Protein Family IF03365
Metagenome
Isolate
153
Members
42
Samples
143
Scaffolds
199.35
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10921212|Ga0123353_109212122
- Length
- 223 aa
- Sequence
- MELLKECIMPTQGNKTKRRNTQMPKLLFQGHGSYRLSANDGRIIYVDPYKGKGYDAPADIILVTHQHSDHNQVKRCAQKPDCLIITNEEALAGGQHNCFDIDGITIQAVEAMNKNHDPKHCVGYIITIDGVKVYASGDTSRTKQMETFVSLGLDYALFPGDGLFNMGPDEASECARLIGAKHNILIHLKPGESIRKKGDKWDAPNKLIVEPGQEINLNKAVC*
Sample Types
Isolate
6.5%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
65.9%
Unclassified
24.4%
Kalotermitidae
7.3%
Termopsidae
2.4%
Taxonomy
Archaea
12
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 10 | 2820271343 | Unclassified Firmicutes Th196P3bin32 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 13 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 14 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 15 | 2820362221 | Unclassified Firmicutes Nt197P3bin116 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 18 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 24 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 2820275298 | Unclassified Firmicutes Th196P3bin17 | Isolate | Unclassified |
| 29 | 2820333861 | Unclassified Firmicutes Nt197P3bin72 | Isolate | Unclassified |
| 30 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 31 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 38 | 2820432912 | Unclassified Firmicutes Lab288P3bin219 | Isolate | Unclassified |
| 39 | 2820530790 | Unclassified Firmicutes Lab288P1bin141 | Isolate | Unclassified |
| 40 | 2820924633 | Unclassified Actinobacteria Emb289P3bin142 | Isolate | Unclassified |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_250431 | 3300042611 | Archaea | 1255 |
| 2 | Ga0415639_135813 | 3300038395 | Archaea | 1057 |
| 3 | Ga0466656_322854 | 3300042550 | Bacteria | 3003 |
| 4 | Ga0466693_004737 | 3300042592 | Archaea | 1895 |
| 5 | Ga0466710_243639 | 3300042613 | Unclassified | 1051 |
| 6 | Ga0466726_005077 | 3300042619 | Bacteria | 7133 |
| 7 | JGI24705J35276_12217263 | 3300002504 | Bacteria | 2085 |
| 8 | JGI24696J40584_12921936 | 3300002834 | Bacteria | 1359 |
| 9 | Ga0123356_10012951 | 3300010049 | Bacteria | 8071 |
| 10 | Ga0123356_10025019 | 3300010049 | Bacteria | 5611 |
| 11 | Ga0123356_10139761 | 3300010049 | Bacteria | 2388 |
| 12 | Ga0123356_10178558 | 3300010049 | Bacteria | 2142 |
| 13 | Ga0123356_10695718 | 3300010049 | Bacteria | 1185 |
| 14 | Ga0123353_10000176 | 3300010167 | Bacteria | 81312 |
| 15 | Ga0123353_10095477 | 3300010167 | Bacteria | 4790 |
| 16 | Ga0123353_10213261 | 3300010167 | Bacteria | 3026 |
| 17 | Ga0123353_10302938 | 3300010167 | Unclassified | 2438 |
| 18 | Ga0123353_10474053 | 3300010167 | Bacteria | 1834 |
| 19 | Ga0123353_10701698 | 3300010167 | Unclassified | 1420 |
| 20 | Ga0123353_10973750 | 3300010167 | Unclassified | 1144 |
| 21 | Ga0123353_11334181 | 3300010167 | Unclassified | 928 |
| 22 | Ga0123353_11918203 | 3300010167 | Unclassified | 730 |
| 23 | Ga0466731_262657 | 3300042622 | Bacteria | 6159 |
| 24 | Ga0466734_134607 | 3300042623 | Bacteria | 1999 |
| 25 | Ga0466702_317944 | 3300042635 | Unclassified | 1499 |
| 26 | Ga0466710_081842 | 3300042613 | Bacteria | 1491 |
| 27 | JGI24702J35022_10181851 | 3300002462 | Bacteria | 1195 |
| 28 | Ga0123356_10009976 | 3300010049 | Bacteria | 9350 |
| 29 | Ga0123356_10089295 | 3300010049 | Bacteria | 2932 |
| 30 | Ga0123356_10101269 | 3300010049 | Bacteria | 2763 |
| 31 | Ga0123356_10171640 | 3300010049 | Bacteria | 2180 |
| 32 | Ga0123356_10442824 | 3300010049 | Bacteria | 1446 |
| 33 | Ga0123353_10251424 | 3300010167 | Unclassified | 2737 |
| 34 | Ga0123353_10369460 | 3300010167 | Archaea | 2151 |
| 35 | Ga0123353_10921212 | 3300010167 | Bacteria | 1187 |
| 36 | Ga0466701_057355 | 3300042598 | Unclassified | 1036 |
| 37 | Ga0466714_027956 | 3300042603 | Bacteria | 1311 |
| 38 | Ga0466734_075332 | 3300042623 | Bacteria | 1740 |
| 39 | Ga0466725_222418 | 3300042654 | Bacteria | 2700 |
| 40 | Ga0415639_111739 | 3300038395 | Bacteria | 5488 |
| 41 | Ga0466657_399369 | 3300042582 | Unclassified | 1433 |
| 42 | JGI24705J35276_12237009 | 3300002504 | Bacteria | 9557 |
| 43 | Ga0123356_10055964 | 3300010049 | Bacteria | 3674 |
| 44 | Ga0123356_10075323 | 3300010049 | Bacteria | 3179 |
| 45 | Ga0123356_10137746 | 3300010049 | Bacteria | 2403 |
| 46 | Ga0123356_10259508 | 3300010049 | Bacteria | 1821 |
| 47 | Ga0123353_10001532 | 3300010167 | Bacteria | 28256 |
| 48 | Ga0123353_10116042 | 3300010167 | Bacteria | 4309 |
| 49 | Ga0123353_10352364 | 3300010167 | Unclassified | 2217 |
| 50 | Ga0123353_10457540 | 3300010167 | Bacteria | 1876 |
| 51 | Ga0123353_10465023 | 3300010167 | Unclassified | 1857 |
| 52 | Ga0123353_10491227 | 3300010167 | Bacteria | 1792 |
| 53 | Ga0123353_10573408 | 3300010167 | Unclassified | 1621 |
| 54 | Ga0123354_10511493 | 3300010882 | Archaea | 929 |
| 55 | Ga0466697_026900 | 3300042611 | Unclassified | 2329 |
| 56 | Ga0466702_092390 | 3300042635 | Bacteria | 1946 |
| 57 | Ga0466704_489230 | 3300042643 | Bacteria | 31616 |
| 58 | Ga0466733_132676 | 3300042659 | Bacteria | 1577 |
| 59 | JGI24702J35022_10037411 | 3300002462 | Bacteria | 2592 |
| 60 | Ga0072941_1430913 | 3300005201 | Bacteria | 659 |
| 61 | Ga0123356_11334157 | 3300010049 | Bacteria | 880 |
| 62 | Ga0123353_10155971 | 3300010167 | Bacteria | 3639 |
| 63 | Ga0123353_10169954 | 3300010167 | Bacteria | 3462 |
| 64 | Ga0123353_10220884 | 3300010167 | Bacteria | 2963 |
| 65 | Ga0123353_10566222 | 3300010167 | Unclassified | 1634 |
| 66 | Ga0123353_10567514 | 3300010167 | Archaea | 1632 |
| 67 | Ga0123353_10578674 | 3300010167 | Bacteria | 1612 |
| 68 | Ga0123353_10723776 | 3300010167 | Archaea | 1391 |
| 69 | Ga0123353_10943760 | 3300010167 | Unclassified | 1168 |
| 70 | Ga0123353_11116480 | 3300010167 | Bacteria | 1045 |
| 71 | Ga0123354_10703510 | 3300010882 | Unclassified | 705 |
| 72 | Ga0466717_061419 | 3300042604 | Bacteria | 5173 |
| 73 | Ga0466725_015223 | 3300042654 | Bacteria | 1437 |
| 74 | Ga0466725_221857 | 3300042654 | Bacteria | 2335 |
| 75 | Ga0466693_273073 | 3300042592 | Bacteria | 2569 |
| 76 | Ga0466726_377926 | 3300042619 | Bacteria | 10842 |
| 77 | Ga0072941_1597498 | 3300005201 | Archaea | 1083 |
| 78 | Ga0123357_10171853 | 3300009784 | Bacteria | 2561 |
| 79 | Ga0123356_10031319 | 3300010049 | Bacteria | 4977 |
| 80 | Ga0123356_10181498 | 3300010049 | Bacteria | 2127 |
| 81 | Ga0123356_10717978 | 3300010049 | Unclassified | 1169 |
| 82 | Ga0123353_10024140 | 3300010167 | Unclassified | 9223 |
| 83 | Ga0123353_10111166 | 3300010167 | Bacteria | 4414 |
| 84 | Ga0123353_10284620 | 3300010167 | Bacteria | 2536 |
| 85 | Ga0123353_10477419 | 3300010167 | Unclassified | 1825 |
| 86 | Ga0123353_10535951 | 3300010167 | Unclassified | 1693 |
| 87 | Ga0123353_10600531 | 3300010167 | Bacteria | 1573 |
| 88 | Ga0123353_10632930 | 3300010167 | Bacteria | 1519 |
| 89 | Ga0123353_10917347 | 3300010167 | Archaea | 1190 |
| 90 | Ga0123353_11490376 | 3300010167 | Bacteria | 862 |
| 91 | Ga0123353_11675099 | 3300010167 | Bacteria | 798 |
| 92 | Ga0123353_11688974 | 3300010167 | Bacteria | 794 |
| 93 | Ga0466724_30620 | 3300042649 | Bacteria | 12775 |
| 94 | Ga0466699_334061 | 3300042597 | Unclassified | 1207 |
| 95 | Ga0466705_480716 | 3300042612 | Bacteria | 10621 |
| 96 | JGI24702J35022_10031422 | 3300002462 | Bacteria | 2845 |
| 97 | JGI24705J35276_11929174 | 3300002504 | Unclassified | 775 |
| 98 | Ga0072941_1019833 | 3300005201 | Bacteria | 3009 |
| 99 | Ga0123356_10009127 | 3300010049 | Bacteria | 9810 |
| 100 | Ga0123356_10011731 | 3300010049 | Unclassified | 8530 |
| 101 | Ga0123356_10025608 | 3300010049 | Bacteria | 5546 |
| 102 | Ga0123356_10048680 | 3300010049 | Bacteria | 3944 |
| 103 | Ga0123356_10061824 | 3300010049 | Bacteria | 3498 |
| 104 | Ga0123356_11071020 | 3300010049 | Bacteria | 975 |
| 105 | Ga0123353_10164187 | 3300010167 | Bacteria | 3532 |
| 106 | Ga0123353_10291441 | 3300010167 | Bacteria | 2498 |
| 107 | Ga0123354_10127703 | 3300010882 | Bacteria | 3235 |
| 108 | Ga0466694_349349 | 3300042594 | Bacteria | 12991 |
| 109 | JGI24705J35276_12232200 | 3300002504 | Bacteria | 4228 |
| 110 | Ga0072940_1073457 | 3300005200 | Bacteria | 1976 |
| 111 | Ga0123356_10083735 | 3300010049 | Bacteria | 3022 |
| 112 | Ga0123356_10266966 | 3300010049 | Archaea | 1799 |
| 113 | Ga0123353_10684886 | 3300010167 | Bacteria | 1443 |
| 114 | Ga0123353_10704031 | 3300010167 | Bacteria | 1417 |
| 115 | Ga0123353_11007247 | 3300010167 | Unclassified | 1118 |
| 116 | Ga0123354_10394463 | 3300010882 | Unclassified | 1179 |
| 117 | Ga0466700_017834 | 3300042600 | Bacteria | 40737 |
| 118 | Ga0466700_046475 | 3300042600 | Bacteria | 3229 |
| 119 | Ga0466717_128552 | 3300042604 | Unclassified | 1084 |
| 120 | Ga0466697_015261 | 3300042611 | Bacteria | 13390 |
| 121 | Ga0466703_312767 | 3300042636 | Archaea | 1325 |
| 122 | Ga0466704_140135 | 3300042643 | Bacteria | 12384 |
| 123 | Ga0466697_255952 | 3300042611 | Unclassified | 2167 |
| 124 | Ga0415639_015129 | 3300038395 | Bacteria | 15095 |
| 125 | Ga0466657_377388 | 3300042582 | Unclassified | 1124 |
| 126 | AustNasuHG_c1001188 | 3300000089 | Bacteria | 9370 |
| 127 | JGI24705J35276_12215622 | 3300002504 | Bacteria | 2010 |
| 128 | Ga0072940_1118893 | 3300005200 | Bacteria | 5520 |
| 129 | Ga0072941_1664396 | 3300005201 | Archaea | 920 |
| 130 | Ga0123357_10360284 | 3300009784 | Bacteria | 1378 |
| 131 | Ga0123356_10011254 | 3300010049 | Bacteria | 8731 |
| 132 | Ga0123356_10134358 | 3300010049 | Bacteria | 2429 |
| 133 | Ga0123356_11110840 | 3300010049 | Unclassified | 959 |
| 134 | Ga0123353_10293490 | 3300010167 | Bacteria | 2487 |
| 135 | Ga0123353_10449941 | 3300010167 | Bacteria | 1896 |
| 136 | Ga0123353_10721281 | 3300010167 | Bacteria | 1394 |
| 137 | Ga0123353_11553257 | 3300010167 | Unclassified | 839 |
| 138 | Ga0466700_073007 | 3300042600 | Bacteria | 1979 |
| 139 | Ga0466700_133392 | 3300042600 | Bacteria | 1050 |
| 140 | Ga0466700_487270 | 3300042600 | Unclassified | 2343 |
| 141 | Ga0466714_084543 | 3300042603 | Bacteria | 23480 |
| 142 | Ga0466717_129537 | 3300042604 | Bacteria | 5214 |
| 143 | Ga0466734_080097 | 3300042623 | Bacteria | 1589 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010049 | Ga0123356_10009127 | Ga0123356_100091273 | 184 |
| 2 | 3300042611 | Ga0466697_255952 | Ga0466697_255952_1497_2069 | 190 |
| 3 | 3300002504 | JGI24705J35276_12217263 | JGI24705J35276_122172632 | 193 |
| 4 | 3300038395 | Ga0415639_015129 | Ga0415639_015129_4142_4729 | 195 |
| 5 | 3300042582 | Ga0466657_377388 | Ga0466657_377388_318_905 | 195 |
| 6 | 3300042582 | Ga0466657_399369 | Ga0466657_399369_612_1199 | 195 |
| 7 | 3300042600 | Ga0466700_017834 | Ga0466700_017834_7770_8357 | 195 |
| 8 | 3300042600 | Ga0466700_073007 | Ga0466700_073007_1092_1679 | 195 |
| 9 | 3300042600 | Ga0466700_487270 | Ga0466700_487270_296_883 | 195 |
| 10 | 3300042604 | Ga0466717_128552 | Ga0466717_128552_72_659 | 195 |
| 11 | 3300042604 | Ga0466717_129537 | Ga0466717_129537_168_755 | 195 |
| 12 | 3300042611 | Ga0466697_015261 | Ga0466697_015261_3692_4279 | 195 |
| 13 | 3300042611 | Ga0466697_250431 | Ga0466697_250431_464_1051 | 195 |
| 14 | 3300042623 | Ga0466734_075332 | Ga0466734_075332_1103_1690 | 195 |
| 15 | 3300042623 | Ga0466734_080097 | Ga0466734_080097_553_1140 | 195 |
| 16 | 3300042654 | Ga0466725_015223 | Ga0466725_015223_799_1386 | 195 |
| 17 | iso_pr_bacteria | 2820275298 | 2820276300 | 195 |
| 18 | iso_pr_bacteria | 2820362221 | 2820364367 | 195 |
| 19 | iso_pr_bacteria | 2820432912 | 2820434875 | 195 |
| 20 | iso_pr_bacteria | 2820530790 | 2820532629 | 195 |
| 21 | 3300005201 | Ga0072941_1019833 | Ga0072941_10198334 | 196 |
| 22 | 3300010049 | Ga0123356_10012951 | Ga0123356_100129519 | 196 |
| 23 | 3300010049 | Ga0123356_10031319 | Ga0123356_100313195 | 196 |
| 24 | 3300010049 | Ga0123356_10061824 | Ga0123356_100618242 | 196 |
| 25 | 3300010049 | Ga0123356_10075323 | Ga0123356_100753232 | 196 |
| 26 | 3300010049 | Ga0123356_10101269 | Ga0123356_101012692 | 196 |
| 27 | 3300010049 | Ga0123356_10134358 | Ga0123356_101343582 | 196 |
| 28 | 3300010049 | Ga0123356_10178558 | Ga0123356_101785584 | 196 |
| 29 | 3300010049 | Ga0123356_10717978 | Ga0123356_107179782 | 196 |
| 30 | 3300010049 | Ga0123356_11110840 | Ga0123356_111108402 | 196 |
| 31 | 3300010167 | Ga0123353_10024140 | Ga0123353_100241403 | 196 |
| 32 | 3300010167 | Ga0123353_10111166 | Ga0123353_101111665 | 196 |
| 33 | 3300010167 | Ga0123353_10164187 | Ga0123353_101641875 | 196 |
| 34 | 3300010167 | Ga0123353_10302938 | Ga0123353_103029384 | 196 |
| 35 | 3300010167 | Ga0123353_10465023 | Ga0123353_104650232 | 196 |
| 36 | 3300010167 | Ga0123353_10566222 | Ga0123353_105662222 | 196 |
| 37 | 3300010167 | Ga0123353_10567514 | Ga0123353_105675142 | 196 |
| 38 | 3300010167 | Ga0123353_10573408 | Ga0123353_105734083 | 196 |
| 39 | 3300010167 | Ga0123353_10600531 | Ga0123353_106005312 | 196 |
| 40 | 3300010167 | Ga0123353_10704031 | Ga0123353_107040312 | 196 |
| 41 | 3300010167 | Ga0123353_11007247 | Ga0123353_110072472 | 196 |
| 42 | 3300010882 | Ga0123354_10127703 | Ga0123354_101277033 | 196 |
| 43 | 3300010882 | Ga0123354_10394463 | Ga0123354_103944632 | 196 |
| 44 | 3300010882 | Ga0123354_10511493 | Ga0123354_105114931 | 196 |
| 45 | 3300010882 | Ga0123354_10703510 | Ga0123354_107035101 | 196 |
| 46 | 3300038395 | Ga0415639_111739 | Ga0415639_111739_3787_4377 | 196 |
| 47 | 3300042550 | Ga0466656_322854 | Ga0466656_322854_2059_2649 | 196 |
| 48 | 3300042592 | Ga0466693_004737 | Ga0466693_004737_1245_1835 | 196 |
| 49 | 3300042598 | Ga0466701_057355 | Ga0466701_057355_181_771 | 196 |
| 50 | 3300042600 | Ga0466700_046475 | Ga0466700_046475_1836_2426 | 196 |
| 51 | iso_pr_bacteria | 2820924633 | 2820926533 | 196 |
| 52 | 3300000089 | AustNasuHG_c1001188 | AustNasuHG_10011883 | 197 |
| 53 | 3300002462 | JGI24702J35022_10031422 | JGI24702J35022_100314224 | 197 |
| 54 | 3300002504 | JGI24705J35276_12232200 | JGI24705J35276_122322002 | 197 |
| 55 | 3300005200 | Ga0072940_1073457 | Ga0072940_10734573 | 197 |
| 56 | 3300005200 | Ga0072940_1118893 | Ga0072940_11188934 | 197 |
| 57 | 3300010049 | Ga0123356_10011731 | Ga0123356_100117312 | 197 |
| 58 | 3300010049 | Ga0123356_10055964 | Ga0123356_100559642 | 197 |
| 59 | 3300010049 | Ga0123356_10259508 | Ga0123356_102595082 | 197 |
| 60 | 3300010049 | Ga0123356_10442824 | Ga0123356_104428242 | 197 |
| 61 | 3300010049 | Ga0123356_10695718 | Ga0123356_106957183 | 197 |
| 62 | 3300010049 | Ga0123356_11071020 | Ga0123356_110710202 | 197 |
| 63 | 3300010167 | Ga0123353_10116042 | Ga0123353_101160424 | 197 |
| 64 | 3300010167 | Ga0123353_10535951 | Ga0123353_105359512 | 197 |
| 65 | 3300010167 | Ga0123353_10701698 | Ga0123353_107016982 | 197 |
| 66 | 3300010167 | Ga0123353_10943760 | Ga0123353_109437601 | 197 |
| 67 | 3300010167 | Ga0123353_10973750 | Ga0123353_109737501 | 197 |
| 68 | 3300010167 | Ga0123353_11334181 | Ga0123353_113341811 | 197 |
| 69 | 3300042594 | Ga0466694_349349 | Ga0466694_349349_3567_4160 | 197 |
| 70 | 3300042613 | Ga0466710_081842 | Ga0466710_081842_832_1425 | 197 |
| 71 | 3300042635 | Ga0466702_092390 | Ga0466702_092390_1343_1936 | 197 |
| 72 | 3300042643 | Ga0466704_489230 | Ga0466704_489230_12824_13417 | 197 |
| 73 | 3300042649 | Ga0466724_30620 | Ga0466724_30620_3861_4454 | 197 |
| 74 | iso_pr_bacteria | 2820271343 | 2820271564 | 197 |
| 75 | iso_pr_bacteria | 2820333861 | 2820334934 | 197 |
| 76 | 3300002504 | JGI24705J35276_12215622 | JGI24705J35276_122156221 | 198 |
| 77 | 3300005201 | Ga0072941_1430913 | Ga0072941_14309131 | 198 |
| 78 | 3300005201 | Ga0072941_1597498 | Ga0072941_15974981 | 198 |
| 79 | 3300010049 | Ga0123356_10048680 | Ga0123356_100486803 | 198 |
| 80 | 3300010167 | Ga0123353_10001532 | Ga0123353_1000153220 | 198 |
| 81 | 3300010167 | Ga0123353_10220884 | Ga0123353_102208842 | 198 |
| 82 | 3300010167 | Ga0123353_10284620 | Ga0123353_102846203 | 198 |
| 83 | 3300010167 | Ga0123353_10491227 | Ga0123353_104912271 | 198 |
| 84 | 3300010167 | Ga0123353_11675099 | Ga0123353_116750991 | 198 |
| 85 | 3300042619 | Ga0466726_377926 | Ga0466726_377926_351_947 | 198 |
| 86 | 3300042622 | Ga0466731_262657 | Ga0466731_262657_2016_2612 | 198 |
| 87 | 3300042623 | Ga0466734_134607 | Ga0466734_134607_564_1160 | 198 |
| 88 | 3300042636 | Ga0466703_312767 | Ga0466703_312767_291_887 | 198 |
| 89 | 3300042643 | Ga0466704_140135 | Ga0466704_140135_4981_5577 | 198 |
| 90 | 3300042654 | Ga0466725_221857 | Ga0466725_221857_32_628 | 198 |
| 91 | 3300042654 | Ga0466725_222418 | Ga0466725_222418_1928_2524 | 198 |
| 92 | iso_pr_bacteria | 2820265624 | 2820266554 | 198 |
| 93 | 3300010049 | Ga0123356_10011254 | Ga0123356_100112543 | 199 |
| 94 | 3300010049 | Ga0123356_10083735 | Ga0123356_100837354 | 199 |
| 95 | 3300010049 | Ga0123356_10139761 | Ga0123356_101397612 | 199 |
| 96 | 3300010049 | Ga0123356_11334157 | Ga0123356_113341571 | 199 |
| 97 | 3300010167 | Ga0123353_10169954 | Ga0123353_101699543 | 199 |
| 98 | 3300010167 | Ga0123353_10251424 | Ga0123353_102514243 | 199 |
| 99 | 3300010167 | Ga0123353_10291441 | Ga0123353_102914412 | 199 |
| 100 | 3300010167 | Ga0123353_10369460 | Ga0123353_103694602 | 199 |
| 101 | 3300010167 | Ga0123353_10578674 | Ga0123353_105786742 | 199 |
| 102 | 3300010167 | Ga0123353_10632930 | Ga0123353_106329302 | 199 |
| 103 | 3300010167 | Ga0123353_10721281 | Ga0123353_107212811 | 199 |
| 104 | 3300010167 | Ga0123353_10917347 | Ga0123353_109173472 | 199 |
| 105 | 3300010167 | Ga0123353_11116480 | Ga0123353_111164802 | 199 |
| 106 | 3300010167 | Ga0123353_11490376 | Ga0123353_114903761 | 199 |
| 107 | 3300010167 | Ga0123353_11688974 | Ga0123353_116889741 | 199 |
| 108 | 3300010167 | Ga0123353_11918203 | Ga0123353_119182032 | 199 |
| 109 | 3300038395 | Ga0415639_135813 | Ga0415639_135813_321_920 | 199 |
| 110 | 3300042592 | Ga0466693_273073 | Ga0466693_273073_1504_2103 | 199 |
| 111 | 3300042603 | Ga0466714_084543 | Ga0466714_084543_3547_4146 | 199 |
| 112 | 3300002834 | JGI24696J40584_12921936 | JGI24696J40584_129219362 | 200 |
| 113 | 3300005201 | Ga0072941_1664396 | Ga0072941_16643961 | 200 |
| 114 | 3300010049 | Ga0123356_10009976 | Ga0123356_100099769 | 200 |
| 115 | 3300010167 | Ga0123353_10213261 | Ga0123353_102132613 | 200 |
| 116 | 3300042613 | Ga0466710_243639 | Ga0466710_243639_337_939 | 200 |
| 117 | 3300042659 | Ga0466733_132676 | Ga0466733_132676_288_890 | 200 |
| 118 | iso_pr_bacteria | 2820272499 | 2820273115 | 200 |
| 119 | iso_pr_bacteria | 2820314258 | 2820315631 | 200 |
| 120 | 3300002504 | JGI24705J35276_12237009 | JGI24705J35276_122370094 | 201 |
| 121 | 3300010049 | Ga0123356_10025019 | Ga0123356_100250192 | 201 |
| 122 | 3300010049 | Ga0123356_10181498 | Ga0123356_101814982 | 201 |
| 123 | 3300010049 | Ga0123356_10266966 | Ga0123356_102669664 | 201 |
| 124 | 3300010167 | Ga0123353_10477419 | Ga0123353_104774192 | 201 |
| 125 | 3300042612 | Ga0466705_480716 | Ga0466705_480716_6836_7441 | 201 |
| 126 | 3300010049 | Ga0123356_10089295 | Ga0123356_100892953 | 202 |
| 127 | 3300010167 | Ga0123353_10449941 | Ga0123353_104499412 | 202 |
| 128 | 3300010167 | Ga0123353_10723776 | Ga0123353_107237762 | 202 |
| 129 | 3300002504 | JGI24705J35276_11929174 | JGI24705J35276_119291741 | 203 |
| 130 | 3300009784 | Ga0123357_10171853 | Ga0123357_101718532 | 203 |
| 131 | 3300042619 | Ga0466726_005077 | Ga0466726_005077_744_1355 | 203 |
| 132 | 3300010049 | Ga0123356_10025608 | Ga0123356_100256082 | 204 |
| 133 | 3300010049 | Ga0123356_10171640 | Ga0123356_101716402 | 204 |
| 134 | 3300010167 | Ga0123353_10155971 | Ga0123353_101559713 | 204 |
| 135 | 3300010167 | Ga0123353_10474053 | Ga0123353_104740532 | 204 |
| 136 | 3300042600 | Ga0466700_133392 | Ga0466700_133392_206_820 | 204 |
| 137 | 3300042611 | Ga0466697_026900 | Ga0466697_026900_906_1520 | 204 |
| 138 | 3300042635 | Ga0466702_317944 | Ga0466702_317944_521_1135 | 204 |
| 139 | 3300010049 | Ga0123356_10137746 | Ga0123356_101377462 | 205 |
| 140 | 3300010167 | Ga0123353_10684886 | Ga0123353_106848862 | 205 |
| 141 | 3300042603 | Ga0466714_027956 | Ga0466714_027956_495_1115 | 206 |
| 142 | 3300010167 | Ga0123353_10000176 | Ga0123353_1000017620 | 207 |
| 143 | 3300010167 | Ga0123353_10293490 | Ga0123353_102934902 | 207 |
| 144 | 3300010167 | Ga0123353_10095477 | Ga0123353_100954774 | 209 |
| 145 | 3300010167 | Ga0123353_11553257 | Ga0123353_115532572 | 209 |
| 146 | 3300009784 | Ga0123357_10360284 | Ga0123357_103602842 | 212 |
| 147 | 3300010167 | Ga0123353_10352364 | Ga0123353_103523641 | 212 |
| 148 | 3300042597 | Ga0466699_334061 | Ga0466699_334061_101_739 | 212 |
| 149 | 3300002462 | JGI24702J35022_10181851 | JGI24702J35022_101818512 | 214 |
| 150 | 3300010167 | Ga0123353_10457540 | Ga0123353_104575402 | 216 |
| 151 | 3300010167 | Ga0123353_10921212 | Ga0123353_109212122 | 223 |
| 152 | 3300042604 | Ga0466717_061419 | Ga0466717_061419_318_998 | 226 |
| 153 | 3300002462 | JGI24702J35022_10037411 | JGI24702J35022_100374112 | 256 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.88 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.