Protein Family IF03403
Metagenome
Metatranscriptome
Isolate
174
Members
69
Samples
160
Scaffolds
85.85
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11690102|Ga0123353_116901022
- Length
- 100 aa
- Sequence
- MARKRGGSGAKNGRDSNPHYLGVKISGGGIVKAGSILVRQRGTHIHPGVNVGCGGDYTLFALADGKVSYIQRRGRKMATVVPEGTSGSDEPQRQVPENL*
Sample Types
Isolate
8.1%
Metagenome
91.4%
MAG
0.0%
Metatranscriptome
0.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.8%
Kalotermitidae
22.4%
Unclassified
17.9%
Termopsidae
4.5%
Armadillidiidae
3.0%
Rhinotermitidae
3.0%
Passalidae
3.0%
Culicidae
1.5%
Tenebrionidae
1.5%
Cerambycidae
1.5%
Formicidae
1.5%
Pyrrhocoridae
1.5%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 15 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 16 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 17 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 20 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 21 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 29 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 8067071256 | Microbispora camponoti 2C-HV3 | Isolate | Formicidae |
| 32 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 33 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 36 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 37 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 38 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 39 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 40 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 41 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 42 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 43 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 48 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 49 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 50 | 2820856540 | Unclassified Actinobacteria Lab288P3bin21 | Isolate | Unclassified |
| 51 | 2503538010 | Coriobacterium glomerans PW2, DSM 20642 | Isolate | Pyrrhocoridae |
| 52 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 53 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 54 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 55 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 56 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 57 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 58 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 59 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 60 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 61 | 2820460928 | Unclassified Firmicutes Lab288P3bin140 | Isolate | Unclassified |
| 62 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 63 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 64 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 65 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 66 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 67 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 68 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 69 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_182250 | 3300042659 | Bacteria | 1824 |
| 2 | Ga0466703_006064 | 3300042636 | Bacteria | 1226 |
| 3 | Ga0466704_027631 | 3300042643 | Unclassified | 2185 |
| 4 | Ga0466704_253096 | 3300042643 | Bacteria | 1414 |
| 5 | Ga0123357_11043383 | 3300009784 | Bacteria | 501 |
| 6 | Ga0123356_12292602 | 3300010049 | Bacteria | 675 |
| 7 | Ga0123356_12467677 | 3300010049 | Bacteria | 651 |
| 8 | Ga0123353_10396198 | 3300010167 | Bacteria | 2057 |
| 9 | Ga0123353_11939030 | 3300010167 | Bacteria | 725 |
| 10 | Ga0123354_10318513 | 3300010882 | Unclassified | 1439 |
| 11 | Ga0160469_101049 | 3300012824 | Bacteria | 8608 |
| 12 | Ga0160434_100008 | 3300012850 | Bacteria | 308347 |
| 13 | Ga0466690_220215 | 3300042590 | Bacteria | 1983 |
| 14 | Ga0466692_136349 | 3300042591 | Bacteria | 2267 |
| 15 | Ga0466691_127839 | 3300042593 | Bacteria | 1836 |
| 16 | Ga0466694_275100 | 3300042594 | Bacteria | 1337 |
| 17 | Ga0466699_416828 | 3300042597 | Bacteria | 1154 |
| 18 | JGI24705J35276_12023279 | 3300002504 | Bacteria | 877 |
| 19 | JGI24699J35502_10983364 | 3300002509 | Bacteria | 1280 |
| 20 | JGI24696J40584_12435735 | 3300002834 | Bacteria | 569 |
| 21 | Ga0466705_253937 | 3300042612 | Bacteria | 1862 |
| 22 | Ga0466735_025071 | 3300042624 | Bacteria | 13306 |
| 23 | Ga0466704_051497 | 3300042643 | Unclassified | 12772 |
| 24 | Ga0466708_015351 | 3300042652 | Bacteria | 125434 |
| 25 | Ga0123357_10209926 | 3300009784 | Bacteria | 2190 |
| 26 | Ga0123353_10134762 | 3300010167 | Bacteria | 3961 |
| 27 | Ga0123353_10416004 | 3300010167 | Bacteria | 1994 |
| 28 | Ga0123353_10873005 | 3300010167 | Bacteria | 1229 |
| 29 | Ga0123353_10889813 | 3300010167 | Unclassified | 1214 |
| 30 | Ga0123353_13015704 | 3300010167 | Bacteria | 545 |
| 31 | Ga0466690_390356 | 3300042590 | Bacteria | 1700 |
| 32 | Ga0466694_006772 | 3300042594 | Bacteria | 1180 |
| 33 | Ga0466723_062295 | 3300042618 | Bacteria | 2352 |
| 34 | Ga0466723_267426 | 3300042618 | Bacteria | 8115 |
| 35 | Ga0466728_246608 | 3300042620 | Bacteria | 1663 |
| 36 | JGI24702J35022_11034914 | 3300002462 | Unclassified | 510 |
| 37 | JGI24705J35276_11344503 | 3300002504 | Bacteria | 513 |
| 38 | JGI24699J35502_10439869 | 3300002509 | Bacteria | 583 |
| 39 | JGI24696J40584_12434061 | 3300002834 | Bacteria | 569 |
| 40 | JGI24696J40584_12864393 | 3300002834 | Bacteria | 1023 |
| 41 | JGI24696J40584_12893455 | 3300002834 | Bacteria | 1143 |
| 42 | Ga0466732_170170 | 3300042656 | Bacteria | 1089 |
| 43 | Ga0466704_327178 | 3300042643 | Bacteria | 1665 |
| 44 | Ga0123357_10104656 | 3300009784 | Bacteria | 3633 |
| 45 | Ga0123357_10857756 | 3300009784 | Unclassified | 598 |
| 46 | Ga0123353_10178220 | 3300010167 | Bacteria | 3367 |
| 47 | Ga0123353_11690102 | 3300010167 | Bacteria | 793 |
| 48 | Ga0123354_10096534 | 3300010882 | Bacteria | 4036 |
| 49 | Ga0466716_025536 | 3300042605 | Bacteria | 1675 |
| 50 | Ga0466719_024918 | 3300042606 | Bacteria | 1797 |
| 51 | Ga0466719_429868 | 3300042606 | Unclassified | 1052 |
| 52 | Ga0160456_101278 | 3300012820 | Bacteria | 6179 |
| 53 | Ga0466656_274669 | 3300042550 | Bacteria | 1286 |
| 54 | Ga0466691_107755 | 3300042593 | Unclassified | 2929 |
| 55 | Ga0466694_309425 | 3300042594 | Bacteria | 7720 |
| 56 | Ga0466715_231446 | 3300042616 | Bacteria | 7917 |
| 57 | Ga0466726_013031 | 3300042619 | Bacteria | 1465 |
| 58 | JGI24702J35022_10559723 | 3300002462 | Bacteria | 705 |
| 59 | Ga0466703_185109 | 3300042636 | Bacteria | 14299 |
| 60 | Ga0466703_199435 | 3300042636 | Bacteria | 8606 |
| 61 | Ga0466703_231460 | 3300042636 | Bacteria | 5029 |
| 62 | Ga0466703_255570 | 3300042636 | Bacteria | 3368 |
| 63 | Ga0466704_342660 | 3300042643 | Bacteria | 3925 |
| 64 | Ga0466709_267657 | 3300042648 | Bacteria | 5657 |
| 65 | Ga0466708_415820 | 3300042652 | Bacteria | 7007 |
| 66 | Ga0466727_103207 | 3300042655 | Bacteria | 2090 |
| 67 | Ga0123356_10134821 | 3300010049 | Bacteria | 2425 |
| 68 | Ga0123356_10331445 | 3300010049 | Bacteria | 1639 |
| 69 | Ga0123356_12038757 | 3300010049 | Bacteria | 716 |
| 70 | Ga0123353_10008497 | 3300010167 | Bacteria | 14037 |
| 71 | Ga0123353_10752289 | 3300010167 | Bacteria | 1356 |
| 72 | Ga0123353_12692527 | 3300010167 | Unclassified | 586 |
| 73 | Ga0466700_243219 | 3300042600 | Bacteria | 1410 |
| 74 | Ga0466719_292305 | 3300042606 | Unclassified | 1297 |
| 75 | Ga0466697_026606 | 3300042611 | Bacteria | 2054 |
| 76 | Ga0466692_008511 | 3300042591 | Bacteria | 9096 |
| 77 | Ga0466699_084894 | 3300042597 | Bacteria | 7527 |
| 78 | Ga0466699_333292 | 3300042597 | Bacteria | 1372 |
| 79 | 2227646823 | 2225789004 | Bacteria | 44086 |
| 80 | Ga0072940_1086523 | 3300005200 | Bacteria | 816 |
| 81 | Ga0466733_087265 | 3300042659 | Bacteria | 208960 |
| 82 | Ga0466703_153375 | 3300042636 | Unclassified | 6480 |
| 83 | Ga0466709_066076 | 3300042648 | Bacteria | 20720 |
| 84 | Ga0466708_208086 | 3300042652 | Bacteria | 3255 |
| 85 | Ga0466727_192549 | 3300042655 | Bacteria | 7286 |
| 86 | Ga0466727_199947 | 3300042655 | Bacteria | 22007 |
| 87 | Ga0123357_10109183 | 3300009784 | Bacteria | 3535 |
| 88 | Ga0123356_10020720 | 3300010049 | Unclassified | 6218 |
| 89 | Ga0123353_11184091 | 3300010167 | Bacteria | 1005 |
| 90 | Ga0160442_100104 | 3300012806 | Bacteria | 97654 |
| 91 | Ga0466700_158640 | 3300042600 | Bacteria | 2091 |
| 92 | Ga0466700_167802 | 3300042600 | Bacteria | 1293 |
| 93 | Ga0415639_001650 | 3300038395 | Bacteria | 69429 |
| 94 | Ga0466711_015276 | 3300042615 | Bacteria | 27260 |
| 95 | Ga0466723_091087 | 3300042618 | Bacteria | 26690 |
| 96 | Ga0466723_281403 | 3300042618 | Bacteria | 9375 |
| 97 | Ga0466726_074883 | 3300042619 | Bacteria | 9798 |
| 98 | IMNBL1DRAFT_c0000179 | 3300000062 | Bacteria | 56432 |
| 99 | JGI24699J35502_11132339 | 3300002509 | Bacteria | 6709 |
| 100 | Ga0466705_135041 | 3300042612 | Bacteria | 3776 |
| 101 | Ga0123357_10186882 | 3300009784 | Bacteria | 2401 |
| 102 | Ga0123357_10265513 | 3300009784 | Unclassified | 1805 |
| 103 | Ga0123355_11119813 | 3300009826 | Bacteria | 816 |
| 104 | Ga0123353_10806114 | 3300010167 | Bacteria | 1295 |
| 105 | Ga0123354_10546872 | 3300010882 | Bacteria | 875 |
| 106 | Ga0123354_10638343 | 3300010882 | Bacteria | 765 |
| 107 | Ga0160442_100037 | 3300012806 | Bacteria | 234310 |
| 108 | Ga0466701_073693 | 3300042598 | Bacteria | 1181 |
| 109 | Ga0466700_280312 | 3300042600 | Bacteria | 26188 |
| 110 | Ga0466707_384765 | 3300042601 | Bacteria | 1128 |
| 111 | Ga0466713_144169 | 3300042602 | Bacteria | 27806 |
| 112 | Ga0466698_392517 | 3300042610 | Unclassified | 29414 |
| 113 | Ga0160440_106067 | 3300012815 | Unclassified | 1106 |
| 114 | Ga0233288_1323954 | 3300022232 | Bacteria | 554 |
| 115 | Ga0466692_192021 | 3300042591 | Bacteria | 1218 |
| 116 | Ga0466694_022227 | 3300042594 | Bacteria | 1279 |
| 117 | Ga0466695_136821 | 3300042595 | Bacteria | 14037 |
| 118 | Ga0466699_373029 | 3300042597 | Bacteria | 1217 |
| 119 | Ga0466715_399043 | 3300042616 | Bacteria | 6571 |
| 120 | Ga0466723_036413 | 3300042618 | Bacteria | 7652 |
| 121 | Ga0466723_248468 | 3300042618 | Bacteria | 4384 |
| 122 | Ga0466729_135051 | 3300042621 | Bacteria | 1445 |
| 123 | JGI24702J35022_10001485 | 3300002462 | Bacteria | 14553 |
| 124 | JGI24702J35022_10054910 | 3300002462 | Bacteria | 2125 |
| 125 | Ga0466703_293893 | 3300042636 | Unclassified | 5475 |
| 126 | Ga0466709_238246 | 3300042648 | Bacteria | 2738 |
| 127 | Ga0123357_10445151 | 3300009784 | Bacteria | 1130 |
| 128 | Ga0123356_13696739 | 3300010049 | Bacteria | 529 |
| 129 | Ga0123353_10267597 | 3300010167 | Bacteria | 2636 |
| 130 | Ga0123353_11158364 | 3300010167 | Bacteria | 1020 |
| 131 | Ga0123353_11690034 | 3300010167 | Bacteria | 793 |
| 132 | Ga0123354_10819802 | 3300010882 | Bacteria | 623 |
| 133 | Ga0123354_11027446 | 3300010882 | Unclassified | 528 |
| 134 | Ga0466714_062930 | 3300042603 | Bacteria | 1151 |
| 135 | Ga0466694_158591 | 3300042594 | Bacteria | 1147 |
| 136 | Ga0466718_020378 | 3300042617 | Bacteria | 6223 |
| 137 | JGI24702J35022_10557319 | 3300002462 | Bacteria | 707 |
| 138 | JGI24702J35022_10738942 | 3300002462 | Bacteria | 612 |
| 139 | JGI24705J35276_11936156 | 3300002504 | Bacteria | 781 |
| 140 | Ga0562376_1774 | 3300056857 | Bacteria | 28793 |
| 141 | Ga0466702_199797 | 3300042635 | Bacteria | 1160 |
| 142 | Ga0466704_573321 | 3300042643 | Bacteria | 1482 |
| 143 | Ga0466708_255911 | 3300042652 | Bacteria | 7021 |
| 144 | Ga0466727_149286 | 3300042655 | Bacteria | 1446 |
| 145 | Ga0123357_10070002 | 3300009784 | Bacteria | 4661 |
| 146 | Ga0123356_10317302 | 3300010049 | Bacteria | 1670 |
| 147 | Ga0123353_10378067 | 3300010167 | Bacteria | 2120 |
| 148 | Ga0466700_373279 | 3300042600 | Bacteria | 1651 |
| 149 | Ga0466719_092272 | 3300042606 | Bacteria | 2462 |
| 150 | Ga0466719_185367 | 3300042606 | Bacteria | 23758 |
| 151 | Ga0466690_222435 | 3300042590 | Bacteria | 1104 |
| 152 | Ga0466692_045234 | 3300042591 | Bacteria | 21389 |
| 153 | Ga0466692_092107 | 3300042591 | Bacteria | 1459 |
| 154 | Ga0466693_203391 | 3300042592 | Bacteria | 1570 |
| 155 | Ga0466691_136528 | 3300042593 | Bacteria | 1014 |
| 156 | Ga0466696_448180 | 3300042596 | Unclassified | 3338 |
| 157 | Ga0466715_052135 | 3300042616 | Bacteria | 14060 |
| 158 | JGI24702J35022_10002303 | 3300002462 | Bacteria | 11706 |
| 159 | JGI24702J35022_10083078 | 3300002462 | Unclassified | 1737 |
| 160 | JGI24705J35276_11856753 | 3300002504 | Bacteria | 719 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042596 | Ga0466696_448180 | Ga0466696_448180_1417_1662 | 81 |
| 2 | 3300042605 | Ga0466716_025536 | Ga0466716_025536_1419_1664 | 81 |
| 3 | 3300042606 | Ga0466719_092272 | Ga0466719_092272_1784_2029 | 81 |
| 4 | 3300042606 | Ga0466719_292305 | Ga0466719_292305_404_649 | 81 |
| 5 | 3300042606 | Ga0466719_429868 | Ga0466719_429868_642_887 | 81 |
| 6 | 3300042618 | Ga0466723_036413 | Ga0466723_036413_2000_2245 | 81 |
| 7 | 3300042636 | Ga0466703_153375 | Ga0466703_153375_5090_5335 | 81 |
| 8 | 3300042636 | Ga0466703_185109 | Ga0466703_185109_2822_3067 | 81 |
| 9 | 3300042636 | Ga0466703_293893 | Ga0466703_293893_4762_5007 | 81 |
| 10 | 3300042643 | Ga0466704_027631 | Ga0466704_027631_506_751 | 81 |
| 11 | 3300042643 | Ga0466704_051497 | Ga0466704_051497_2820_3065 | 81 |
| 12 | 3300042643 | Ga0466704_573321 | Ga0466704_573321_427_672 | 81 |
| 13 | 3300002509 | JGI24699J35502_10439869 | JGI24699J35502_104398692 | 82 |
| 14 | 3300002509 | JGI24699J35502_10983364 | JGI24699J35502_109833642 | 82 |
| 15 | 3300002509 | JGI24699J35502_11132339 | JGI24699J35502_111323398 | 82 |
| 16 | 3300042550 | Ga0466656_274669 | Ga0466656_274669_874_1122 | 82 |
| 17 | 3300042598 | Ga0466701_073693 | Ga0466701_073693_557_805 | 82 |
| 18 | 3300042659 | Ga0466733_087265 | Ga0466733_087265_11945_12193 | 82 |
| 19 | 3300012824 | Ga0160469_101049 | Ga0160469_1010493 | 83 |
| 20 | 3300042591 | Ga0466692_045234 | Ga0466692_045234_5761_6012 | 83 |
| 21 | 3300042594 | Ga0466694_309425 | Ga0466694_309425_556_807 | 83 |
| 22 | 3300042601 | Ga0466707_384765 | Ga0466707_384765_283_534 | 83 |
| 23 | 3300042602 | Ga0466713_144169 | Ga0466713_144169_664_915 | 83 |
| 24 | 3300042603 | Ga0466714_062930 | Ga0466714_062930_543_794 | 83 |
| 25 | 3300042612 | Ga0466705_253937 | Ga0466705_253937_1480_1731 | 83 |
| 26 | 3300042616 | Ga0466715_052135 | Ga0466715_052135_5346_5597 | 83 |
| 27 | 3300042618 | Ga0466723_281403 | Ga0466723_281403_2964_3215 | 83 |
| 28 | 3300042643 | Ga0466704_342660 | Ga0466704_342660_3264_3515 | 83 |
| 29 | iso_pr_bacteria | 2820460928 | 2820461489 | 83 |
| 30 | 3300002504 | JGI24705J35276_12023279 | JGI24705J35276_120232792 | 84 |
| 31 | 3300002834 | JGI24696J40584_12864393 | JGI24696J40584_128643931 | 84 |
| 32 | 3300002834 | JGI24696J40584_12893455 | JGI24696J40584_128934551 | 84 |
| 33 | 3300009784 | Ga0123357_10857756 | Ga0123357_108577562 | 84 |
| 34 | 3300010167 | Ga0123353_10134762 | Ga0123353_101347622 | 84 |
| 35 | 3300010882 | Ga0123354_10318513 | Ga0123354_103185132 | 84 |
| 36 | 3300012820 | Ga0160456_101278 | Ga0160456_1012785 | 84 |
| 37 | 3300042592 | Ga0466693_203391 | Ga0466693_203391_198_452 | 84 |
| 38 | 3300042593 | Ga0466691_127839 | Ga0466691_127839_758_1012 | 84 |
| 39 | 3300042593 | Ga0466691_136528 | Ga0466691_136528_655_909 | 84 |
| 40 | 3300042595 | Ga0466695_136821 | Ga0466695_136821_286_540 | 84 |
| 41 | 3300042600 | Ga0466700_167802 | Ga0466700_167802_1013_1267 | 84 |
| 42 | 3300042611 | Ga0466697_026606 | Ga0466697_026606_538_792 | 84 |
| 43 | 3300042619 | Ga0466726_013031 | Ga0466726_013031_859_1113 | 84 |
| 44 | 3300042624 | Ga0466735_025071 | Ga0466735_025071_3310_3564 | 84 |
| 45 | 3300042636 | Ga0466703_255570 | Ga0466703_255570_3071_3325 | 84 |
| 46 | 3300042648 | Ga0466709_238246 | Ga0466709_238246_972_1226 | 84 |
| 47 | 3300042652 | Ga0466708_255911 | Ga0466708_255911_980_1234 | 84 |
| 48 | 3300042655 | Ga0466727_192549 | Ga0466727_192549_783_1037 | 84 |
| 49 | 3300010049 | Ga0123356_10020720 | Ga0123356_100207206 | 85 |
| 50 | 3300010049 | Ga0123356_12038757 | Ga0123356_120387572 | 85 |
| 51 | 3300010167 | Ga0123353_12692527 | Ga0123353_126925271 | 85 |
| 52 | 3300022232 | Ga0233288_1323954 | Ga0233288_13239542 | 85 |
| 53 | 3300042590 | Ga0466690_222435 | Ga0466690_222435_61_318 | 85 |
| 54 | 3300042593 | Ga0466691_107755 | Ga0466691_107755_1978_2235 | 85 |
| 55 | 3300042594 | Ga0466694_006772 | Ga0466694_006772_65_322 | 85 |
| 56 | 3300042594 | Ga0466694_022227 | Ga0466694_022227_311_568 | 85 |
| 57 | 3300042594 | Ga0466694_158591 | Ga0466694_158591_459_716 | 85 |
| 58 | 3300042594 | Ga0466694_275100 | Ga0466694_275100_158_415 | 85 |
| 59 | 3300042597 | Ga0466699_333292 | Ga0466699_333292_185_442 | 85 |
| 60 | 3300042597 | Ga0466699_416828 | Ga0466699_416828_688_945 | 85 |
| 61 | 3300042600 | Ga0466700_158640 | Ga0466700_158640_1555_1812 | 85 |
| 62 | 3300042600 | Ga0466700_280312 | Ga0466700_280312_4283_4540 | 85 |
| 63 | 3300042610 | Ga0466698_392517 | Ga0466698_392517_262_519 | 85 |
| 64 | 3300042612 | Ga0466705_135041 | Ga0466705_135041_1473_1730 | 85 |
| 65 | 3300042616 | Ga0466715_399043 | Ga0466715_399043_870_1127 | 85 |
| 66 | 3300042617 | Ga0466718_020378 | Ga0466718_020378_5084_5341 | 85 |
| 67 | 3300042618 | Ga0466723_248468 | Ga0466723_248468_1973_2230 | 85 |
| 68 | 3300042618 | Ga0466723_267426 | Ga0466723_267426_2936_3193 | 85 |
| 69 | 3300042619 | Ga0466726_074883 | Ga0466726_074883_8345_8602 | 85 |
| 70 | 3300042621 | Ga0466729_135051 | Ga0466729_135051_506_763 | 85 |
| 71 | 3300042635 | Ga0466702_199797 | Ga0466702_199797_759_1016 | 85 |
| 72 | 3300042636 | Ga0466703_006064 | Ga0466703_006064_251_508 | 85 |
| 73 | 3300042636 | Ga0466703_199435 | Ga0466703_199435_6037_6294 | 85 |
| 74 | 3300042636 | Ga0466703_231460 | Ga0466703_231460_971_1228 | 85 |
| 75 | 3300042643 | Ga0466704_253096 | Ga0466704_253096_482_739 | 85 |
| 76 | 3300042643 | Ga0466704_327178 | Ga0466704_327178_682_939 | 85 |
| 77 | 3300042648 | Ga0466709_066076 | Ga0466709_066076_1322_1579 | 85 |
| 78 | 3300042648 | Ga0466709_267657 | Ga0466709_267657_4102_4359 | 85 |
| 79 | 3300042652 | Ga0466708_208086 | Ga0466708_208086_1528_1785 | 85 |
| 80 | 3300042655 | Ga0466727_103207 | Ga0466727_103207_273_530 | 85 |
| 81 | 3300042655 | Ga0466727_149286 | Ga0466727_149286_308_565 | 85 |
| 82 | 3300042655 | Ga0466727_199947 | Ga0466727_199947_13037_13294 | 85 |
| 83 | 3300042656 | Ga0466732_170170 | Ga0466732_170170_772_1029 | 85 |
| 84 | 3300042659 | Ga0466733_182250 | Ga0466733_182250_1051_1308 | 85 |
| 85 | 3300056857 | Ga0562376_1774 | Ga0562376_1774_23644_23901 | 85 |
| 86 | iso_pr_bacteria | 2503538010 | 2503575656 | 85 |
| 87 | iso_pr_bacteria | 2681812870 | 2682011340 | 85 |
| 88 | iso_pr_bacteria | 2781125652 | 2781312260 | 85 |
| 89 | iso_pr_bacteria | 2781125686 | 2781418845 | 85 |
| 90 | iso_pr_bacteria | 2781125690 | 2781426985 | 85 |
| 91 | iso_pr_bacteria | 2820457604 | 2820459316 | 85 |
| 92 | iso_pr_bacteria | 2883361506 | 2883363855 | 85 |
| 93 | iso_pr_bacteria | 8067071256 | 8067076974 | 85 |
| 94 | 3300002462 | JGI24702J35022_10001485 | JGI24702J35022_1000148510 | 86 |
| 95 | 3300002462 | JGI24702J35022_10002303 | JGI24702J35022_1000230310 | 86 |
| 96 | 3300002462 | JGI24702J35022_10054910 | JGI24702J35022_100549102 | 86 |
| 97 | 3300002462 | JGI24702J35022_10083078 | JGI24702J35022_100830782 | 86 |
| 98 | 3300002462 | JGI24702J35022_10557319 | JGI24702J35022_105573192 | 86 |
| 99 | 3300002462 | JGI24702J35022_10559723 | JGI24702J35022_105597232 | 86 |
| 100 | 3300002462 | JGI24702J35022_10738942 | JGI24702J35022_107389421 | 86 |
| 101 | 3300002462 | JGI24702J35022_11034914 | JGI24702J35022_110349141 | 86 |
| 102 | 3300002504 | JGI24705J35276_11344503 | JGI24705J35276_113445032 | 86 |
| 103 | 3300002504 | JGI24705J35276_11856753 | JGI24705J35276_118567532 | 86 |
| 104 | 3300002504 | JGI24705J35276_11936156 | JGI24705J35276_119361561 | 86 |
| 105 | 3300002834 | JGI24696J40584_12435735 | JGI24696J40584_124357351 | 86 |
| 106 | 3300009784 | Ga0123357_10070002 | Ga0123357_100700028 | 86 |
| 107 | 3300009784 | Ga0123357_10104656 | Ga0123357_101046564 | 86 |
| 108 | 3300009784 | Ga0123357_10109183 | Ga0123357_101091834 | 86 |
| 109 | 3300009784 | Ga0123357_10186882 | Ga0123357_101868821 | 86 |
| 110 | 3300009784 | Ga0123357_10209926 | Ga0123357_102099262 | 86 |
| 111 | 3300009784 | Ga0123357_10265513 | Ga0123357_102655132 | 86 |
| 112 | 3300010049 | Ga0123356_10317302 | Ga0123356_103173024 | 86 |
| 113 | 3300010049 | Ga0123356_12292602 | Ga0123356_122926022 | 86 |
| 114 | 3300010049 | Ga0123356_12467677 | Ga0123356_124676772 | 86 |
| 115 | 3300010049 | Ga0123356_13696739 | Ga0123356_136967392 | 86 |
| 116 | 3300010167 | Ga0123353_10178220 | Ga0123353_101782203 | 86 |
| 117 | 3300010167 | Ga0123353_10267597 | Ga0123353_102675973 | 86 |
| 118 | 3300010167 | Ga0123353_10378067 | Ga0123353_103780674 | 86 |
| 119 | 3300010167 | Ga0123353_10396198 | Ga0123353_103961982 | 86 |
| 120 | 3300010167 | Ga0123353_10416004 | Ga0123353_104160045 | 86 |
| 121 | 3300010167 | Ga0123353_10752289 | Ga0123353_107522892 | 86 |
| 122 | 3300010167 | Ga0123353_10873005 | Ga0123353_108730052 | 86 |
| 123 | 3300010167 | Ga0123353_10889813 | Ga0123353_108898131 | 86 |
| 124 | 3300010167 | Ga0123353_11158364 | Ga0123353_111583642 | 86 |
| 125 | 3300010167 | Ga0123353_11184091 | Ga0123353_111840912 | 86 |
| 126 | 3300010167 | Ga0123353_11690034 | Ga0123353_116900342 | 86 |
| 127 | 3300010167 | Ga0123353_11939030 | Ga0123353_119390301 | 86 |
| 128 | 3300010882 | Ga0123354_10096534 | Ga0123354_100965343 | 86 |
| 129 | 3300010882 | Ga0123354_10546872 | Ga0123354_105468722 | 86 |
| 130 | 3300010882 | Ga0123354_10638343 | Ga0123354_106383432 | 86 |
| 131 | 3300010882 | Ga0123354_10819802 | Ga0123354_108198022 | 86 |
| 132 | 3300010882 | Ga0123354_11027446 | Ga0123354_110274462 | 86 |
| 133 | 3300012806 | Ga0160442_100037 | Ga0160442_10003772 | 86 |
| 134 | 3300012806 | Ga0160442_100104 | Ga0160442_10010471 | 86 |
| 135 | 3300012815 | Ga0160440_106067 | Ga0160440_1060672 | 86 |
| 136 | 3300012850 | Ga0160434_100008 | Ga0160434_100008179 | 86 |
| 137 | 3300038395 | Ga0415639_001650 | Ga0415639_001650_51786_52046 | 86 |
| 138 | 3300042591 | Ga0466692_008511 | Ga0466692_008511_4417_4677 | 86 |
| 139 | 3300042591 | Ga0466692_092107 | Ga0466692_092107_21_281 | 86 |
| 140 | 3300042591 | Ga0466692_136349 | Ga0466692_136349_1160_1420 | 86 |
| 141 | 3300042597 | Ga0466699_084894 | Ga0466699_084894_2407_2667 | 86 |
| 142 | 3300042606 | Ga0466719_024918 | Ga0466719_024918_1173_1433 | 86 |
| 143 | 3300042652 | Ga0466708_415820 | Ga0466708_415820_1349_1609 | 86 |
| 144 | 3300002834 | JGI24696J40584_12434061 | JGI24696J40584_124340611 | 87 |
| 145 | 3300005200 | Ga0072940_1086523 | Ga0072940_10865231 | 87 |
| 146 | 3300009826 | Ga0123355_11119813 | Ga0123355_111198131 | 87 |
| 147 | 3300010167 | Ga0123353_13015704 | Ga0123353_130157041 | 87 |
| 148 | 3300042590 | Ga0466690_390356 | Ga0466690_390356_581_844 | 87 |
| 149 | 3300042597 | Ga0466699_373029 | Ga0466699_373029_463_726 | 87 |
| 150 | 3300042606 | Ga0466719_185367 | Ga0466719_185367_23201_23464 | 87 |
| 151 | 3300042615 | Ga0466711_015276 | Ga0466711_015276_22927_23190 | 87 |
| 152 | 3300042616 | Ga0466715_231446 | Ga0466715_231446_1440_1703 | 87 |
| 153 | 3300042618 | Ga0466723_062295 | Ga0466723_062295_1986_2249 | 87 |
| 154 | 3300042618 | Ga0466723_091087 | Ga0466723_091087_6035_6298 | 87 |
| 155 | iso_pr_bacteria | 2820856540 | 2820857109 | 88 |
| 156 | 3300010049 | Ga0123356_10134821 | Ga0123356_101348212 | 89 |
| 157 | 3300010167 | Ga0123353_10008497 | Ga0123353_100084972 | 89 |
| 158 | 3300042600 | Ga0466700_373279 | Ga0466700_373279_1138_1407 | 89 |
| 159 | 3300009784 | Ga0123357_10445151 | Ga0123357_104451512 | 92 |
| 160 | 3300009784 | Ga0123357_11043383 | Ga0123357_110433831 | 92 |
| 161 | 3300010049 | Ga0123356_10331445 | Ga0123356_103314452 | 92 |
| 162 | iso_pr_bacteria | 2781125666 | 2781342728 | 92 |
| 163 | iso_pr_bacteria | 651324002 | 651578723 | 92 |
| 164 | 3300042600 | Ga0466700_243219 | Ga0466700_243219_376_657 | 93 |
| 165 | 3300042620 | Ga0466728_246608 | Ga0466728_246608_1225_1509 | 94 |
| 166 | 2225789004 | 2227646823 | 2228239539 | 95 |
| 167 | 3300042590 | Ga0466690_220215 | Ga0466690_220215_1160_1447 | 95 |
| 168 | 3300042591 | Ga0466692_192021 | Ga0466692_192021_884_1171 | 95 |
| 169 | 3300042652 | Ga0466708_015351 | Ga0466708_015351_96278_96565 | 95 |
| 170 | 3300000062 | IMNBL1DRAFT_c0000179 | IMNBL1DRAFT_000017948 | 96 |
| 171 | iso_pr_bacteria | 2636416028 | 2638993305 | 96 |
| 172 | 3300010167 | Ga0123353_11690102 | Ga0123353_116901022 | 100 |
| 173 | iso_pr_bacteria | 2989309576 | 2989311120 | 102 |
| 174 | 3300010167 | Ga0123353_10806114 | Ga0123353_108061141 | 107 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01016 | Ribosomal_L27 | Ribosomal L27 protein | 2 | 80 | 0.97 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.64 | 0.85 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.