Protein Family IF03403

Metagenome Metatranscriptome Isolate
174 Members
69 Samples
160 Scaffolds
85.85 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_11690102|Ga0123353_116901022
Length
100 aa
Sequence
MARKRGGSGAKNGRDSNPHYLGVKISGGGIVKAGSILVRQRGTHIHPGVNVGCGGDYTLFALADGKVSYIQRRGRKMATVVPEGTSGSDEPQRQVPENL*

πŸ“Š Sample Types

Isolate 8.1%
Metagenome 91.4%
MAG 0.0%
Metatranscriptome 0.6%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 38.8%
Kalotermitidae 22.4%
Unclassified 17.9%
Termopsidae 4.5%
Armadillidiidae 3.0%
Rhinotermitidae 3.0%
Passalidae 3.0%
Culicidae 1.5%
Tenebrionidae 1.5%
Cerambycidae 1.5%
Formicidae 1.5%
Pyrrhocoridae 1.5%

🌳 Taxonomy

Archaea 0
Bacteria 155
Eukaryota 0
Viruses 0
Unclassified 19

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
15 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
16 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
17 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
18 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
19 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
20 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
21 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
22 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
23 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
29 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
30 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
31 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
32 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
33 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
34 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
35 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
36 2681812870 Oerskovia enterophila DFA-19 Isolate Unclassified
37 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
38 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
39 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
40 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
41 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
42 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
43 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
44 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
45 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
46 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
47 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
48 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
49 3300012806 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG Metagenome
50 2820856540 Unclassified Actinobacteria Lab288P3bin21 Isolate Unclassified
51 2503538010 Coriobacterium glomerans PW2, DSM 20642 Isolate Pyrrhocoridae
52 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
53 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
54 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
55 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
56 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
57 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
58 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
59 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
60 2781125690 Treponema sp. Th196P3bin63 Isolate Unclassified
61 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
62 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
63 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
64 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
65 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
66 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
69 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_182250 3300042659 Bacteria 1824
2 Ga0466703_006064 3300042636 Bacteria 1226
3 Ga0466704_027631 3300042643 Unclassified 2185
4 Ga0466704_253096 3300042643 Bacteria 1414
5 Ga0123357_11043383 3300009784 Bacteria 501
6 Ga0123356_12292602 3300010049 Bacteria 675
7 Ga0123356_12467677 3300010049 Bacteria 651
8 Ga0123353_10396198 3300010167 Bacteria 2057
9 Ga0123353_11939030 3300010167 Bacteria 725
10 Ga0123354_10318513 3300010882 Unclassified 1439
11 Ga0160469_101049 3300012824 Bacteria 8608
12 Ga0160434_100008 3300012850 Bacteria 308347
13 Ga0466690_220215 3300042590 Bacteria 1983
14 Ga0466692_136349 3300042591 Bacteria 2267
15 Ga0466691_127839 3300042593 Bacteria 1836
16 Ga0466694_275100 3300042594 Bacteria 1337
17 Ga0466699_416828 3300042597 Bacteria 1154
18 JGI24705J35276_12023279 3300002504 Bacteria 877
19 JGI24699J35502_10983364 3300002509 Bacteria 1280
20 JGI24696J40584_12435735 3300002834 Bacteria 569
21 Ga0466705_253937 3300042612 Bacteria 1862
22 Ga0466735_025071 3300042624 Bacteria 13306
23 Ga0466704_051497 3300042643 Unclassified 12772
24 Ga0466708_015351 3300042652 Bacteria 125434
25 Ga0123357_10209926 3300009784 Bacteria 2190
26 Ga0123353_10134762 3300010167 Bacteria 3961
27 Ga0123353_10416004 3300010167 Bacteria 1994
28 Ga0123353_10873005 3300010167 Bacteria 1229
29 Ga0123353_10889813 3300010167 Unclassified 1214
30 Ga0123353_13015704 3300010167 Bacteria 545
31 Ga0466690_390356 3300042590 Bacteria 1700
32 Ga0466694_006772 3300042594 Bacteria 1180
33 Ga0466723_062295 3300042618 Bacteria 2352
34 Ga0466723_267426 3300042618 Bacteria 8115
35 Ga0466728_246608 3300042620 Bacteria 1663
36 JGI24702J35022_11034914 3300002462 Unclassified 510
37 JGI24705J35276_11344503 3300002504 Bacteria 513
38 JGI24699J35502_10439869 3300002509 Bacteria 583
39 JGI24696J40584_12434061 3300002834 Bacteria 569
40 JGI24696J40584_12864393 3300002834 Bacteria 1023
41 JGI24696J40584_12893455 3300002834 Bacteria 1143
42 Ga0466732_170170 3300042656 Bacteria 1089
43 Ga0466704_327178 3300042643 Bacteria 1665
44 Ga0123357_10104656 3300009784 Bacteria 3633
45 Ga0123357_10857756 3300009784 Unclassified 598
46 Ga0123353_10178220 3300010167 Bacteria 3367
47 Ga0123353_11690102 3300010167 Bacteria 793
48 Ga0123354_10096534 3300010882 Bacteria 4036
49 Ga0466716_025536 3300042605 Bacteria 1675
50 Ga0466719_024918 3300042606 Bacteria 1797
51 Ga0466719_429868 3300042606 Unclassified 1052
52 Ga0160456_101278 3300012820 Bacteria 6179
53 Ga0466656_274669 3300042550 Bacteria 1286
54 Ga0466691_107755 3300042593 Unclassified 2929
55 Ga0466694_309425 3300042594 Bacteria 7720
56 Ga0466715_231446 3300042616 Bacteria 7917
57 Ga0466726_013031 3300042619 Bacteria 1465
58 JGI24702J35022_10559723 3300002462 Bacteria 705
59 Ga0466703_185109 3300042636 Bacteria 14299
60 Ga0466703_199435 3300042636 Bacteria 8606
61 Ga0466703_231460 3300042636 Bacteria 5029
62 Ga0466703_255570 3300042636 Bacteria 3368
63 Ga0466704_342660 3300042643 Bacteria 3925
64 Ga0466709_267657 3300042648 Bacteria 5657
65 Ga0466708_415820 3300042652 Bacteria 7007
66 Ga0466727_103207 3300042655 Bacteria 2090
67 Ga0123356_10134821 3300010049 Bacteria 2425
68 Ga0123356_10331445 3300010049 Bacteria 1639
69 Ga0123356_12038757 3300010049 Bacteria 716
70 Ga0123353_10008497 3300010167 Bacteria 14037
71 Ga0123353_10752289 3300010167 Bacteria 1356
72 Ga0123353_12692527 3300010167 Unclassified 586
73 Ga0466700_243219 3300042600 Bacteria 1410
74 Ga0466719_292305 3300042606 Unclassified 1297
75 Ga0466697_026606 3300042611 Bacteria 2054
76 Ga0466692_008511 3300042591 Bacteria 9096
77 Ga0466699_084894 3300042597 Bacteria 7527
78 Ga0466699_333292 3300042597 Bacteria 1372
79 2227646823 2225789004 Bacteria 44086
80 Ga0072940_1086523 3300005200 Bacteria 816
81 Ga0466733_087265 3300042659 Bacteria 208960
82 Ga0466703_153375 3300042636 Unclassified 6480
83 Ga0466709_066076 3300042648 Bacteria 20720
84 Ga0466708_208086 3300042652 Bacteria 3255
85 Ga0466727_192549 3300042655 Bacteria 7286
86 Ga0466727_199947 3300042655 Bacteria 22007
87 Ga0123357_10109183 3300009784 Bacteria 3535
88 Ga0123356_10020720 3300010049 Unclassified 6218
89 Ga0123353_11184091 3300010167 Bacteria 1005
90 Ga0160442_100104 3300012806 Bacteria 97654
91 Ga0466700_158640 3300042600 Bacteria 2091
92 Ga0466700_167802 3300042600 Bacteria 1293
93 Ga0415639_001650 3300038395 Bacteria 69429
94 Ga0466711_015276 3300042615 Bacteria 27260
95 Ga0466723_091087 3300042618 Bacteria 26690
96 Ga0466723_281403 3300042618 Bacteria 9375
97 Ga0466726_074883 3300042619 Bacteria 9798
98 IMNBL1DRAFT_c0000179 3300000062 Bacteria 56432
99 JGI24699J35502_11132339 3300002509 Bacteria 6709
100 Ga0466705_135041 3300042612 Bacteria 3776
101 Ga0123357_10186882 3300009784 Bacteria 2401
102 Ga0123357_10265513 3300009784 Unclassified 1805
103 Ga0123355_11119813 3300009826 Bacteria 816
104 Ga0123353_10806114 3300010167 Bacteria 1295
105 Ga0123354_10546872 3300010882 Bacteria 875
106 Ga0123354_10638343 3300010882 Bacteria 765
107 Ga0160442_100037 3300012806 Bacteria 234310
108 Ga0466701_073693 3300042598 Bacteria 1181
109 Ga0466700_280312 3300042600 Bacteria 26188
110 Ga0466707_384765 3300042601 Bacteria 1128
111 Ga0466713_144169 3300042602 Bacteria 27806
112 Ga0466698_392517 3300042610 Unclassified 29414
113 Ga0160440_106067 3300012815 Unclassified 1106
114 Ga0233288_1323954 3300022232 Bacteria 554
115 Ga0466692_192021 3300042591 Bacteria 1218
116 Ga0466694_022227 3300042594 Bacteria 1279
117 Ga0466695_136821 3300042595 Bacteria 14037
118 Ga0466699_373029 3300042597 Bacteria 1217
119 Ga0466715_399043 3300042616 Bacteria 6571
120 Ga0466723_036413 3300042618 Bacteria 7652
121 Ga0466723_248468 3300042618 Bacteria 4384
122 Ga0466729_135051 3300042621 Bacteria 1445
123 JGI24702J35022_10001485 3300002462 Bacteria 14553
124 JGI24702J35022_10054910 3300002462 Bacteria 2125
125 Ga0466703_293893 3300042636 Unclassified 5475
126 Ga0466709_238246 3300042648 Bacteria 2738
127 Ga0123357_10445151 3300009784 Bacteria 1130
128 Ga0123356_13696739 3300010049 Bacteria 529
129 Ga0123353_10267597 3300010167 Bacteria 2636
130 Ga0123353_11158364 3300010167 Bacteria 1020
131 Ga0123353_11690034 3300010167 Bacteria 793
132 Ga0123354_10819802 3300010882 Bacteria 623
133 Ga0123354_11027446 3300010882 Unclassified 528
134 Ga0466714_062930 3300042603 Bacteria 1151
135 Ga0466694_158591 3300042594 Bacteria 1147
136 Ga0466718_020378 3300042617 Bacteria 6223
137 JGI24702J35022_10557319 3300002462 Bacteria 707
138 JGI24702J35022_10738942 3300002462 Bacteria 612
139 JGI24705J35276_11936156 3300002504 Bacteria 781
140 Ga0562376_1774 3300056857 Bacteria 28793
141 Ga0466702_199797 3300042635 Bacteria 1160
142 Ga0466704_573321 3300042643 Bacteria 1482
143 Ga0466708_255911 3300042652 Bacteria 7021
144 Ga0466727_149286 3300042655 Bacteria 1446
145 Ga0123357_10070002 3300009784 Bacteria 4661
146 Ga0123356_10317302 3300010049 Bacteria 1670
147 Ga0123353_10378067 3300010167 Bacteria 2120
148 Ga0466700_373279 3300042600 Bacteria 1651
149 Ga0466719_092272 3300042606 Bacteria 2462
150 Ga0466719_185367 3300042606 Bacteria 23758
151 Ga0466690_222435 3300042590 Bacteria 1104
152 Ga0466692_045234 3300042591 Bacteria 21389
153 Ga0466692_092107 3300042591 Bacteria 1459
154 Ga0466693_203391 3300042592 Bacteria 1570
155 Ga0466691_136528 3300042593 Bacteria 1014
156 Ga0466696_448180 3300042596 Unclassified 3338
157 Ga0466715_052135 3300042616 Bacteria 14060
158 JGI24702J35022_10002303 3300002462 Bacteria 11706
159 JGI24702J35022_10083078 3300002462 Unclassified 1737
160 JGI24705J35276_11856753 3300002504 Bacteria 719

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_448180 Ga0466696_448180_1417_1662 81
2 3300042605 Ga0466716_025536 Ga0466716_025536_1419_1664 81
3 3300042606 Ga0466719_092272 Ga0466719_092272_1784_2029 81
4 3300042606 Ga0466719_292305 Ga0466719_292305_404_649 81
5 3300042606 Ga0466719_429868 Ga0466719_429868_642_887 81
6 3300042618 Ga0466723_036413 Ga0466723_036413_2000_2245 81
7 3300042636 Ga0466703_153375 Ga0466703_153375_5090_5335 81
8 3300042636 Ga0466703_185109 Ga0466703_185109_2822_3067 81
9 3300042636 Ga0466703_293893 Ga0466703_293893_4762_5007 81
10 3300042643 Ga0466704_027631 Ga0466704_027631_506_751 81
11 3300042643 Ga0466704_051497 Ga0466704_051497_2820_3065 81
12 3300042643 Ga0466704_573321 Ga0466704_573321_427_672 81
13 3300002509 JGI24699J35502_10439869 JGI24699J35502_104398692 82
14 3300002509 JGI24699J35502_10983364 JGI24699J35502_109833642 82
15 3300002509 JGI24699J35502_11132339 JGI24699J35502_111323398 82
16 3300042550 Ga0466656_274669 Ga0466656_274669_874_1122 82
17 3300042598 Ga0466701_073693 Ga0466701_073693_557_805 82
18 3300042659 Ga0466733_087265 Ga0466733_087265_11945_12193 82
19 3300012824 Ga0160469_101049 Ga0160469_1010493 83
20 3300042591 Ga0466692_045234 Ga0466692_045234_5761_6012 83
21 3300042594 Ga0466694_309425 Ga0466694_309425_556_807 83
22 3300042601 Ga0466707_384765 Ga0466707_384765_283_534 83
23 3300042602 Ga0466713_144169 Ga0466713_144169_664_915 83
24 3300042603 Ga0466714_062930 Ga0466714_062930_543_794 83
25 3300042612 Ga0466705_253937 Ga0466705_253937_1480_1731 83
26 3300042616 Ga0466715_052135 Ga0466715_052135_5346_5597 83
27 3300042618 Ga0466723_281403 Ga0466723_281403_2964_3215 83
28 3300042643 Ga0466704_342660 Ga0466704_342660_3264_3515 83
29 iso_pr_bacteria 2820460928 2820461489 83
30 3300002504 JGI24705J35276_12023279 JGI24705J35276_120232792 84
31 3300002834 JGI24696J40584_12864393 JGI24696J40584_128643931 84
32 3300002834 JGI24696J40584_12893455 JGI24696J40584_128934551 84
33 3300009784 Ga0123357_10857756 Ga0123357_108577562 84
34 3300010167 Ga0123353_10134762 Ga0123353_101347622 84
35 3300010882 Ga0123354_10318513 Ga0123354_103185132 84
36 3300012820 Ga0160456_101278 Ga0160456_1012785 84
37 3300042592 Ga0466693_203391 Ga0466693_203391_198_452 84
38 3300042593 Ga0466691_127839 Ga0466691_127839_758_1012 84
39 3300042593 Ga0466691_136528 Ga0466691_136528_655_909 84
40 3300042595 Ga0466695_136821 Ga0466695_136821_286_540 84
41 3300042600 Ga0466700_167802 Ga0466700_167802_1013_1267 84
42 3300042611 Ga0466697_026606 Ga0466697_026606_538_792 84
43 3300042619 Ga0466726_013031 Ga0466726_013031_859_1113 84
44 3300042624 Ga0466735_025071 Ga0466735_025071_3310_3564 84
45 3300042636 Ga0466703_255570 Ga0466703_255570_3071_3325 84
46 3300042648 Ga0466709_238246 Ga0466709_238246_972_1226 84
47 3300042652 Ga0466708_255911 Ga0466708_255911_980_1234 84
48 3300042655 Ga0466727_192549 Ga0466727_192549_783_1037 84
49 3300010049 Ga0123356_10020720 Ga0123356_100207206 85
50 3300010049 Ga0123356_12038757 Ga0123356_120387572 85
51 3300010167 Ga0123353_12692527 Ga0123353_126925271 85
52 3300022232 Ga0233288_1323954 Ga0233288_13239542 85
53 3300042590 Ga0466690_222435 Ga0466690_222435_61_318 85
54 3300042593 Ga0466691_107755 Ga0466691_107755_1978_2235 85
55 3300042594 Ga0466694_006772 Ga0466694_006772_65_322 85
56 3300042594 Ga0466694_022227 Ga0466694_022227_311_568 85
57 3300042594 Ga0466694_158591 Ga0466694_158591_459_716 85
58 3300042594 Ga0466694_275100 Ga0466694_275100_158_415 85
59 3300042597 Ga0466699_333292 Ga0466699_333292_185_442 85
60 3300042597 Ga0466699_416828 Ga0466699_416828_688_945 85
61 3300042600 Ga0466700_158640 Ga0466700_158640_1555_1812 85
62 3300042600 Ga0466700_280312 Ga0466700_280312_4283_4540 85
63 3300042610 Ga0466698_392517 Ga0466698_392517_262_519 85
64 3300042612 Ga0466705_135041 Ga0466705_135041_1473_1730 85
65 3300042616 Ga0466715_399043 Ga0466715_399043_870_1127 85
66 3300042617 Ga0466718_020378 Ga0466718_020378_5084_5341 85
67 3300042618 Ga0466723_248468 Ga0466723_248468_1973_2230 85
68 3300042618 Ga0466723_267426 Ga0466723_267426_2936_3193 85
69 3300042619 Ga0466726_074883 Ga0466726_074883_8345_8602 85
70 3300042621 Ga0466729_135051 Ga0466729_135051_506_763 85
71 3300042635 Ga0466702_199797 Ga0466702_199797_759_1016 85
72 3300042636 Ga0466703_006064 Ga0466703_006064_251_508 85
73 3300042636 Ga0466703_199435 Ga0466703_199435_6037_6294 85
74 3300042636 Ga0466703_231460 Ga0466703_231460_971_1228 85
75 3300042643 Ga0466704_253096 Ga0466704_253096_482_739 85
76 3300042643 Ga0466704_327178 Ga0466704_327178_682_939 85
77 3300042648 Ga0466709_066076 Ga0466709_066076_1322_1579 85
78 3300042648 Ga0466709_267657 Ga0466709_267657_4102_4359 85
79 3300042652 Ga0466708_208086 Ga0466708_208086_1528_1785 85
80 3300042655 Ga0466727_103207 Ga0466727_103207_273_530 85
81 3300042655 Ga0466727_149286 Ga0466727_149286_308_565 85
82 3300042655 Ga0466727_199947 Ga0466727_199947_13037_13294 85
83 3300042656 Ga0466732_170170 Ga0466732_170170_772_1029 85
84 3300042659 Ga0466733_182250 Ga0466733_182250_1051_1308 85
85 3300056857 Ga0562376_1774 Ga0562376_1774_23644_23901 85
86 iso_pr_bacteria 2503538010 2503575656 85
87 iso_pr_bacteria 2681812870 2682011340 85
88 iso_pr_bacteria 2781125652 2781312260 85
89 iso_pr_bacteria 2781125686 2781418845 85
90 iso_pr_bacteria 2781125690 2781426985 85
91 iso_pr_bacteria 2820457604 2820459316 85
92 iso_pr_bacteria 2883361506 2883363855 85
93 iso_pr_bacteria 8067071256 8067076974 85
94 3300002462 JGI24702J35022_10001485 JGI24702J35022_1000148510 86
95 3300002462 JGI24702J35022_10002303 JGI24702J35022_1000230310 86
96 3300002462 JGI24702J35022_10054910 JGI24702J35022_100549102 86
97 3300002462 JGI24702J35022_10083078 JGI24702J35022_100830782 86
98 3300002462 JGI24702J35022_10557319 JGI24702J35022_105573192 86
99 3300002462 JGI24702J35022_10559723 JGI24702J35022_105597232 86
100 3300002462 JGI24702J35022_10738942 JGI24702J35022_107389421 86
101 3300002462 JGI24702J35022_11034914 JGI24702J35022_110349141 86
102 3300002504 JGI24705J35276_11344503 JGI24705J35276_113445032 86
103 3300002504 JGI24705J35276_11856753 JGI24705J35276_118567532 86
104 3300002504 JGI24705J35276_11936156 JGI24705J35276_119361561 86
105 3300002834 JGI24696J40584_12435735 JGI24696J40584_124357351 86
106 3300009784 Ga0123357_10070002 Ga0123357_100700028 86
107 3300009784 Ga0123357_10104656 Ga0123357_101046564 86
108 3300009784 Ga0123357_10109183 Ga0123357_101091834 86
109 3300009784 Ga0123357_10186882 Ga0123357_101868821 86
110 3300009784 Ga0123357_10209926 Ga0123357_102099262 86
111 3300009784 Ga0123357_10265513 Ga0123357_102655132 86
112 3300010049 Ga0123356_10317302 Ga0123356_103173024 86
113 3300010049 Ga0123356_12292602 Ga0123356_122926022 86
114 3300010049 Ga0123356_12467677 Ga0123356_124676772 86
115 3300010049 Ga0123356_13696739 Ga0123356_136967392 86
116 3300010167 Ga0123353_10178220 Ga0123353_101782203 86
117 3300010167 Ga0123353_10267597 Ga0123353_102675973 86
118 3300010167 Ga0123353_10378067 Ga0123353_103780674 86
119 3300010167 Ga0123353_10396198 Ga0123353_103961982 86
120 3300010167 Ga0123353_10416004 Ga0123353_104160045 86
121 3300010167 Ga0123353_10752289 Ga0123353_107522892 86
122 3300010167 Ga0123353_10873005 Ga0123353_108730052 86
123 3300010167 Ga0123353_10889813 Ga0123353_108898131 86
124 3300010167 Ga0123353_11158364 Ga0123353_111583642 86
125 3300010167 Ga0123353_11184091 Ga0123353_111840912 86
126 3300010167 Ga0123353_11690034 Ga0123353_116900342 86
127 3300010167 Ga0123353_11939030 Ga0123353_119390301 86
128 3300010882 Ga0123354_10096534 Ga0123354_100965343 86
129 3300010882 Ga0123354_10546872 Ga0123354_105468722 86
130 3300010882 Ga0123354_10638343 Ga0123354_106383432 86
131 3300010882 Ga0123354_10819802 Ga0123354_108198022 86
132 3300010882 Ga0123354_11027446 Ga0123354_110274462 86
133 3300012806 Ga0160442_100037 Ga0160442_10003772 86
134 3300012806 Ga0160442_100104 Ga0160442_10010471 86
135 3300012815 Ga0160440_106067 Ga0160440_1060672 86
136 3300012850 Ga0160434_100008 Ga0160434_100008179 86
137 3300038395 Ga0415639_001650 Ga0415639_001650_51786_52046 86
138 3300042591 Ga0466692_008511 Ga0466692_008511_4417_4677 86
139 3300042591 Ga0466692_092107 Ga0466692_092107_21_281 86
140 3300042591 Ga0466692_136349 Ga0466692_136349_1160_1420 86
141 3300042597 Ga0466699_084894 Ga0466699_084894_2407_2667 86
142 3300042606 Ga0466719_024918 Ga0466719_024918_1173_1433 86
143 3300042652 Ga0466708_415820 Ga0466708_415820_1349_1609 86
144 3300002834 JGI24696J40584_12434061 JGI24696J40584_124340611 87
145 3300005200 Ga0072940_1086523 Ga0072940_10865231 87
146 3300009826 Ga0123355_11119813 Ga0123355_111198131 87
147 3300010167 Ga0123353_13015704 Ga0123353_130157041 87
148 3300042590 Ga0466690_390356 Ga0466690_390356_581_844 87
149 3300042597 Ga0466699_373029 Ga0466699_373029_463_726 87
150 3300042606 Ga0466719_185367 Ga0466719_185367_23201_23464 87
151 3300042615 Ga0466711_015276 Ga0466711_015276_22927_23190 87
152 3300042616 Ga0466715_231446 Ga0466715_231446_1440_1703 87
153 3300042618 Ga0466723_062295 Ga0466723_062295_1986_2249 87
154 3300042618 Ga0466723_091087 Ga0466723_091087_6035_6298 87
155 iso_pr_bacteria 2820856540 2820857109 88
156 3300010049 Ga0123356_10134821 Ga0123356_101348212 89
157 3300010167 Ga0123353_10008497 Ga0123353_100084972 89
158 3300042600 Ga0466700_373279 Ga0466700_373279_1138_1407 89
159 3300009784 Ga0123357_10445151 Ga0123357_104451512 92
160 3300009784 Ga0123357_11043383 Ga0123357_110433831 92
161 3300010049 Ga0123356_10331445 Ga0123356_103314452 92
162 iso_pr_bacteria 2781125666 2781342728 92
163 iso_pr_bacteria 651324002 651578723 92
164 3300042600 Ga0466700_243219 Ga0466700_243219_376_657 93
165 3300042620 Ga0466728_246608 Ga0466728_246608_1225_1509 94
166 2225789004 2227646823 2228239539 95
167 3300042590 Ga0466690_220215 Ga0466690_220215_1160_1447 95
168 3300042591 Ga0466692_192021 Ga0466692_192021_884_1171 95
169 3300042652 Ga0466708_015351 Ga0466708_015351_96278_96565 95
170 3300000062 IMNBL1DRAFT_c0000179 IMNBL1DRAFT_000017948 96
171 iso_pr_bacteria 2636416028 2638993305 96
172 3300010167 Ga0123353_11690102 Ga0123353_116901022 100
173 iso_pr_bacteria 2989309576 2989311120 102
174 3300010167 Ga0123353_10806114 Ga0123353_108061141 107

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01016 Ribosomal_L27 Ribosomal L27 protein 2 80 0.97

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.64 0.85 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.