 Ga0123353_10221582 Ga0123353_102215822 144
102 3300038395 Ga0415639_001362 Ga0415639_001362_8317_8751 144
103 3300042600 Ga0466700_279896 Ga0466700_279896_44507_44941 144
104 3300057007 Ga0562374_0683 Ga0562374_0683_1147_1581 144
105 iso_pr_bacteria 2781125694 2781435649 144
106 iso_pr_bacteria 2825804107 2825805369 144
107 3300010167 Ga0123353_10093178 Ga0123353_100931782 145
108 3300056814 Ga0562378_0039 Ga0562378_0039_441327_441764 145
109 3300056814 Ga0562378_0589 Ga0562378_0589_52850_53287 145
110 3300056856 Ga0562375_0159 Ga0562375_0159_169070_169507 145
111 iso_pr_bacteria 2820272499 2820272777 145
112 iso_pr_bacteria 2940264388 2940264787 145
113 iso_pr_bacteria 2940267548 2940267947 145
114 iso_pr_bacteria 2940270707 2940271106 145
115 iso_pr_bacteria 2940273867 2940274273 145
116 3300005319 Ga0074304_1173717 Ga0074304_11737171 146
117 3300009826 Ga0123355_10112807 Ga0123355_101128073 146
118 3300042614 Ga0466712_017838 Ga0466712_017838_2340_2780 146
119 3300042649 Ga0466724_37783 Ga0466724_37783_182_622 146
120 3300042593 Ga0466691_032537 Ga0466691_032537_2948_3391 147
121 3300042603 Ga0466714_012954 Ga0466714_012954_8748_9191 147
122 3300042609 Ga0466722_210579 Ga0466722_210579_560_1003 147
123 3300042619 Ga0466726_286329 Ga0466726_286329_641_1084 147
124 iso_pr_bacteria 2881375749 2881376172 147
125 iso_pr_bacteria 8007223943 8007224645 147
126 3300010049 Ga0123356_10024576 Ga0123356_100245765 148
127 3300010049 Ga0123356_10031092 Ga0123356_100310927 148
128 3300010049 Ga0123356_10800353 Ga0123356_108003532 148
129 3300042590 Ga0466690_156306 Ga0466690_156306_802_1248 148
130 3300042652 Ga0466708_353409 Ga0466708_353409_3346_3792 148
131 iso_pr_bacteria 2622736579 2623392499 148
132 3300009784 Ga0123357_10907482 Ga0123357_109074822 149
133 3300042618 Ga0466723_011522 Ga0466723_011522_6716_7165 149
134 3300042652 Ga0466708_206063 Ga0466708_206063_16108_16557 149
135 3300010167 Ga0123353_10255061 Ga0123353_102550614 152
136 3300042597 Ga0466699_193343 Ga0466699_193343_246_704 152
137 iso_pr_bacteria 8038268975 8038270366 152
138 iso_pr_bacteria 8108568626 8108570150 152
139 iso_pr_bacteria 8114555646 8114557170 152
140 3300007767 Ga0105553_1110576 Ga0105553_11105764 153
141 3300010167 Ga0123353_10093921 Ga0123353_100939212 157
142 3300056857 Ga0562376_0927 Ga0562376_0927_1641_2120 159
143 3300010167 Ga0123353_12136199 Ga0123353_121361991 161

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03061 4HBT Thioesterase superfamily 39 119 0.97
PF13279 4HBT_2 Thioesterase-like superfamily 33 147 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.