Protein Family IF03372

Metagenome Metatranscriptome Isolate
255 Members
201 Samples
113 Scaffolds
118.59 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_11008286|Ga0123353_110082861
Length
110 aa
Sequence
MARIKGGVNHKKKQNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRLWIARINAAARMNGLSYSRLMHGLKLADINMNRKMLAELAVNDKDAFATLADLAKGKIA*

πŸ“Š Sample Types

Isolate 55.7%
Metagenome 43.9%
MAG 0.0%
Metatranscriptome 0.4%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 23.5%
Apidae 16.6%
Termitidae 12.8%
Drosophilidae 5.3%
Scarabaeidae 4.8%
Halictidae 4.3%
Kalotermitidae 4.3%
Tenebrionidae 3.7%
Pyralidae 3.2%
Elmidae 2.7%
Formicidae 2.7%
Rhinotermitidae 1.6%
Bombycidae 1.6%
Passalidae 1.1%
Culicidae 1.1%
Termopsidae 1.1%
Noctuidae 1.1%
Blattidae 1.1%
Dytiscidae 0.5%
Gomphidae 0.5%
Nephropidae 0.5%
Ocypodidae 0.5%
Curculionidae 0.5%
Portunidae 0.5%
Cixiidae 0.5%
Euphausiidae 0.5%
Libellulidae 0.5%
Hydrophilidae 0.5%
Eresidae 0.5%
Calliphoridae 0.5%
Vespidae 0.5%
Hodotermitidae 0.5%

🌳 Taxonomy

Archaea 0
Bacteria 227
Eukaryota 0
Viruses 0
Unclassified 28

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2595698194 Melissococcus plutonius 90.0 Isolate Apidae
2 2595698195 Melissococcus plutonius 119 Isolate Apidae
3 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
4 2758568514 Lactobacillus kullabergensis ESL0261 Isolate Unclassified
5 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
6 2820611732 Unclassified Firmicutes Emb289P1bin19 Isolate Unclassified
7 2645727721 Lactobacillus helsingborgensis Bma5 Isolate Unclassified
8 2822450720 Bacillus toyonensis AFS052650 Isolate Scarabaeidae
9 2864782175 Bacillus toyonensis S00025 Isolate Elmidae
10 2873584433 Vagococcus coleopterorum HDW17A Isolate Dytiscidae
11 2878857142 Lactococcus lactis DmW198 Isolate Drosophilidae
12 2956930723 Bombilactobacillus bombi LV-8.1 Isolate Apidae
13 2936628749 Apilactobacillus quenuiae HV_6 Isolate Halictidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
16 8007223943 Enterococcus sp. MSG2901 Isolate
17 8017536074 Lactobacillus sp. ESL0261 Isolate Apidae
18 8018750880 Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 Isolate
19 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
20 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
21 8066795793 Apilactobacillus timberlakei HV_10 Isolate Halictidae
22 8066799369 Apilactobacillus timberlakei HV_02 Isolate Halictidae
23 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
24 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2978778678 Bacillus cereus 25 Isolate Ocypodidae
27 2997944163 Streptococcus penaeicida CAIM 1838 Isolate Unclassified
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 8114549044 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
30 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
31 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
32 2595698198 Melissococcus plutonius L9 Isolate Apidae
33 2675903377 Apilactobacillus kunkeei AR114 Isolate Unclassified
34 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
35 2758568560 Bombilactobacillus mellis ESL0294 Isolate Unclassified
36 2822232166 Bacillus toyonensis AFS084242 Isolate Scarabaeidae
37 2838140227 Dyella sp. OAE510 Isolate Unclassified
38 2877513988 Lactobacillus kullabergensis ESL0186 Isolate Apidae
39 2890957088 Psychrobacillus lasiicapitis NEAU-3TGS17 Isolate Formicidae
40 2961515617 Lactobacillus sp. ESL0259 Isolate Apidae
41 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
42 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
43 647533136 Enterococcus faecalis Fly1 Isolate Drosophilidae
44 8007220153 Enterococcus sp. BWB1-3 Isolate Scarabaeidae
45 8017462664 Lactobacillus melliventris ESL0184 Isolate Apidae
46 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
47 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
48 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
49 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
50 2971438493 Paenibacillus apiarius NRRL B-23460 Isolate Apidae
51 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
52 3300003973 Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle Metagenome Curculionidae
53 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
54 8114555646 Enterococcus sp. DIV1094 Isolate
55 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
56 2585428141 Pilibacter termitis ATCC BAA-1030 Isolate Rhinotermitidae
57 2595698190 Melissococcus plutonius 21.1 Isolate Apidae
58 2627853628 Melissococcus plutonius 82 Isolate Apidae
59 2758568515 Lactobacillus melliventris ESL0259 Isolate Unclassified
60 2758568561 Bombilactobacillus mellis ESL0292 Isolate Unclassified
61 2775507073 Enterococcus sp. CR-Ec1 Isolate Unclassified
62 2820400448 Unclassified Firmicutes Nc150Mbin1 Isolate Unclassified
63 2836667214 Paenibacillus larvae larvae B-3650 Isolate Apidae
64 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
65 2864816158 Priestia aryabhattai S00060 Isolate Elmidae
66 2896843662 Levilactobacillus brevis BDGP6 Isolate Drosophilidae
67 2956928875 Bombilactobacillus apium DCY120 Isolate Apidae
68 643886087 Bacillus thuringiensis sv. kurstaki T03a001 Isolate Pyralidae
69 643886090 Bacillus thuringiensis sv. pakistani t13001 Isolate Unclassified
70 8061100935 Bacillus thuringiensis sv. japonensis 62 Isolate
71 8064008355 Heyndrickxia oleronia Isolate Unclassified
72 2969145278 Bacillus cereus 29 Isolate Portunidae
73 3300012812 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG Metagenome Culicidae
74 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
75 2595698199 Melissococcus plutonius 60 Isolate Apidae
76 2684622911 Lactobacillus kullabergensis Lb_186 Isolate Unclassified
77 2684622914 Lactobacillus helsinborgensis Lb_183 Isolate Unclassified
78 2758568512 Lactobacillus helsingborgensis ESL0262 Isolate Unclassified
79 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
80 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
81 2850695442 Lactococcus allomyrinae 1JSPR-7 Isolate Scarabaeidae
82 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
83 2864909992 Bacillus velezensis S00166 Isolate Elmidae
84 2905310146 Ligilactobacillus salivarius A3iob Isolate Apidae
85 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
86 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
87 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
88 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
89 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
90 8001918023 Bombilactobacillus bombi XV6 Isolate Apidae
91 8002304686 Apilactobacillus kunkeei UASWS1867-NN5 Isolate Apidae
92 8007215774 Enterococcus sp. BWR-S5 Isolate Scarabaeidae
93 8007237282 Enterococcus sp. DIV0212c Isolate
94 8017489919 Lactobacillus brevis EF Isolate Unclassified
95 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
96 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
97 8061039349 Bacillus thuringiensis sv. galleriae BGSC 4G4 Isolate Bombycidae
98 8066802609 Apilactobacillus timberlakei HV_09 Isolate Halictidae
99 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
100 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
101 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
102 3300005311 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut Metagenome Drosophilidae
103 3004719924 Lactobacillus sp. W8174 Isolate Apidae
104 2537562000 Bacillus cereus HD73 Isolate Pyralidae
105 2551306396 Paenibacillus sp. ICGEB2008 Isolate Noctuidae
106 2574180310 Bacillus licheniformis CG-B52 Isolate Unclassified
107 2576861701 Paenibacillus sp. JCM 10914 Isolate Termitidae
108 2617270844 Dyella sp. HyOG Isolate Cixiidae
109 2740892556 Enterococcus sp. JR029-101 Isolate Unclassified
110 2758568557 Bombilactobacillus mellis ESL0394 Isolate Unclassified
111 2758568559 Bombilactobacillus mellis ESL0295 Isolate Unclassified
112 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
113 2940261461 Enterococcus sp. PFB1-1 Isolate Blattidae
114 2956926959 Bombilactobacillus bombi BI-1.1 Isolate Apidae
115 8002519755 Planococcus sp. MSAK28401 Isolate Euphausiidae
116 8061045771 Bacillus thuringiensis sv. kurstaki BGSC 4D1 Isolate Bombycidae
117 8108568626 Enterococcus sp. DIV1094 Isolate
118 8108576847 Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 Isolate
119 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
120 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
121 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
122 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
123 3300005314 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut Metagenome Drosophilidae
124 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
125 3300007767 Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut Metagenome Drosophilidae
126 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
127 2684622913 Lactobacillus melliventris Lb_184 Isolate Unclassified
128 2758568513 Lactobacillus melliventris ESL0260 Isolate Unclassified
129 2758568558 Lactobacillus melliventris ESL0393 Isolate Unclassified
130 2820236043 Unclassified Firmicutes Th196P3bin97 Isolate Unclassified
131 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
132 2820396902 Unclassified Firmicutes Nc150P1bin3 Isolate Unclassified
133 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
134 2864801025 Bacillus aerius S00042 Isolate Elmidae
135 2877522083 Apilactobacillus bombintestini BHWM-4 Isolate Apidae
136 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
137 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
138 643886085 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
139 643886091 Bacillus thuringiensis sv. thuringiensis T01001 Isolate Pyralidae
140 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
141 8066797744 Apilactobacillus timberlakei HV_26 Isolate Halictidae
142 8077780672 Enterococcus sp. PLM3 Isolate Formicidae
143 3300002932 Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 Metagenome Formicidae
144 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
145 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
146 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
147 2558860143 Apilactobacillus kunkeei EFB6 Isolate Apidae
148 2563367190 Bacillus thuringiensis sv. aizawai Leapi01 Isolate Noctuidae
149 2595698197 Melissococcus plutonius H6 Isolate Apidae
150 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
151 2820688768 Unclassified Firmicutes Co191P1bin74 Isolate Unclassified
152 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
153 2851412233 Bombilactobacillus bombi BI-2.5 Isolate Apidae
154 2864895409 Bacillus aerius S00152 Isolate Elmidae
155 2873581347 Vagococcus hydrophili HDW17B Isolate Hydrophilidae
156 2916858470 Heyndrickxia oleronia Isolate Unclassified
157 2916873227 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
158 650716050 Melissococcus plutonius ATCC 35311 Isolate Unclassified
159 8007211731 Enterococcus larvae BWM-S5 Isolate Scarabaeidae
160 8022725327 Bacillus sp. SN10 Isolate Eresidae
161 8022781829 Bacillus sp. VKPM B-3276 Isolate Culicidae
162 8066790652 Apilactobacillus timberlakei HV_28 Isolate Halictidae
163 8066792404 Apilactobacillus timberlakei HV_04 Isolate Halictidae
164 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
165 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
166 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
167 2983866074 Paenibacillus polymyxa A18 Isolate Unclassified
168 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
169 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
170 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
171 8114544644 Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 Isolate
172 2209111004 Macrotermes natalensis queen gut microbiome Metagenome Termitidae
173 2590828839 Clostridium sp. 1 Isolate Termitidae
174 2595698193 Melissococcus plutonius B5 Isolate Apidae
175 2595698196 Melissococcus plutonius 49.3 Isolate Apidae
176 2808606958 Lactobacillus sp. ESL0449 v2 Isolate Unclassified
177 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
178 2820416776 Unclassified Firmicutes Lab288P3bin9 Isolate Unclassified
179 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
180 2851410423 Lactobacillus helsingborgensis ESL0183 Isolate Apidae
181 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
182 2852431164 Brevibacillus laterosporus BON707 Isolate Calliphoridae
183 2881375749 Vagococcus entomophilus DSM 24756 Isolate Vespidae
184 2912849059 Bacillus thuringiensis sv. berliner ATCC 10792 Isolate Pyralidae
185 2940218408 Enterococcus sp. PF1-24 Isolate Blattidae
186 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
187 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
188 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
189 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
190 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
191 8018754795 Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 Isolate
192 8038268975 Enterococcus mundtii EM01 Isolate Bombycidae
193 8066794103 Apilactobacillus timberlakei HV_25 Isolate Halictidae
194 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
195 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
196 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
197 3300005309 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut Metagenome Drosophilidae
198 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
199 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
200 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
201 3300021190 Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA Metatranscriptome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0562376_0011 3300056857 Bacteria 876793
2 Ga0415639_038900 3300038395 Bacteria 14036
3 Ga0466731_015631 3300042622 Bacteria 8704
4 Ga0466735_031061 3300042624 Bacteria 43379
5 Ga0123356_10372771 3300010049 Bacteria 1558
6 Ga0123353_11064283 3300010167 Unclassified 1079
7 Ga0123354_10060618 3300010882 Unclassified 5594
8 Ga0123354_10536242 3300010882 Bacteria 891
9 JGI24702J35022_10006814 3300002462 Bacteria 6579
10 Ga0063521_1000169 3300003973 Bacteria 49079
11 Ga0074309_1095184 3300005314 Bacteria 1786
12 Ga0466705_156178 3300042612 Unclassified 1100
13 Ga0466733_005099 3300042659 Bacteria 10815
14 Ga0562379_0102 3300056790 Bacteria 287611
15 Ga0562374_0683 3300057007 Bacteria 50941
16 Ga0466715_363656 3300042616 Bacteria 50544
17 Ga0466730_000126 3300042625 Unclassified 1030
18 Ga0466730_080698 3300042625 Unclassified 1773
19 Ga0466702_138864 3300042635 Bacteria 1168
20 Ga0466706_010623 3300042599 Bacteria 1800
21 Ga0466706_160545 3300042599 Bacteria 2250
22 Ga0123353_11008286 3300010167 Bacteria 1118
23 Ga0123353_12868692 3300010167 Bacteria 563
24 2227364150 2225789004 Unclassified 6071
25 2227580176 2225789004 Bacteria 13436
26 IMNBL1DRAFT_c0000007 3300000062 Bacteria 246638
27 IMNBL1DRAFT_c0004085 3300000062 Bacteria 8930
28 IMNBL1DRAFT_c0168930 3300000062 Unclassified 556
29 HBC_ctgsDRAFT_1038469 3300000333 Unclassified 1172
30 JGI24700J35501_10827005 3300002508 Unclassified 1746
31 Ga0530661_000004 3300056564 Bacteria 460556
32 Ga0562379_0035 3300056790 Bacteria 679259
33 Ga0562377_0616 3300056842 Unclassified 53929
34 Ga0562375_0005 3300056856 Bacteria 2472444
35 Ga0562375_0057 3300056856 Bacteria 447120
36 Ga0466693_361441 3300042592 Bacteria 3928
37 Ga0466691_174633 3300042593 Bacteria 1123
38 Ga0466711_052955 3300042615 Bacteria 7954
39 Ga0466729_281290 3300042621 Bacteria 5178
40 Ga0466707_054372 3300042601 Bacteria 91469
41 Ga0466713_154278 3300042602 Bacteria 86095
42 Ga0123355_11439613 3300009826 Bacteria 677
43 Ga0123356_11158493 3300010049 Bacteria 940
44 Ga0123353_12031651 3300010167 Bacteria 703
45 2211830538 2209111004 Bacteria 31842
46 2227466323 2225789004 Unclassified 5135
47 JGI24705J35276_12021416 3300002504 Unclassified 875
48 CVPL010L_1001209 3300002932 Unclassified 3977
49 Ga0562379_0031 3300056790 Bacteria 758933
50 Ga0562375_0015 3300056856 Bacteria 1028412
51 Ga0466691_151655 3300042593 Unclassified 11846
52 Ga0466711_412330 3300042615 Bacteria 1626
53 Ga0466715_091994 3300042616 Bacteria 112451
54 Ga0466728_192436 3300042620 Bacteria 7080
55 Ga0466731_425245 3300042622 Bacteria 4099
56 Ga0466702_466777 3300042635 Bacteria 51038
57 Ga0123355_10358249 3300009826 Bacteria 1924
58 Ga0123353_12566714 3300010167 Unclassified 604
59 Ga0160465_101210 3300012803 Bacteria 8046
60 Ga0160471_106690 3300012812 Unclassified 1432
61 2227182200 2225789004 Unclassified 1490
62 IMNBL1DRAFT_c0050793 3300000062 Bacteria 1311
63 Ga0068305_10267149 3300005083 Bacteria 757
64 Ga0074278_123814 3300005721 Unclassified 15442
65 Ga0466705_046986 3300042612 Bacteria 17682
66 Ga0562379_0058 3300056790 Bacteria 476404
67 Ga0562379_3108 3300056790 Unclassified 11838
68 Ga0222431_1015414 3300021190 Bacteria 824
69 Ga0466718_062476 3300042617 Bacteria 1103
70 Ga0466704_403328 3300042643 Bacteria 2576
71 Ga0466700_134353 3300042600 Bacteria 68384
72 Ga0466707_091730 3300042601 Bacteria 2720
73 2227499076 2225789004 Unclassified 3847
74 JGI24703J35330_11292378 3300002501 Bacteria 841
75 CVPL010L_1000104 3300002932 Bacteria 34619
76 Ga0072940_1213922 3300005200 Bacteria 2060
77 Ga0072940_1321666 3300005200 Bacteria 513
78 Ga0102739_1000002 3300007095 Bacteria 96752
79 Ga0562377_0023 3300056842 Bacteria 912125
80 Ga0562374_0008 3300057007 Bacteria 1999653
81 Ga0466699_259985 3300042597 Bacteria 1283
82 Ga0466703_329432 3300042636 Bacteria 28587
83 Ga0466724_19371 3300042649 Unclassified 3415
84 Ga0466700_249547 3300042600 Bacteria 19133
85 Ga0466714_155743 3300042603 Bacteria 1695
86 Ga0466722_048926 3300042609 Bacteria 8222
87 Ga0123356_11171012 3300010049 Bacteria 935
88 Ga0123353_13353927 3300010167 Unclassified 509
89 IMNBL1DRAFT_c0010097 3300000062 Unclassified 4569
90 IMNBL1DRAFT_c0024734 3300000062 Bacteria 2318
91 Ga0074300_1142101 3300005311 Bacteria 728
92 Ga0074278_117762 3300005721 Unclassified 839
93 Ga0466705_149243 3300042612 Bacteria 2977
94 Ga0562375_0417 3300056856 Bacteria 93360
95 Ga0562374_0693 3300057007 Bacteria 50414
96 Ga0466730_006569 3300042625 Bacteria 1511
97 Ga0466707_360743 3300042601 Bacteria 13441
98 Ga0123353_11296039 3300010167 Bacteria 946
99 JGI24700J35501_10838320 3300002508 Bacteria 1845
100 Ga0068305_10111197 3300005083 Unclassified 4436
101 Ga0102734_1000240 3300007129 Bacteria 17000
102 Ga0105553_1087582 3300007767 Unclassified 3776
103 Ga0562379_0060 3300056790 Bacteria 473002
104 Ga0562378_0039 3300056814 Bacteria 444185
105 Ga0562378_1725 3300056814 Unclassified 22010
106 Ga0466690_393441 3300042590 Bacteria 1093
107 Ga0123353_10291919 3300010167 Unclassified 2495
108 Ga0123353_11101263 3300010167 Bacteria 1054
109 Ga0123353_12625238 3300010167 Bacteria 595
110 HBC_ctgsDRAFT_1001474 3300000333 Bacteria 5149
111 Ga0068302_10079402 3300005071 Bacteria 10292
112 Ga0068305_10003979 3300005083 Bacteria 2532
113 Ga0074306_1123824 3300005309 Bacteria 844

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300005083 Ga0068305_10111197 Ga0068305_101111976 108
2 3300010167 Ga0123353_11008286 Ga0123353_110082861 110
3 3300042635 Ga0466702_138864 Ga0466702_138864_816_1151 111
4 3300009826 Ga0123355_10358249 Ga0123355_103582492 112
5 3300010882 Ga0123354_10536242 Ga0123354_105362421 114
6 3300042601 Ga0466707_091730 Ga0466707_091730_21_368 115
7 3300009826 Ga0123355_11439613 Ga0123355_114396132 116
8 3300010049 Ga0123356_10372771 Ga0123356_103727713 116
9 3300010049 Ga0123356_11171012 Ga0123356_111710122 116
10 3300010167 Ga0123353_11064283 Ga0123353_110642831 116
11 3300010167 Ga0123353_11296039 Ga0123353_112960392 116
12 3300010167 Ga0123353_12031651 Ga0123353_120316511 116
13 3300021190 Ga0222431_1015414 Ga0222431_10154142 116
14 3300042603 Ga0466714_155743 Ga0466714_155743_304_654 116
15 3300042612 Ga0466705_046986 Ga0466705_046986_6254_6604 116
16 iso_pr_bacteria 2820611732 2820613195 116
17 2225789004 2227182200 2227600404 117
18 3300010167 Ga0123353_10291919 Ga0123353_102919193 117
19 3300010167 Ga0123353_12868692 Ga0123353_128686921 117
20 3300042592 Ga0466693_361441 Ga0466693_361441_1055_1408 117
21 3300042600 Ga0466700_249547 Ga0466700_249547_18283_18636 117
22 3300042617 Ga0466718_062476 Ga0466718_062476_13_366 117
23 3300042622 Ga0466731_425245 Ga0466731_425245_3707_4060 117
24 3300042624 Ga0466735_031061 Ga0466735_031061_26550_26903 117
25 3300042635 Ga0466702_466777 Ga0466702_466777_39759_40112 117
26 3300042659 Ga0466733_005099 Ga0466733_005099_9000_9353 117
27 3300056790 Ga0562379_0031 Ga0562379_0031_249127_249480 117
28 iso_pr_bacteria 2820227065 2820227907 117
29 iso_pr_bacteria 2820238527 2820240427 117
30 iso_pr_bacteria 2820347164 2820347647 117
31 iso_pr_bacteria 2820396902 2820397176 117
32 iso_pr_bacteria 2820400448 2820400653 117
33 2225789004 2227364150 2227811643 118
34 2225789004 2227466323 2227905981 118
35 2225789004 2227499076 2227979582 118
36 2225789004 2227580176 2228131489 118
37 3300000062 IMNBL1DRAFT_c0004085 IMNBL1DRAFT_00040854 118
38 3300000062 IMNBL1DRAFT_c0024734 IMNBL1DRAFT_00247343 118
39 3300000333 HBC_ctgsDRAFT_1001474 HBC_ctgsDRAFT_10014745 118
40 3300002462 JGI24702J35022_10006814 JGI24702J35022_100068147 118
41 3300002504 JGI24705J35276_12021416 JGI24705J35276_120214161 118
42 3300005083 Ga0068305_10003979 Ga0068305_100039792 118
43 3300010167 Ga0123353_12566714 Ga0123353_125667142 118
44 3300010167 Ga0123353_12625238 Ga0123353_126252381 118
45 3300038395 Ga0415639_038900 Ga0415639_038900_9266_9622 118
46 3300042625 Ga0466730_080698 Ga0466730_080698_269_625 118
47 iso_pr_bacteria 2537562000 2539433949 118
48 iso_pr_bacteria 2558860143 2559000540 118
49 iso_pr_bacteria 2563367190 2565787076 118
50 iso_pr_bacteria 2645727721 2646684643 118
51 iso_pr_bacteria 2675903377 2677723356 118
52 iso_pr_bacteria 2684622911 2686073978 118
53 iso_pr_bacteria 2684622913 2686077555 118
54 iso_pr_bacteria 2684622914 2686079406 118
55 iso_pr_bacteria 2758568512 2760264084 118
56 iso_pr_bacteria 2758568513 2760265929 118
57 iso_pr_bacteria 2758568514 2760267938 118
58 iso_pr_bacteria 2758568515 2760269778 118
59 iso_pr_bacteria 2758568557 2760422808 118
60 iso_pr_bacteria 2758568558 2760424780 118
61 iso_pr_bacteria 2758568559 2760426051 118
62 iso_pr_bacteria 2758568560 2760427305 118
63 iso_pr_bacteria 2758568561 2760429376 118
64 iso_pr_bacteria 2808606958 2811757788 118
65 iso_pr_bacteria 2820688768 2820689469 118
66 iso_pr_bacteria 2822232166 2822235827 118
67 iso_pr_bacteria 2822450720 2822454370 118
68 iso_pr_bacteria 2851410423 2851411588 118
69 iso_pr_bacteria 2851412233 2851412616 118
70 iso_pr_bacteria 2864782175 2864783880 118
71 iso_pr_bacteria 2877513988 2877515244 118
72 iso_pr_bacteria 2877522083 2877522889 118
73 iso_pr_bacteria 2912849059 2912853768 118
74 iso_pr_bacteria 2916873227 2916879365 118
75 iso_pr_bacteria 2936628749 2936628810 118
76 iso_pr_bacteria 2956926959 2956928060 118
77 iso_pr_bacteria 2956928875 2956930442 118
78 iso_pr_bacteria 2956930723 2956932055 118
79 iso_pr_bacteria 2961515617 2961516750 118
80 iso_pr_bacteria 2969145278 2969147542 118
81 iso_pr_bacteria 2978778678 2978781973 118
82 iso_pr_bacteria 3004719924 3004720075 118
83 iso_pr_bacteria 643886085 644681952 118
84 iso_pr_bacteria 643886087 644669569 118
85 iso_pr_bacteria 643886090 644663515 118
86 iso_pr_bacteria 643886091 644650635 118
87 iso_pr_bacteria 8002304686 8002304905 118
88 iso_pr_bacteria 8017462664 8017463993 118
89 iso_pr_bacteria 8017536074 8017537409 118
90 iso_pr_bacteria 8022725327 8022727148 118
91 iso_pr_bacteria 8022781829 8022783650 118
92 iso_pr_bacteria 8061039349 8061044697 118
93 iso_pr_bacteria 8061045771 8061049489 118
94 iso_pr_bacteria 8061100935 8061104804 118
95 iso_pr_bacteria 8066790652 8066791784 118
96 iso_pr_bacteria 8066792404 8066793133 118
97 iso_pr_bacteria 8066794103 8066795477 118
98 iso_pr_bacteria 8066795793 8066796130 118
99 iso_pr_bacteria 8066797744 8066798481 118
100 iso_pr_bacteria 8066799369 8066800089 118
101 iso_pr_bacteria 8066802609 8066803021 118
102 2209111004 2211830538 2211865575 119
103 3300000062 IMNBL1DRAFT_c0000007 IMNBL1DRAFT_000000775 119
104 3300000062 IMNBL1DRAFT_c0010097 IMNBL1DRAFT_00100975 119
105 3300000062 IMNBL1DRAFT_c0050793 IMNBL1DRAFT_00507933 119
106 3300000062 IMNBL1DRAFT_c0168930 IMNBL1DRAFT_01689301 119
107 3300000333 HBC_ctgsDRAFT_1038469 HBC_ctgsDRAFT_10384692 119
108 3300002501 JGI24703J35330_11292378 JGI24703J35330_112923782 119
109 3300003973 Ga0063521_1000169 Ga0063521_100016949 119
110 3300005200 Ga0072940_1213922 Ga0072940_12139223 119
111 3300005721 Ga0074278_117762 Ga0074278_1177621 119
112 3300005721 Ga0074278_123814 Ga0074278_12381411 119
113 3300010049 Ga0123356_11158493 Ga0123356_111584931 119
114 3300042590 Ga0466690_393441 Ga0466690_393441_271_630 119
115 3300042593 Ga0466691_151655 Ga0466691_151655_11085_11444 119
116 3300042593 Ga0466691_174633 Ga0466691_174633_246_605 119
117 3300042599 Ga0466706_160545 Ga0466706_160545_223_582 119
118 3300042601 Ga0466707_054372 Ga0466707_054372_81904_82263 119
119 3300042601 Ga0466707_360743 Ga0466707_360743_9400_9759 119
120 3300042602 Ga0466713_154278 Ga0466713_154278_47892_48251 119
121 3300042609 Ga0466722_048926 Ga0466722_048926_1435_1794 119
122 3300042612 Ga0466705_149243 Ga0466705_149243_1706_2065 119
123 3300042612 Ga0466705_156178 Ga0466705_156178_327_686 119
124 3300042615 Ga0466711_412330 Ga0466711_412330_345_704 119
125 3300042616 Ga0466715_091994 Ga0466715_091994_63207_63566 119
126 3300042616 Ga0466715_363656 Ga0466715_363656_38305_38664 119
127 3300042620 Ga0466728_192436 Ga0466728_192436_1129_1488 119
128 3300042621 Ga0466729_281290 Ga0466729_281290_265_624 119
129 3300042625 Ga0466730_000126 Ga0466730_000126_160_519 119
130 3300042625 Ga0466730_006569 Ga0466730_006569_295_654 119
131 3300042649 Ga0466724_19371 Ga0466724_19371_1691_2050 119
132 3300056564 Ga0530661_000004 Ga0530661_000004_448751_449110 119
133 3300056790 Ga0562379_0060 Ga0562379_0060_208153_208512 119
134 3300056790 Ga0562379_0102 Ga0562379_0102_26367_26726 119
135 3300056814 Ga0562378_0039 Ga0562378_0039_409803_410162 119
136 3300056814 Ga0562378_1725 Ga0562378_1725_19360_19719 119
137 3300056842 Ga0562377_0023 Ga0562377_0023_693993_694352 119
138 3300056842 Ga0562377_0616 Ga0562377_0616_17417_17776 119
139 3300056856 Ga0562375_0005 Ga0562375_0005_356148_356507 119
140 3300056856 Ga0562375_0057 Ga0562375_0057_210125_210484 119
141 3300056856 Ga0562375_0417 Ga0562375_0417_68141_68500 119
142 3300056857 Ga0562376_0011 Ga0562376_0011_867476_867835 119
143 3300057007 Ga0562374_0008 Ga0562374_0008_1313946_1314305 119
144 3300057007 Ga0562374_0683 Ga0562374_0683_9153_9512 119
145 3300057007 Ga0562374_0693 Ga0562374_0693_46240_46599 119
146 iso_pr_bacteria 2523231078 2523496744 119
147 iso_pr_bacteria 2524614537 2524835469 119
148 iso_pr_bacteria 2551306396 2552921216 119
149 iso_pr_bacteria 2574180310 2576357906 119
150 iso_pr_bacteria 2576861701 2579269402 119
151 iso_pr_bacteria 2585428141 2588053257 119
152 iso_pr_bacteria 2590828839 2593251781 119
153 iso_pr_bacteria 2595698190 2596205588 119
154 iso_pr_bacteria 2595698193 2596210996 119
155 iso_pr_bacteria 2595698194 2596212748 119
156 iso_pr_bacteria 2595698195 2596214685 119
157 iso_pr_bacteria 2595698196 2596216499 119
158 iso_pr_bacteria 2595698197 2596218336 119
159 iso_pr_bacteria 2595698198 2596220167 119
160 iso_pr_bacteria 2595698199 2596221979 119
161 iso_pr_bacteria 2617270844 2617733624 119
162 iso_pr_bacteria 2627853628 2628280354 119
163 iso_pr_bacteria 2731957677 2732687997 119
164 iso_pr_bacteria 2740892556 2743949224 119
165 iso_pr_bacteria 2751185832 2753510412 119
166 iso_pr_bacteria 2767802234 2769331591 119
167 iso_pr_bacteria 2775507073 2777018746 119
168 iso_pr_bacteria 2791355481 2794424914 119
169 iso_pr_bacteria 2820236043 2820237593 119
170 iso_pr_bacteria 2820416776 2820417812 119
171 iso_pr_bacteria 2825804107 2825805359 119
172 iso_pr_bacteria 2836667214 2836671096 119
173 iso_pr_bacteria 2838140227 2838142720 119
174 iso_pr_bacteria 2843246524 2843247891 119
175 iso_pr_bacteria 2849099867 2849103978 119
176 iso_pr_bacteria 2849104611 2849105275 119
177 iso_pr_bacteria 2850695442 2850696964 119
178 iso_pr_bacteria 2850744690 2850748431 119
179 iso_pr_bacteria 2852123468 2852125926 119
180 iso_pr_bacteria 2852431164 2852431789 119
181 iso_pr_bacteria 2855361764 2855363806 119
182 iso_pr_bacteria 2864801025 2864803293 119
183 iso_pr_bacteria 2864816158 2864819490 119
184 iso_pr_bacteria 2864895409 2864897675 119
185 iso_pr_bacteria 2864909992 2864912964 119
186 iso_pr_bacteria 2873581347 2873583018 119
187 iso_pr_bacteria 2873584433 2873584667 119
188 iso_pr_bacteria 2878857142 2878859161 119
189 iso_pr_bacteria 2881375749 2881377778 119
190 iso_pr_bacteria 2890957088 2890960534 119
191 iso_pr_bacteria 2896843662 2896844362 119
192 iso_pr_bacteria 2900804455 2900805570 119
193 iso_pr_bacteria 2916858470 2916858967 119
194 iso_pr_bacteria 2940218408 2940218795 119
195 iso_pr_bacteria 2940261461 2940261849 119
196 iso_pr_bacteria 2971438493 2971440458 119
197 iso_pr_bacteria 2983866074 2983868172 119
198 iso_pr_bacteria 2997944163 2997944734 119
199 iso_pr_bacteria 647533136 647746647 119
200 iso_pr_bacteria 650716050 650844940 119
201 iso_pr_bacteria 8001918023 8001918410 119
202 iso_pr_bacteria 8002299145 8002300902 119
203 iso_pr_bacteria 8002519755 8002521266 119
204 iso_pr_bacteria 8007211731 8007214873 119
205 iso_pr_bacteria 8007215774 8007216039 119
206 iso_pr_bacteria 8007220153 8007220327 119
207 iso_pr_bacteria 8007223943 8007224654 119
208 iso_pr_bacteria 8007237282 8007239908 119
209 iso_pr_bacteria 8017489919 8017491888 119
210 iso_pr_bacteria 8018750880 8018753778 119
211 iso_pr_bacteria 8018754795 8018755194 119
212 iso_pr_bacteria 8018794549 8018797720 119
213 iso_pr_bacteria 8018798118 8018800526 119
214 iso_pr_bacteria 8018802046 8018802696 119
215 iso_pr_bacteria 8038268975 8038270360 119
216 iso_pr_bacteria 8043041867 8043042067 119
217 iso_pr_bacteria 8064008355 8064010121 119
218 iso_pr_bacteria 8077780672 8077781400 119
219 iso_pr_bacteria 8108568626 8108570127 119
220 iso_pr_bacteria 8108576847 8108578131 119
221 iso_pr_bacteria 8114537524 8114540477 119
222 iso_pr_bacteria 8114541043 8114542768 119
223 iso_pr_bacteria 8114544644 8114546374 119
224 iso_pr_bacteria 8114549044 8114550328 119
225 iso_pr_bacteria 8114555646 8114557147 119
226 3300002508 JGI24700J35501_10827005 JGI24700J35501_108270053 120
227 3300002932 CVPL010L_1000104 CVPL010L_100010410 120
228 3300002932 CVPL010L_1001209 CVPL010L_10012093 120
229 3300005071 Ga0068302_10079402 Ga0068302_100794024 120
230 3300005083 Ga0068305_10267149 Ga0068305_102671492 120
231 3300005200 Ga0072940_1321666 Ga0072940_13216662 120
232 3300005311 Ga0074300_1142101 Ga0074300_11421011 120
233 3300005314 Ga0074309_1095184 Ga0074309_10951841 120
234 3300007095 Ga0102739_1000002 Ga0102739_100000231 120
235 3300007129 Ga0102734_1000240 Ga0102734_100024017 120
236 3300007767 Ga0105553_1087582 Ga0105553_10875823 120
237 3300010167 Ga0123353_13353927 Ga0123353_133539272 120
238 3300010882 Ga0123354_10060618 Ga0123354_100606184 120
239 3300012803 Ga0160465_101210 Ga0160465_1012106 120
240 3300012812 Ga0160471_106690 Ga0160471_1066901 120
241 3300042599 Ga0466706_010623 Ga0466706_010623_118_480 120
242 3300042615 Ga0466711_052955 Ga0466711_052955_4917_5279 120
243 3300042636 Ga0466703_329432 Ga0466703_329432_9793_10155 120
244 3300042643 Ga0466704_403328 Ga0466704_403328_49_411 120
245 3300056790 Ga0562379_3108 Ga0562379_3108_2281_2643 120
246 iso_pr_bacteria 2905310146 2905310996 120
247 3300005309 Ga0074306_1123824 Ga0074306_11238241 121
248 3300010167 Ga0123353_11101263 Ga0123353_111012633 121
249 3300056790 Ga0562379_0035 Ga0562379_0035_102589_102954 121
250 3300056790 Ga0562379_0058 Ga0562379_0058_276156_276521 121
251 3300056856 Ga0562375_0015 Ga0562375_0015_279463_279828 121
252 3300002508 JGI24700J35501_10838320 JGI24700J35501_108383201 124
253 3300042622 Ga0466731_015631 Ga0466731_015631_2960_3340 126
254 3300042597 Ga0466699_259985 Ga0466699_259985_548_937 129
255 3300042600 Ga0466700_134353 Ga0466700_134353_3741_4154 137

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00453 Ribosomal_L20 Ribosomal protein L20 3 100 0.98

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.58 0.65 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.