Protein Family IF03372
Metagenome
Metatranscriptome
Isolate
255
Members
201
Samples
113
Scaffolds
118.59
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_11008286|Ga0123353_110082861
- Length
- 110 aa
- Sequence
- MARIKGGVNHKKKQNRVLKLAKGYRGARSKQYRVAKQSVMRALTSSYAGRLWIARINAAARMNGLSYSRLMHGLKLADINMNRKMLAELAVNDKDAFATLADLAKGKIA*
Sample Types
Isolate
55.7%
Metagenome
43.9%
MAG
0.0%
Metatranscriptome
0.4%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
23.5%
Apidae
16.6%
Termitidae
12.8%
Drosophilidae
5.3%
Scarabaeidae
4.8%
Halictidae
4.3%
Kalotermitidae
4.3%
Tenebrionidae
3.7%
Pyralidae
3.2%
Elmidae
2.7%
Formicidae
2.7%
Rhinotermitidae
1.6%
Bombycidae
1.6%
Passalidae
1.1%
Culicidae
1.1%
Termopsidae
1.1%
Noctuidae
1.1%
Blattidae
1.1%
Dytiscidae
0.5%
Gomphidae
0.5%
Nephropidae
0.5%
Ocypodidae
0.5%
Curculionidae
0.5%
Portunidae
0.5%
Cixiidae
0.5%
Euphausiidae
0.5%
Libellulidae
0.5%
Hydrophilidae
0.5%
Eresidae
0.5%
Calliphoridae
0.5%
Vespidae
0.5%
Hodotermitidae
0.5%
Taxonomy
Archaea
0
Bacteria
227
Eukaryota
0
Viruses
0
Unclassified
28
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 2 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 3 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 4 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 5 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 6 | 2820611732 | Unclassified Firmicutes Emb289P1bin19 | Isolate | Unclassified |
| 7 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 8 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 9 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 10 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 11 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 12 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 13 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 17 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 18 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 19 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 20 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 21 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 22 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 23 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 27 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 30 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 31 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 32 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 33 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 34 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 35 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 36 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 37 | 2838140227 | Dyella sp. OAE510 | Isolate | Unclassified |
| 38 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 39 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 40 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 41 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 42 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 43 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 44 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 45 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 46 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 47 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 48 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 49 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 50 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 51 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 52 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 53 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 54 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 55 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 56 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 57 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 58 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 59 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 60 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 61 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 62 | 2820400448 | Unclassified Firmicutes Nc150Mbin1 | Isolate | Unclassified |
| 63 | 2836667214 | Paenibacillus larvae larvae B-3650 | Isolate | Apidae |
| 64 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 65 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 66 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 67 | 2956928875 | Bombilactobacillus apium DCY120 | Isolate | Apidae |
| 68 | 643886087 | Bacillus thuringiensis sv. kurstaki T03a001 | Isolate | Pyralidae |
| 69 | 643886090 | Bacillus thuringiensis sv. pakistani t13001 | Isolate | Unclassified |
| 70 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 71 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 72 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 73 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 74 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 75 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 76 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 77 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 78 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 79 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 80 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 81 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 82 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 83 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 84 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 85 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 86 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 87 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 88 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 89 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 90 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 91 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 92 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 93 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 94 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 95 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 96 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 97 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 98 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 99 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 100 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 101 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 102 | 3300005311 | Drosophila gut microbial communities from New York, USA - Drosophila falleni male 1 gut | Metagenome | Drosophilidae |
| 103 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 104 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 105 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 106 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 107 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 108 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 109 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 110 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 111 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 112 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 113 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 114 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 115 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 116 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 117 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 118 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 119 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 120 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 121 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 122 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 123 | 3300005314 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 2 gut | Metagenome | Drosophilidae |
| 124 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 125 | 3300007767 | Drosophila gut microbial communities from New York, USA - Drosophila suzukii male 6 gut | Metagenome | Drosophilidae |
| 126 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 127 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 128 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 129 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 130 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 131 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 132 | 2820396902 | Unclassified Firmicutes Nc150P1bin3 | Isolate | Unclassified |
| 133 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 134 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 135 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 136 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 137 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 138 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 139 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 140 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 141 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 142 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 143 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 144 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 145 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 146 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 147 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 148 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 149 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 150 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 151 | 2820688768 | Unclassified Firmicutes Co191P1bin74 | Isolate | Unclassified |
| 152 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 153 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 154 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 155 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 156 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 157 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 158 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 159 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 160 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 161 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 162 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 163 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 164 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 165 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 166 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 167 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 168 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 169 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 170 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 171 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 172 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 173 | 2590828839 | Clostridium sp. 1 | Isolate | Termitidae |
| 174 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 175 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 176 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 177 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 178 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 179 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 180 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 181 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 182 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 183 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 184 | 2912849059 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 185 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 186 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 187 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 188 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 189 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 190 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 191 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 192 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 193 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 194 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 195 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 196 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 197 | 3300005309 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 1 gut | Metagenome | Drosophilidae |
| 198 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 199 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 200 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 201 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_0011 | 3300056857 | Bacteria | 876793 |
| 2 | Ga0415639_038900 | 3300038395 | Bacteria | 14036 |
| 3 | Ga0466731_015631 | 3300042622 | Bacteria | 8704 |
| 4 | Ga0466735_031061 | 3300042624 | Bacteria | 43379 |
| 5 | Ga0123356_10372771 | 3300010049 | Bacteria | 1558 |
| 6 | Ga0123353_11064283 | 3300010167 | Unclassified | 1079 |
| 7 | Ga0123354_10060618 | 3300010882 | Unclassified | 5594 |
| 8 | Ga0123354_10536242 | 3300010882 | Bacteria | 891 |
| 9 | JGI24702J35022_10006814 | 3300002462 | Bacteria | 6579 |
| 10 | Ga0063521_1000169 | 3300003973 | Bacteria | 49079 |
| 11 | Ga0074309_1095184 | 3300005314 | Bacteria | 1786 |
| 12 | Ga0466705_156178 | 3300042612 | Unclassified | 1100 |
| 13 | Ga0466733_005099 | 3300042659 | Bacteria | 10815 |
| 14 | Ga0562379_0102 | 3300056790 | Bacteria | 287611 |
| 15 | Ga0562374_0683 | 3300057007 | Bacteria | 50941 |
| 16 | Ga0466715_363656 | 3300042616 | Bacteria | 50544 |
| 17 | Ga0466730_000126 | 3300042625 | Unclassified | 1030 |
| 18 | Ga0466730_080698 | 3300042625 | Unclassified | 1773 |
| 19 | Ga0466702_138864 | 3300042635 | Bacteria | 1168 |
| 20 | Ga0466706_010623 | 3300042599 | Bacteria | 1800 |
| 21 | Ga0466706_160545 | 3300042599 | Bacteria | 2250 |
| 22 | Ga0123353_11008286 | 3300010167 | Bacteria | 1118 |
| 23 | Ga0123353_12868692 | 3300010167 | Bacteria | 563 |
| 24 | 2227364150 | 2225789004 | Unclassified | 6071 |
| 25 | 2227580176 | 2225789004 | Bacteria | 13436 |
| 26 | IMNBL1DRAFT_c0000007 | 3300000062 | Bacteria | 246638 |
| 27 | IMNBL1DRAFT_c0004085 | 3300000062 | Bacteria | 8930 |
| 28 | IMNBL1DRAFT_c0168930 | 3300000062 | Unclassified | 556 |
| 29 | HBC_ctgsDRAFT_1038469 | 3300000333 | Unclassified | 1172 |
| 30 | JGI24700J35501_10827005 | 3300002508 | Unclassified | 1746 |
| 31 | Ga0530661_000004 | 3300056564 | Bacteria | 460556 |
| 32 | Ga0562379_0035 | 3300056790 | Bacteria | 679259 |
| 33 | Ga0562377_0616 | 3300056842 | Unclassified | 53929 |
| 34 | Ga0562375_0005 | 3300056856 | Bacteria | 2472444 |
| 35 | Ga0562375_0057 | 3300056856 | Bacteria | 447120 |
| 36 | Ga0466693_361441 | 3300042592 | Bacteria | 3928 |
| 37 | Ga0466691_174633 | 3300042593 | Bacteria | 1123 |
| 38 | Ga0466711_052955 | 3300042615 | Bacteria | 7954 |
| 39 | Ga0466729_281290 | 3300042621 | Bacteria | 5178 |
| 40 | Ga0466707_054372 | 3300042601 | Bacteria | 91469 |
| 41 | Ga0466713_154278 | 3300042602 | Bacteria | 86095 |
| 42 | Ga0123355_11439613 | 3300009826 | Bacteria | 677 |
| 43 | Ga0123356_11158493 | 3300010049 | Bacteria | 940 |
| 44 | Ga0123353_12031651 | 3300010167 | Bacteria | 703 |
| 45 | 2211830538 | 2209111004 | Bacteria | 31842 |
| 46 | 2227466323 | 2225789004 | Unclassified | 5135 |
| 47 | JGI24705J35276_12021416 | 3300002504 | Unclassified | 875 |
| 48 | CVPL010L_1001209 | 3300002932 | Unclassified | 3977 |
| 49 | Ga0562379_0031 | 3300056790 | Bacteria | 758933 |
| 50 | Ga0562375_0015 | 3300056856 | Bacteria | 1028412 |
| 51 | Ga0466691_151655 | 3300042593 | Unclassified | 11846 |
| 52 | Ga0466711_412330 | 3300042615 | Bacteria | 1626 |
| 53 | Ga0466715_091994 | 3300042616 | Bacteria | 112451 |
| 54 | Ga0466728_192436 | 3300042620 | Bacteria | 7080 |
| 55 | Ga0466731_425245 | 3300042622 | Bacteria | 4099 |
| 56 | Ga0466702_466777 | 3300042635 | Bacteria | 51038 |
| 57 | Ga0123355_10358249 | 3300009826 | Bacteria | 1924 |
| 58 | Ga0123353_12566714 | 3300010167 | Unclassified | 604 |
| 59 | Ga0160465_101210 | 3300012803 | Bacteria | 8046 |
| 60 | Ga0160471_106690 | 3300012812 | Unclassified | 1432 |
| 61 | 2227182200 | 2225789004 | Unclassified | 1490 |
| 62 | IMNBL1DRAFT_c0050793 | 3300000062 | Bacteria | 1311 |
| 63 | Ga0068305_10267149 | 3300005083 | Bacteria | 757 |
| 64 | Ga0074278_123814 | 3300005721 | Unclassified | 15442 |
| 65 | Ga0466705_046986 | 3300042612 | Bacteria | 17682 |
| 66 | Ga0562379_0058 | 3300056790 | Bacteria | 476404 |
| 67 | Ga0562379_3108 | 3300056790 | Unclassified | 11838 |
| 68 | Ga0222431_1015414 | 3300021190 | Bacteria | 824 |
| 69 | Ga0466718_062476 | 3300042617 | Bacteria | 1103 |
| 70 | Ga0466704_403328 | 3300042643 | Bacteria | 2576 |
| 71 | Ga0466700_134353 | 3300042600 | Bacteria | 68384 |
| 72 | Ga0466707_091730 | 3300042601 | Bacteria | 2720 |
| 73 | 2227499076 | 2225789004 | Unclassified | 3847 |
| 74 | JGI24703J35330_11292378 | 3300002501 | Bacteria | 841 |
| 75 | CVPL010L_1000104 | 3300002932 | Bacteria | 34619 |
| 76 | Ga0072940_1213922 | 3300005200 | Bacteria | 2060 |
| 77 | Ga0072940_1321666 | 3300005200 | Bacteria | 513 |
| 78 | Ga0102739_1000002 | 3300007095 | Bacteria | 96752 |
| 79 | Ga0562377_0023 | 3300056842 | Bacteria | 912125 |
| 80 | Ga0562374_0008 | 3300057007 | Bacteria | 1999653 |
| 81 | Ga0466699_259985 | 3300042597 | Bacteria | 1283 |
| 82 | Ga0466703_329432 | 3300042636 | Bacteria | 28587 |
| 83 | Ga0466724_19371 | 3300042649 | Unclassified | 3415 |
| 84 | Ga0466700_249547 | 3300042600 | Bacteria | 19133 |
| 85 | Ga0466714_155743 | 3300042603 | Bacteria | 1695 |
| 86 | Ga0466722_048926 | 3300042609 | Bacteria | 8222 |
| 87 | Ga0123356_11171012 | 3300010049 | Bacteria | 935 |
| 88 | Ga0123353_13353927 | 3300010167 | Unclassified | 509 |
| 89 | IMNBL1DRAFT_c0010097 | 3300000062 | Unclassified | 4569 |
| 90 | IMNBL1DRAFT_c0024734 | 3300000062 | Bacteria | 2318 |
| 91 | Ga0074300_1142101 | 3300005311 | Bacteria | 728 |
| 92 | Ga0074278_117762 | 3300005721 | Unclassified | 839 |
| 93 | Ga0466705_149243 | 3300042612 | Bacteria | 2977 |
| 94 | Ga0562375_0417 | 3300056856 | Bacteria | 93360 |
| 95 | Ga0562374_0693 | 3300057007 | Bacteria | 50414 |
| 96 | Ga0466730_006569 | 3300042625 | Bacteria | 1511 |
| 97 | Ga0466707_360743 | 3300042601 | Bacteria | 13441 |
| 98 | Ga0123353_11296039 | 3300010167 | Bacteria | 946 |
| 99 | JGI24700J35501_10838320 | 3300002508 | Bacteria | 1845 |
| 100 | Ga0068305_10111197 | 3300005083 | Unclassified | 4436 |
| 101 | Ga0102734_1000240 | 3300007129 | Bacteria | 17000 |
| 102 | Ga0105553_1087582 | 3300007767 | Unclassified | 3776 |
| 103 | Ga0562379_0060 | 3300056790 | Bacteria | 473002 |
| 104 | Ga0562378_0039 | 3300056814 | Bacteria | 444185 |
| 105 | Ga0562378_1725 | 3300056814 | Unclassified | 22010 |
| 106 | Ga0466690_393441 | 3300042590 | Bacteria | 1093 |
| 107 | Ga0123353_10291919 | 3300010167 | Unclassified | 2495 |
| 108 | Ga0123353_11101263 | 3300010167 | Bacteria | 1054 |
| 109 | Ga0123353_12625238 | 3300010167 | Bacteria | 595 |
| 110 | HBC_ctgsDRAFT_1001474 | 3300000333 | Bacteria | 5149 |
| 111 | Ga0068302_10079402 | 3300005071 | Bacteria | 10292 |
| 112 | Ga0068305_10003979 | 3300005083 | Bacteria | 2532 |
| 113 | Ga0074306_1123824 | 3300005309 | Bacteria | 844 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300005083 | Ga0068305_10111197 | Ga0068305_101111976 | 108 |
| 2 | 3300010167 | Ga0123353_11008286 | Ga0123353_110082861 | 110 |
| 3 | 3300042635 | Ga0466702_138864 | Ga0466702_138864_816_1151 | 111 |
| 4 | 3300009826 | Ga0123355_10358249 | Ga0123355_103582492 | 112 |
| 5 | 3300010882 | Ga0123354_10536242 | Ga0123354_105362421 | 114 |
| 6 | 3300042601 | Ga0466707_091730 | Ga0466707_091730_21_368 | 115 |
| 7 | 3300009826 | Ga0123355_11439613 | Ga0123355_114396132 | 116 |
| 8 | 3300010049 | Ga0123356_10372771 | Ga0123356_103727713 | 116 |
| 9 | 3300010049 | Ga0123356_11171012 | Ga0123356_111710122 | 116 |
| 10 | 3300010167 | Ga0123353_11064283 | Ga0123353_110642831 | 116 |
| 11 | 3300010167 | Ga0123353_11296039 | Ga0123353_112960392 | 116 |
| 12 | 3300010167 | Ga0123353_12031651 | Ga0123353_120316511 | 116 |
| 13 | 3300021190 | Ga0222431_1015414 | Ga0222431_10154142 | 116 |
| 14 | 3300042603 | Ga0466714_155743 | Ga0466714_155743_304_654 | 116 |
| 15 | 3300042612 | Ga0466705_046986 | Ga0466705_046986_6254_6604 | 116 |
| 16 | iso_pr_bacteria | 2820611732 | 2820613195 | 116 |
| 17 | 2225789004 | 2227182200 | 2227600404 | 117 |
| 18 | 3300010167 | Ga0123353_10291919 | Ga0123353_102919193 | 117 |
| 19 | 3300010167 | Ga0123353_12868692 | Ga0123353_128686921 | 117 |
| 20 | 3300042592 | Ga0466693_361441 | Ga0466693_361441_1055_1408 | 117 |
| 21 | 3300042600 | Ga0466700_249547 | Ga0466700_249547_18283_18636 | 117 |
| 22 | 3300042617 | Ga0466718_062476 | Ga0466718_062476_13_366 | 117 |
| 23 | 3300042622 | Ga0466731_425245 | Ga0466731_425245_3707_4060 | 117 |
| 24 | 3300042624 | Ga0466735_031061 | Ga0466735_031061_26550_26903 | 117 |
| 25 | 3300042635 | Ga0466702_466777 | Ga0466702_466777_39759_40112 | 117 |
| 26 | 3300042659 | Ga0466733_005099 | Ga0466733_005099_9000_9353 | 117 |
| 27 | 3300056790 | Ga0562379_0031 | Ga0562379_0031_249127_249480 | 117 |
| 28 | iso_pr_bacteria | 2820227065 | 2820227907 | 117 |
| 29 | iso_pr_bacteria | 2820238527 | 2820240427 | 117 |
| 30 | iso_pr_bacteria | 2820347164 | 2820347647 | 117 |
| 31 | iso_pr_bacteria | 2820396902 | 2820397176 | 117 |
| 32 | iso_pr_bacteria | 2820400448 | 2820400653 | 117 |
| 33 | 2225789004 | 2227364150 | 2227811643 | 118 |
| 34 | 2225789004 | 2227466323 | 2227905981 | 118 |
| 35 | 2225789004 | 2227499076 | 2227979582 | 118 |
| 36 | 2225789004 | 2227580176 | 2228131489 | 118 |
| 37 | 3300000062 | IMNBL1DRAFT_c0004085 | IMNBL1DRAFT_00040854 | 118 |
| 38 | 3300000062 | IMNBL1DRAFT_c0024734 | IMNBL1DRAFT_00247343 | 118 |
| 39 | 3300000333 | HBC_ctgsDRAFT_1001474 | HBC_ctgsDRAFT_10014745 | 118 |
| 40 | 3300002462 | JGI24702J35022_10006814 | JGI24702J35022_100068147 | 118 |
| 41 | 3300002504 | JGI24705J35276_12021416 | JGI24705J35276_120214161 | 118 |
| 42 | 3300005083 | Ga0068305_10003979 | Ga0068305_100039792 | 118 |
| 43 | 3300010167 | Ga0123353_12566714 | Ga0123353_125667142 | 118 |
| 44 | 3300010167 | Ga0123353_12625238 | Ga0123353_126252381 | 118 |
| 45 | 3300038395 | Ga0415639_038900 | Ga0415639_038900_9266_9622 | 118 |
| 46 | 3300042625 | Ga0466730_080698 | Ga0466730_080698_269_625 | 118 |
| 47 | iso_pr_bacteria | 2537562000 | 2539433949 | 118 |
| 48 | iso_pr_bacteria | 2558860143 | 2559000540 | 118 |
| 49 | iso_pr_bacteria | 2563367190 | 2565787076 | 118 |
| 50 | iso_pr_bacteria | 2645727721 | 2646684643 | 118 |
| 51 | iso_pr_bacteria | 2675903377 | 2677723356 | 118 |
| 52 | iso_pr_bacteria | 2684622911 | 2686073978 | 118 |
| 53 | iso_pr_bacteria | 2684622913 | 2686077555 | 118 |
| 54 | iso_pr_bacteria | 2684622914 | 2686079406 | 118 |
| 55 | iso_pr_bacteria | 2758568512 | 2760264084 | 118 |
| 56 | iso_pr_bacteria | 2758568513 | 2760265929 | 118 |
| 57 | iso_pr_bacteria | 2758568514 | 2760267938 | 118 |
| 58 | iso_pr_bacteria | 2758568515 | 2760269778 | 118 |
| 59 | iso_pr_bacteria | 2758568557 | 2760422808 | 118 |
| 60 | iso_pr_bacteria | 2758568558 | 2760424780 | 118 |
| 61 | iso_pr_bacteria | 2758568559 | 2760426051 | 118 |
| 62 | iso_pr_bacteria | 2758568560 | 2760427305 | 118 |
| 63 | iso_pr_bacteria | 2758568561 | 2760429376 | 118 |
| 64 | iso_pr_bacteria | 2808606958 | 2811757788 | 118 |
| 65 | iso_pr_bacteria | 2820688768 | 2820689469 | 118 |
| 66 | iso_pr_bacteria | 2822232166 | 2822235827 | 118 |
| 67 | iso_pr_bacteria | 2822450720 | 2822454370 | 118 |
| 68 | iso_pr_bacteria | 2851410423 | 2851411588 | 118 |
| 69 | iso_pr_bacteria | 2851412233 | 2851412616 | 118 |
| 70 | iso_pr_bacteria | 2864782175 | 2864783880 | 118 |
| 71 | iso_pr_bacteria | 2877513988 | 2877515244 | 118 |
| 72 | iso_pr_bacteria | 2877522083 | 2877522889 | 118 |
| 73 | iso_pr_bacteria | 2912849059 | 2912853768 | 118 |
| 74 | iso_pr_bacteria | 2916873227 | 2916879365 | 118 |
| 75 | iso_pr_bacteria | 2936628749 | 2936628810 | 118 |
| 76 | iso_pr_bacteria | 2956926959 | 2956928060 | 118 |
| 77 | iso_pr_bacteria | 2956928875 | 2956930442 | 118 |
| 78 | iso_pr_bacteria | 2956930723 | 2956932055 | 118 |
| 79 | iso_pr_bacteria | 2961515617 | 2961516750 | 118 |
| 80 | iso_pr_bacteria | 2969145278 | 2969147542 | 118 |
| 81 | iso_pr_bacteria | 2978778678 | 2978781973 | 118 |
| 82 | iso_pr_bacteria | 3004719924 | 3004720075 | 118 |
| 83 | iso_pr_bacteria | 643886085 | 644681952 | 118 |
| 84 | iso_pr_bacteria | 643886087 | 644669569 | 118 |
| 85 | iso_pr_bacteria | 643886090 | 644663515 | 118 |
| 86 | iso_pr_bacteria | 643886091 | 644650635 | 118 |
| 87 | iso_pr_bacteria | 8002304686 | 8002304905 | 118 |
| 88 | iso_pr_bacteria | 8017462664 | 8017463993 | 118 |
| 89 | iso_pr_bacteria | 8017536074 | 8017537409 | 118 |
| 90 | iso_pr_bacteria | 8022725327 | 8022727148 | 118 |
| 91 | iso_pr_bacteria | 8022781829 | 8022783650 | 118 |
| 92 | iso_pr_bacteria | 8061039349 | 8061044697 | 118 |
| 93 | iso_pr_bacteria | 8061045771 | 8061049489 | 118 |
| 94 | iso_pr_bacteria | 8061100935 | 8061104804 | 118 |
| 95 | iso_pr_bacteria | 8066790652 | 8066791784 | 118 |
| 96 | iso_pr_bacteria | 8066792404 | 8066793133 | 118 |
| 97 | iso_pr_bacteria | 8066794103 | 8066795477 | 118 |
| 98 | iso_pr_bacteria | 8066795793 | 8066796130 | 118 |
| 99 | iso_pr_bacteria | 8066797744 | 8066798481 | 118 |
| 100 | iso_pr_bacteria | 8066799369 | 8066800089 | 118 |
| 101 | iso_pr_bacteria | 8066802609 | 8066803021 | 118 |
| 102 | 2209111004 | 2211830538 | 2211865575 | 119 |
| 103 | 3300000062 | IMNBL1DRAFT_c0000007 | IMNBL1DRAFT_000000775 | 119 |
| 104 | 3300000062 | IMNBL1DRAFT_c0010097 | IMNBL1DRAFT_00100975 | 119 |
| 105 | 3300000062 | IMNBL1DRAFT_c0050793 | IMNBL1DRAFT_00507933 | 119 |
| 106 | 3300000062 | IMNBL1DRAFT_c0168930 | IMNBL1DRAFT_01689301 | 119 |
| 107 | 3300000333 | HBC_ctgsDRAFT_1038469 | HBC_ctgsDRAFT_10384692 | 119 |
| 108 | 3300002501 | JGI24703J35330_11292378 | JGI24703J35330_112923782 | 119 |
| 109 | 3300003973 | Ga0063521_1000169 | Ga0063521_100016949 | 119 |
| 110 | 3300005200 | Ga0072940_1213922 | Ga0072940_12139223 | 119 |
| 111 | 3300005721 | Ga0074278_117762 | Ga0074278_1177621 | 119 |
| 112 | 3300005721 | Ga0074278_123814 | Ga0074278_12381411 | 119 |
| 113 | 3300010049 | Ga0123356_11158493 | Ga0123356_111584931 | 119 |
| 114 | 3300042590 | Ga0466690_393441 | Ga0466690_393441_271_630 | 119 |
| 115 | 3300042593 | Ga0466691_151655 | Ga0466691_151655_11085_11444 | 119 |
| 116 | 3300042593 | Ga0466691_174633 | Ga0466691_174633_246_605 | 119 |
| 117 | 3300042599 | Ga0466706_160545 | Ga0466706_160545_223_582 | 119 |
| 118 | 3300042601 | Ga0466707_054372 | Ga0466707_054372_81904_82263 | 119 |
| 119 | 3300042601 | Ga0466707_360743 | Ga0466707_360743_9400_9759 | 119 |
| 120 | 3300042602 | Ga0466713_154278 | Ga0466713_154278_47892_48251 | 119 |
| 121 | 3300042609 | Ga0466722_048926 | Ga0466722_048926_1435_1794 | 119 |
| 122 | 3300042612 | Ga0466705_149243 | Ga0466705_149243_1706_2065 | 119 |
| 123 | 3300042612 | Ga0466705_156178 | Ga0466705_156178_327_686 | 119 |
| 124 | 3300042615 | Ga0466711_412330 | Ga0466711_412330_345_704 | 119 |
| 125 | 3300042616 | Ga0466715_091994 | Ga0466715_091994_63207_63566 | 119 |
| 126 | 3300042616 | Ga0466715_363656 | Ga0466715_363656_38305_38664 | 119 |
| 127 | 3300042620 | Ga0466728_192436 | Ga0466728_192436_1129_1488 | 119 |
| 128 | 3300042621 | Ga0466729_281290 | Ga0466729_281290_265_624 | 119 |
| 129 | 3300042625 | Ga0466730_000126 | Ga0466730_000126_160_519 | 119 |
| 130 | 3300042625 | Ga0466730_006569 | Ga0466730_006569_295_654 | 119 |
| 131 | 3300042649 | Ga0466724_19371 | Ga0466724_19371_1691_2050 | 119 |
| 132 | 3300056564 | Ga0530661_000004 | Ga0530661_000004_448751_449110 | 119 |
| 133 | 3300056790 | Ga0562379_0060 | Ga0562379_0060_208153_208512 | 119 |
| 134 | 3300056790 | Ga0562379_0102 | Ga0562379_0102_26367_26726 | 119 |
| 135 | 3300056814 | Ga0562378_0039 | Ga0562378_0039_409803_410162 | 119 |
| 136 | 3300056814 | Ga0562378_1725 | Ga0562378_1725_19360_19719 | 119 |
| 137 | 3300056842 | Ga0562377_0023 | Ga0562377_0023_693993_694352 | 119 |
| 138 | 3300056842 | Ga0562377_0616 | Ga0562377_0616_17417_17776 | 119 |
| 139 | 3300056856 | Ga0562375_0005 | Ga0562375_0005_356148_356507 | 119 |
| 140 | 3300056856 | Ga0562375_0057 | Ga0562375_0057_210125_210484 | 119 |
| 141 | 3300056856 | Ga0562375_0417 | Ga0562375_0417_68141_68500 | 119 |
| 142 | 3300056857 | Ga0562376_0011 | Ga0562376_0011_867476_867835 | 119 |
| 143 | 3300057007 | Ga0562374_0008 | Ga0562374_0008_1313946_1314305 | 119 |
| 144 | 3300057007 | Ga0562374_0683 | Ga0562374_0683_9153_9512 | 119 |
| 145 | 3300057007 | Ga0562374_0693 | Ga0562374_0693_46240_46599 | 119 |
| 146 | iso_pr_bacteria | 2523231078 | 2523496744 | 119 |
| 147 | iso_pr_bacteria | 2524614537 | 2524835469 | 119 |
| 148 | iso_pr_bacteria | 2551306396 | 2552921216 | 119 |
| 149 | iso_pr_bacteria | 2574180310 | 2576357906 | 119 |
| 150 | iso_pr_bacteria | 2576861701 | 2579269402 | 119 |
| 151 | iso_pr_bacteria | 2585428141 | 2588053257 | 119 |
| 152 | iso_pr_bacteria | 2590828839 | 2593251781 | 119 |
| 153 | iso_pr_bacteria | 2595698190 | 2596205588 | 119 |
| 154 | iso_pr_bacteria | 2595698193 | 2596210996 | 119 |
| 155 | iso_pr_bacteria | 2595698194 | 2596212748 | 119 |
| 156 | iso_pr_bacteria | 2595698195 | 2596214685 | 119 |
| 157 | iso_pr_bacteria | 2595698196 | 2596216499 | 119 |
| 158 | iso_pr_bacteria | 2595698197 | 2596218336 | 119 |
| 159 | iso_pr_bacteria | 2595698198 | 2596220167 | 119 |
| 160 | iso_pr_bacteria | 2595698199 | 2596221979 | 119 |
| 161 | iso_pr_bacteria | 2617270844 | 2617733624 | 119 |
| 162 | iso_pr_bacteria | 2627853628 | 2628280354 | 119 |
| 163 | iso_pr_bacteria | 2731957677 | 2732687997 | 119 |
| 164 | iso_pr_bacteria | 2740892556 | 2743949224 | 119 |
| 165 | iso_pr_bacteria | 2751185832 | 2753510412 | 119 |
| 166 | iso_pr_bacteria | 2767802234 | 2769331591 | 119 |
| 167 | iso_pr_bacteria | 2775507073 | 2777018746 | 119 |
| 168 | iso_pr_bacteria | 2791355481 | 2794424914 | 119 |
| 169 | iso_pr_bacteria | 2820236043 | 2820237593 | 119 |
| 170 | iso_pr_bacteria | 2820416776 | 2820417812 | 119 |
| 171 | iso_pr_bacteria | 2825804107 | 2825805359 | 119 |
| 172 | iso_pr_bacteria | 2836667214 | 2836671096 | 119 |
| 173 | iso_pr_bacteria | 2838140227 | 2838142720 | 119 |
| 174 | iso_pr_bacteria | 2843246524 | 2843247891 | 119 |
| 175 | iso_pr_bacteria | 2849099867 | 2849103978 | 119 |
| 176 | iso_pr_bacteria | 2849104611 | 2849105275 | 119 |
| 177 | iso_pr_bacteria | 2850695442 | 2850696964 | 119 |
| 178 | iso_pr_bacteria | 2850744690 | 2850748431 | 119 |
| 179 | iso_pr_bacteria | 2852123468 | 2852125926 | 119 |
| 180 | iso_pr_bacteria | 2852431164 | 2852431789 | 119 |
| 181 | iso_pr_bacteria | 2855361764 | 2855363806 | 119 |
| 182 | iso_pr_bacteria | 2864801025 | 2864803293 | 119 |
| 183 | iso_pr_bacteria | 2864816158 | 2864819490 | 119 |
| 184 | iso_pr_bacteria | 2864895409 | 2864897675 | 119 |
| 185 | iso_pr_bacteria | 2864909992 | 2864912964 | 119 |
| 186 | iso_pr_bacteria | 2873581347 | 2873583018 | 119 |
| 187 | iso_pr_bacteria | 2873584433 | 2873584667 | 119 |
| 188 | iso_pr_bacteria | 2878857142 | 2878859161 | 119 |
| 189 | iso_pr_bacteria | 2881375749 | 2881377778 | 119 |
| 190 | iso_pr_bacteria | 2890957088 | 2890960534 | 119 |
| 191 | iso_pr_bacteria | 2896843662 | 2896844362 | 119 |
| 192 | iso_pr_bacteria | 2900804455 | 2900805570 | 119 |
| 193 | iso_pr_bacteria | 2916858470 | 2916858967 | 119 |
| 194 | iso_pr_bacteria | 2940218408 | 2940218795 | 119 |
| 195 | iso_pr_bacteria | 2940261461 | 2940261849 | 119 |
| 196 | iso_pr_bacteria | 2971438493 | 2971440458 | 119 |
| 197 | iso_pr_bacteria | 2983866074 | 2983868172 | 119 |
| 198 | iso_pr_bacteria | 2997944163 | 2997944734 | 119 |
| 199 | iso_pr_bacteria | 647533136 | 647746647 | 119 |
| 200 | iso_pr_bacteria | 650716050 | 650844940 | 119 |
| 201 | iso_pr_bacteria | 8001918023 | 8001918410 | 119 |
| 202 | iso_pr_bacteria | 8002299145 | 8002300902 | 119 |
| 203 | iso_pr_bacteria | 8002519755 | 8002521266 | 119 |
| 204 | iso_pr_bacteria | 8007211731 | 8007214873 | 119 |
| 205 | iso_pr_bacteria | 8007215774 | 8007216039 | 119 |
| 206 | iso_pr_bacteria | 8007220153 | 8007220327 | 119 |
| 207 | iso_pr_bacteria | 8007223943 | 8007224654 | 119 |
| 208 | iso_pr_bacteria | 8007237282 | 8007239908 | 119 |
| 209 | iso_pr_bacteria | 8017489919 | 8017491888 | 119 |
| 210 | iso_pr_bacteria | 8018750880 | 8018753778 | 119 |
| 211 | iso_pr_bacteria | 8018754795 | 8018755194 | 119 |
| 212 | iso_pr_bacteria | 8018794549 | 8018797720 | 119 |
| 213 | iso_pr_bacteria | 8018798118 | 8018800526 | 119 |
| 214 | iso_pr_bacteria | 8018802046 | 8018802696 | 119 |
| 215 | iso_pr_bacteria | 8038268975 | 8038270360 | 119 |
| 216 | iso_pr_bacteria | 8043041867 | 8043042067 | 119 |
| 217 | iso_pr_bacteria | 8064008355 | 8064010121 | 119 |
| 218 | iso_pr_bacteria | 8077780672 | 8077781400 | 119 |
| 219 | iso_pr_bacteria | 8108568626 | 8108570127 | 119 |
| 220 | iso_pr_bacteria | 8108576847 | 8108578131 | 119 |
| 221 | iso_pr_bacteria | 8114537524 | 8114540477 | 119 |
| 222 | iso_pr_bacteria | 8114541043 | 8114542768 | 119 |
| 223 | iso_pr_bacteria | 8114544644 | 8114546374 | 119 |
| 224 | iso_pr_bacteria | 8114549044 | 8114550328 | 119 |
| 225 | iso_pr_bacteria | 8114555646 | 8114557147 | 119 |
| 226 | 3300002508 | JGI24700J35501_10827005 | JGI24700J35501_108270053 | 120 |
| 227 | 3300002932 | CVPL010L_1000104 | CVPL010L_100010410 | 120 |
| 228 | 3300002932 | CVPL010L_1001209 | CVPL010L_10012093 | 120 |
| 229 | 3300005071 | Ga0068302_10079402 | Ga0068302_100794024 | 120 |
| 230 | 3300005083 | Ga0068305_10267149 | Ga0068305_102671492 | 120 |
| 231 | 3300005200 | Ga0072940_1321666 | Ga0072940_13216662 | 120 |
| 232 | 3300005311 | Ga0074300_1142101 | Ga0074300_11421011 | 120 |
| 233 | 3300005314 | Ga0074309_1095184 | Ga0074309_10951841 | 120 |
| 234 | 3300007095 | Ga0102739_1000002 | Ga0102739_100000231 | 120 |
| 235 | 3300007129 | Ga0102734_1000240 | Ga0102734_100024017 | 120 |
| 236 | 3300007767 | Ga0105553_1087582 | Ga0105553_10875823 | 120 |
| 237 | 3300010167 | Ga0123353_13353927 | Ga0123353_133539272 | 120 |
| 238 | 3300010882 | Ga0123354_10060618 | Ga0123354_100606184 | 120 |
| 239 | 3300012803 | Ga0160465_101210 | Ga0160465_1012106 | 120 |
| 240 | 3300012812 | Ga0160471_106690 | Ga0160471_1066901 | 120 |
| 241 | 3300042599 | Ga0466706_010623 | Ga0466706_010623_118_480 | 120 |
| 242 | 3300042615 | Ga0466711_052955 | Ga0466711_052955_4917_5279 | 120 |
| 243 | 3300042636 | Ga0466703_329432 | Ga0466703_329432_9793_10155 | 120 |
| 244 | 3300042643 | Ga0466704_403328 | Ga0466704_403328_49_411 | 120 |
| 245 | 3300056790 | Ga0562379_3108 | Ga0562379_3108_2281_2643 | 120 |
| 246 | iso_pr_bacteria | 2905310146 | 2905310996 | 120 |
| 247 | 3300005309 | Ga0074306_1123824 | Ga0074306_11238241 | 121 |
| 248 | 3300010167 | Ga0123353_11101263 | Ga0123353_111012633 | 121 |
| 249 | 3300056790 | Ga0562379_0035 | Ga0562379_0035_102589_102954 | 121 |
| 250 | 3300056790 | Ga0562379_0058 | Ga0562379_0058_276156_276521 | 121 |
| 251 | 3300056856 | Ga0562375_0015 | Ga0562375_0015_279463_279828 | 121 |
| 252 | 3300002508 | JGI24700J35501_10838320 | JGI24700J35501_108383201 | 124 |
| 253 | 3300042622 | Ga0466731_015631 | Ga0466731_015631_2960_3340 | 126 |
| 254 | 3300042597 | Ga0466699_259985 | Ga0466699_259985_548_937 | 129 |
| 255 | 3300042600 | Ga0466700_134353 | Ga0466700_134353_3741_4154 | 137 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00453 | Ribosomal_L20 | Ribosomal protein L20 | 3 | 100 | 0.98 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.58 | 0.65 | Medium |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.