Protein Family IF03353

Metagenome Isolate
314 Members
99 Samples
278 Scaffolds
251.85 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10710722|Ga0123353_107107221
Length
288 aa
Sequence
MGGQGEGLHRKISRFDRYFYRRRVQTNGQIHYKIKNMLAKRIVPCLDIKDGKTVKGINFVGFRDAGDPVELGAEYSRQGADELVFLDITASHEGRKTFVDLVRKVAENVNIPFTVGGGIYELKDVDTLLNAGADKVSLNSAILRNPGLIDDIASNFGSHVLVAAIDGNLEDGRWVCYLNGGRIPTDKELFSWAKEAQERGAGEILFTSMTHDGVKEGYPNEALATLSDTLNIPVTASGGAGKMEHFKDAFISGKADAALAASVFHFGEIRIPELKKYLASEGIHIRL*

📊 Sample Types

Isolate 11.5%
Metagenome 88.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 27.5%
Blattidae 16.5%
Unclassified 15.4%
Kalotermitidae 14.3%
Tenebrionidae 5.5%
Termopsidae 4.4%
Drosophilidae 4.4%
Passalidae 4.4%
Rhinotermitidae 3.3%
Gomphidae 1.1%
Libellulidae 1.1%
Hodotermitidae 1.1%
Formicidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 304
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 8018802046 Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 Isolate Gomphidae
3 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 8114541043 Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 Isolate Libellulidae
13 2820265624 Unclassified Firmicutes Th196P3bin36 Isolate Unclassified
14 2834951433 Brochothrix thermosphacta CD 337 Isolate Unclassified
15 2896321640 Sphingobacterium sp. xlx-130 Isolate
16 2940313741 Parabacteroides sp. PH5-17 Isolate Blattidae
17 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
18 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
19 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
20 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
21 8114537524 Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 Isolate
22 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
23 2820757377 Unclassified Bacteroidetes Mp193P4bin6 Isolate Unclassified
24 2898741527 Sphingobacterium sp. xlx-73 Isolate
25 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
26 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
30 8007237282 Enterococcus sp. DIV0212c Isolate
31 8018798118 Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 Isolate
32 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
33 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
34 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
35 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
36 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
37 3300007149 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 4 gut Metagenome Drosophilidae
38 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
39 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
40 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
41 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
42 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
43 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
44 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
45 2896350215 Sphingobacterium sp. xlx-183 Isolate
46 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
47 2940298504 Parabacteroides sp. PF5-13 Isolate Blattidae
48 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
49 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
50 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
51 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
52 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
53 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
54 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
55 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
56 2940306115 Parabacteroides sp. PFB2-22 Isolate Blattidae
57 2940309933 Parabacteroides sp. PH5-13 Isolate Blattidae
58 2940328985 Parabacteroides sp. PH5-46 Isolate Blattidae
59 2820951912 Unclassified Acidobacteria Emb289P4bin26 Isolate Unclassified
60 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
61 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
62 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
63 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
64 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
65 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
66 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
67 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
68 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
69 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
70 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
71 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
72 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
73 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
74 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
75 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
76 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
77 2940302308 Parabacteroides sp. PF5-5 Isolate Blattidae
78 2940321370 Parabacteroides sp. PH5-39 Isolate Blattidae
79 2940332795 Parabacteroides sp. PH5-8 Isolate Blattidae
80 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
81 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
82 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
83 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
84 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
85 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
86 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
87 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
88 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
89 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
90 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
91 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
92 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
93 2896330536 Sphingobacterium sp. xlx-96 Isolate
94 2940205530 Parabacteroides sp. PH5-33 Isolate Blattidae
95 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
96 2940317558 Parabacteroides sp. PH5-26 Isolate Blattidae
97 2940325180 Parabacteroides sp. PH5-41 Isolate Blattidae
98 8012939035 Enterococcus sp. UD-01 Isolate Tenebrionidae
99 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_191911 3300042612 Bacteria 3296
2 Ga0562376_0088 3300056857 Bacteria 219719
3 JGI24702J35022_10000738 3300002462 Bacteria 20126
4 JGI24699J35502_11134000 3300002509 Bacteria 23716
5 Ga0466701_047395 3300042598 Bacteria 4057
6 Ga0466700_003037 3300042600 Bacteria 30141
7 Ga0466707_129085 3300042601 Bacteria 1630
8 Ga0466713_083056 3300042602 Bacteria 2149
9 Ga0466717_184543 3300042604 Unclassified 1009
10 Ga0466716_217748 3300042605 Bacteria 13442
11 Ga0466719_545997 3300042606 Bacteria 4165
12 Ga0466722_036334 3300042609 Bacteria 4666
13 Ga0415639_032949 3300038395 Bacteria 17877
14 Ga0466690_003105 3300042590 Bacteria 52820
15 Ga0466690_221039 3300042590 Bacteria 17812
16 Ga0466690_381813 3300042590 Bacteria 66142
17 Ga0466696_255699 3300042596 Bacteria 21807
18 Ga0123357_10006387 3300009784 Bacteria 14365
19 Ga0123357_10033439 3300009784 Bacteria 6986
20 Ga0123355_10022363 3300009826 Bacteria 10135
21 Ga0123356_10000242 3300010049 Bacteria 62970
22 Ga0123356_10005549 3300010049 Bacteria 12829
23 Ga0123356_10085804 3300010049 Bacteria 2987
24 Ga0123356_10326485 3300010049 Bacteria 1649
25 Ga0123353_10371978 3300010167 Bacteria 2142
26 Ga0123353_10491138 3300010167 Bacteria 1792
27 Ga0123353_11009090 3300010167 Bacteria 1117
28 Ga0466705_528022 3300042612 Bacteria 15235
29 Ga0466703_098553 3300042636 Bacteria 10370
30 Ga0466704_044023 3300042643 Bacteria 26668
31 Ga0466705_347982 3300042612 Bacteria 27347
32 2227540470 2225789004 Bacteria 2998
33 IMNBL1DRAFT_c0001357 3300000062 Bacteria 18416
34 IMNBL1DRAFT_c0001758 3300000062 Bacteria 15875
35 JGI24705J35276_12224125 3300002504 Bacteria 2578
36 JGI24699J35502_11134227 3300002509 Bacteria 76542
37 Ga0068305_10167097 3300005083 Bacteria 4947
38 Ga0466701_079535 3300042598 Bacteria 72629
39 Ga0466707_146743 3300042601 Bacteria 5186
40 Ga0466707_167629 3300042601 Bacteria 52999
41 Ga0466713_042033 3300042602 Bacteria 13325
42 Ga0466719_491579 3300042606 Bacteria 7343
43 Ga0466722_016134 3300042609 Bacteria 13088
44 Ga0466722_252821 3300042609 Bacteria 235840
45 Ga0466696_416536 3300042596 Bacteria 8864
46 Ga0123357_10011226 3300009784 Bacteria 11468
47 Ga0123355_10136228 3300009826 Bacteria 3770
48 Ga0123355_10621051 3300009826 Bacteria 1274
49 Ga0123356_10008707 3300010049 Bacteria 10064
50 Ga0123356_10054321 3300010049 Bacteria 3731
51 Ga0123356_10065709 3300010049 Bacteria 3394
52 Ga0123356_10119933 3300010049 Bacteria 2556
53 Ga0123356_10660764 3300010049 Bacteria 1213
54 Ga0123353_10008024 3300010167 Bacteria 14364
55 Ga0123353_10055946 3300010167 Bacteria 6314
56 Ga0123353_10067673 3300010167 Bacteria 5736
57 Ga0123353_10299802 3300010167 Bacteria 2454
58 Ga0123353_10621686 3300010167 Bacteria 1537
59 Ga0123354_10005439 3300010882 Bacteria 18514
60 Ga0123354_10029978 3300010882 Bacteria 8550
61 Ga0123354_10300459 3300010882 Bacteria 1519
62 Ga0466715_223117 3300042616 Bacteria 2842
63 Ga0466723_097479 3300042618 Bacteria 24080
64 Ga0466723_367436 3300042618 Bacteria 4612
65 Ga0466729_240911 3300042621 Bacteria 7463
66 Ga0466734_154502 3300042623 Bacteria 1243
67 Ga0466703_335745 3300042636 Bacteria 5577
68 IMNBGM34_c001209 3300000036 Bacteria 4847
69 JGI24698J34947_10054383 3300002449 Bacteria 1999
70 JGI24702J35022_10045890 3300002462 Bacteria 2328
71 CVPL010W_10002427 3300002931 Bacteria 48318
72 Ga0466707_243595 3300042601 Bacteria 19927
73 Ga0466714_048239 3300042603 Bacteria 109405
74 Ga0466714_062004 3300042603 Bacteria 1707
75 Ga0466722_091635 3300042609 Bacteria 5035
76 Ga0466722_204114 3300042609 Bacteria 23829
77 Ga0466698_449763 3300042610 Bacteria 1002
78 Ga0466690_147886 3300042590 Bacteria 13686
79 Ga0466690_216616 3300042590 Bacteria 1905
80 Ga0466691_071826 3300042593 Bacteria 22585
81 Ga0123357_10010972 3300009784 Bacteria 11572
82 Ga0123355_10406681 3300009826 Bacteria 1751
83 Ga0123356_10000210 3300010049 Bacteria 68021
84 Ga0123356_10172600 3300010049 Bacteria 2174
85 Ga0123356_10175807 3300010049 Bacteria 2157
86 Ga0123356_10232158 3300010049 Bacteria 1910
87 Ga0123356_10298508 3300010049 Bacteria 1715
88 Ga0123356_10423703 3300010049 Archaea 1474
89 Ga0123356_10472393 3300010049 Bacteria 1406
90 Ga0123356_10489439 3300010049 Bacteria 1384
91 Ga0123356_11052117 3300010049 Bacteria 983
92 Ga0123353_10028790 3300010167 Bacteria 8543
93 Ga0123353_10699548 3300010167 Bacteria 1423
94 Ga0123354_10006484 3300010882 Bacteria 17397
95 Ga0466715_058320 3300042616 Bacteria 5866
96 Ga0466715_096303 3300042616 Bacteria 18483
97 Ga0466729_099509 3300042621 Bacteria 1608
98 Ga0466729_143931 3300042621 Bacteria 11316
99 Ga0466703_151702 3300042636 Bacteria 27425
100 Ga0466703_198952 3300042636 Bacteria 9159
101 Ga0466703_319363 3300042636 Bacteria 11975
102 Ga0466704_048621 3300042643 Bacteria 3757
103 Ga0466709_295596 3300042648 Bacteria 10885
104 Ga0466697_107714 3300042611 Bacteria 1572
105 2227513524 2225789004 Bacteria 18108
106 IMNBL1DRAFT_c0024839 3300000062 Bacteria 2311
107 Ga0104043_1093643 3300007058 Unclassified 1214
108 Ga0466701_037990 3300042598 Bacteria 12014
109 Ga0466700_192757 3300042600 Bacteria 1420
110 Ga0466707_050759 3300042601 Bacteria 5366
111 Ga0466714_018529 3300042603 Bacteria 86040
112 Ga0466717_057174 3300042604 Unclassified 2129
113 Ga0466722_027463 3300042609 Bacteria 1383
114 Ga0466691_094593 3300042593 Bacteria 62434
115 Ga0466696_483456 3300042596 Unclassified 8223
116 Ga0466699_183756 3300042597 Bacteria 5117
117 Ga0123357_10030758 3300009784 Bacteria 7282
118 Ga0123357_10189477 3300009784 Unclassified 2375
119 Ga0123356_10015847 3300010049 Bacteria 7213
120 Ga0123356_10026054 3300010049 Bacteria 5496
121 Ga0123356_10145613 3300010049 Bacteria 2343
122 Ga0123356_10310317 3300010049 Bacteria 1686
123 Ga0123356_10668657 3300010049 Bacteria 1206
124 Ga0123356_10931233 3300010049 Bacteria 1040
125 Ga0123353_10047690 3300010167 Bacteria 6816
126 Ga0123353_10185411 3300010167 Bacteria 3291
127 Ga0123353_10321393 3300010167 Bacteria 2348
128 Ga0123353_10570127 3300010167 Bacteria 1627
129 Ga0123354_10004885 3300010882 Bacteria 19219
130 Ga0123354_10262374 3300010882 Unclassified 1722
131 Ga0466711_223085 3300042615 Bacteria 1836
132 Ga0466715_566191 3300042616 Bacteria 17032
133 Ga0466718_081242 3300042617 Bacteria 1731
134 Ga0466726_145169 3300042619 Bacteria 2006
135 Ga0466726_218603 3300042619 Bacteria 6308
136 Ga0466726_489928 3300042619 Bacteria 5835
137 Ga0466728_404258 3300042620 Bacteria 22281
138 Ga0466709_020764 3300042648 Bacteria 14403
139 Ga0466709_375890 3300042648 Unclassified 2870
140 Ga0466697_253480 3300042611 Bacteria 3214
141 Ga0562375_0015 3300056856 Bacteria 1028412
142 2227063686 2225789003 Bacteria 18025
143 2227521855 2225789004 Bacteria 17131
144 IMNBL1DRAFT_c0000489 3300000062 Bacteria 33049
145 JGI24702J35022_10000485 3300002462 Bacteria 24037
146 JGI24702J35022_10016372 3300002462 Bacteria 4064
147 JGI24705J35276_12215274 3300002504 Bacteria 1996
148 JGI24699J35502_11133377 3300002509 Bacteria 10189
149 JGI24696J40584_12938950 3300002834 Bacteria 1640
150 Ga0104041_1035013 3300007106 Bacteria 2106
151 Ga0123357_10001078 3300009784 Bacteria 28159
152 Ga0466713_075503 3300042602 Bacteria 4869
153 Ga0466717_197012 3300042604 Bacteria 10355
154 Ga0466698_382854 3300042610 Bacteria 1448
155 Ga0466690_138349 3300042590 Bacteria 5833
156 Ga0466696_058283 3300042596 Bacteria 42827
157 Ga0123356_10082955 3300010049 Bacteria 3036
158 Ga0123356_10145716 3300010049 Bacteria 2342
159 Ga0123356_10173410 3300010049 Bacteria 2170
160 Ga0123356_10253343 3300010049 Bacteria 1839
161 Ga0123356_10321699 3300010049 Bacteria 1660
162 Ga0123356_10498013 3300010049 Bacteria 1374
163 Ga0123353_10322080 3300010167 Bacteria 2345
164 Ga0123354_10005281 3300010882 Bacteria 18726
165 Ga0123354_10597797 3300010882 Bacteria 810
166 Ga0466715_593195 3300042616 Bacteria 30381
167 Ga0466727_171635 3300042655 Bacteria 4649
168 Ga0466705_319150 3300042612 Bacteria 11105
169 Ga0530661_000018 3300056564 Bacteria 232195
170 Ga0530661_000025 3300056564 Bacteria 184613
171 2227097482 2225789004 Bacteria 9675
172 2227546855 2225789004 Bacteria 15206
173 IMNBL1DRAFT_c0000303 3300000062 Bacteria 41914
174 Ga0068302_10056840 3300005071 Bacteria 5172
175 Ga0104040_1154132 3300007149 Bacteria 1060
176 Ga0466713_145405 3300042602 Bacteria 30268
177 Ga0466714_069781 3300042603 Bacteria 1554
178 Ga0466717_059762 3300042604 Unclassified 1923
179 Ga0466722_026149 3300042609 Bacteria 42543
180 Ga0466696_092398 3300042596 Bacteria 31103
181 Ga0123357_10063888 3300009784 Bacteria 4922
182 Ga0123357_10105389 3300009784 Bacteria 3617
183 Ga0123356_10010107 3300010049 Bacteria 9280
184 Ga0123356_10271944 3300010049 Bacteria 1785
185 Ga0123356_10302665 3300010049 Bacteria 1704
186 Ga0123356_10572832 3300010049 Bacteria 1292
187 Ga0123356_10878226 3300010049 Bacteria 1068
188 Ga0123353_10001822 3300010167 Bacteria 26231
189 Ga0123353_10059700 3300010167 Bacteria 6116
190 Ga0123353_10084874 3300010167 Bacteria 5098
191 Ga0123353_10285120 3300010167 Bacteria 2533
192 Ga0123353_11263406 3300010167 Bacteria 962
193 Ga0123353_11271089 3300010167 Bacteria 958
194 Ga0123354_10203287 3300010882 Bacteria 2169
195 Ga0466711_025702 3300042615 Bacteria 8443
196 Ga0466711_289238 3300042615 Bacteria 45865
197 Ga0466734_133897 3300042623 Bacteria 2550
198 Ga0466735_008107 3300042624 Bacteria 13453
199 Ga0466704_067334 3300042643 Bacteria 14559
200 Ga0466704_130193 3300042643 Bacteria 8624
201 Ga0466704_334341 3300042643 Bacteria 10042
202 Ga0466727_216925 3300042655 Bacteria 1008
203 Ga0466733_066581 3300042659 Bacteria 19447
204 Ga0466733_120525 3300042659 Bacteria 8761
205 Ga0562377_0028 3300056842 Bacteria 766538
206 2227519383 2225789004 Bacteria 3369
207 IMNBL1DRAFT_c0000345 3300000062 Bacteria 39398
208 Ga0072941_1405559 3300005201 Bacteria 2092
209 Ga0123357_10001255 3300009784 Bacteria 26695
210 Ga0466706_168300 3300042599 Bacteria 28378
211 Ga0466716_506121 3300042605 Bacteria 9655
212 Ga0466719_515791 3300042606 Bacteria 3286
213 Ga0466721_260002 3300042608 Bacteria 4064
214 Ga0466722_164511 3300042609 Bacteria 4155
215 Ga0415639_063222 3300038395 Bacteria 3785
216 Ga0466692_030052 3300042591 Bacteria 80804
217 Ga0466692_077112 3300042591 Bacteria 18021
218 Ga0466696_040606 3300042596 Bacteria 10155
219 Ga0123357_10012428 3300009784 Bacteria 10985
220 Ga0123356_10117302 3300010049 Bacteria 2583
221 Ga0123356_10117888 3300010049 Bacteria 2577
222 Ga0123356_10171876 3300010049 Bacteria 2179
223 Ga0123356_10181268 3300010049 Bacteria 2128
224 Ga0123356_10325422 3300010049 Bacteria 1652
225 Ga0123356_10515377 3300010049 Bacteria 1354
226 Ga0123356_10639890 3300010049 Bacteria 1230
227 Ga0123353_10157048 3300010167 Bacteria 3625
228 Ga0123353_11272110 3300010167 Bacteria 958
229 Ga0466715_079603 3300042616 Bacteria 222305
230 Ga0466715_231386 3300042616 Bacteria 80319
231 Ga0466723_197818 3300042618 Bacteria 8752
232 Ga0466726_370795 3300042619 Bacteria 1691
233 Ga0466726_373213 3300042619 Bacteria 4716
234 Ga0466735_231182 3300042624 Bacteria 5723
235 Ga0466703_137325 3300042636 Bacteria 11622
236 Ga0466703_211262 3300042636 Bacteria 6984
237 Ga0466704_184466 3300042643 Bacteria 5544
238 Ga0466704_251441 3300042643 Bacteria 3970
239 Ga0466704_460475 3300042643 Bacteria 4490
240 Ga0466705_064830 3300042612 Bacteria 19081
241 Ga0466733_029574 3300042659 Bacteria 3881
242 Ga0466733_138016 3300042659 Bacteria 7924
243 Ga0466733_184316 3300042659 Bacteria 2628
244 2227606565 2225789004 Bacteria 2294
245 IMNBL1DRAFT_c0001100 3300000062 Bacteria 20718
246 JGI24695J34938_10109625 3300002450 Bacteria 1125
247 JGI24702J35022_10145228 3300002462 Bacteria 1327
248 Ga0068302_10169609 3300005071 Bacteria 2002
249 Ga0104050_1002079 3300007153 Bacteria 10891
250 Ga0466701_037152 3300042598 Bacteria 1545
251 Ga0466700_252013 3300042600 Bacteria 17693
252 Ga0466713_007344 3300042602 Bacteria 13469
253 Ga0466713_042000 3300042602 Bacteria 23357
254 Ga0466713_094733 3300042602 Bacteria 8171
255 Ga0466717_138477 3300042604 Bacteria 1695
256 Ga0466719_245083 3300042606 Bacteria 6306
257 Ga0466719_405593 3300042606 Bacteria 3107
258 Ga0466722_069017 3300042609 Bacteria 18716
259 Ga0466657_092451 3300042582 Unclassified 1504
260 Ga0466690_270570 3300042590 Bacteria 3700
261 Ga0466692_062316 3300042591 Bacteria 1663
262 Ga0466692_191126 3300042591 Bacteria 1644
263 Ga0466693_093736 3300042592 Bacteria 3206
264 Ga0123356_10109416 3300010049 Bacteria 2666
265 Ga0123353_10078999 3300010167 Bacteria 5289
266 Ga0123353_10117619 3300010167 Bacteria 4275
267 Ga0123353_10276989 3300010167 Bacteria 2580
268 Ga0123353_10673787 3300010167 Bacteria 1458
269 Ga0123353_10710722 3300010167 Bacteria 1408
270 Ga0123354_10000047 3300010882 Bacteria 92241
271 Ga0123354_10000328 3300010882 Bacteria 44060
272 Ga0123354_10002448 3300010882 Bacteria 24525
273 Ga0123354_10180576 3300010882 Bacteria 2411
274 Ga0466715_070660 3300042616 Bacteria 9155
275 Ga0466726_327879 3300042619 Bacteria 3268
276 Ga0466735_149350 3300042624 Bacteria 14544
277 Ga0466704_107169 3300042643 Bacteria 11926
278 Ga0466727_215312 3300042655 Bacteria 4563

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007106 Ga0104041_1035013 Ga0104041_10350134 210
2 3300042617 Ga0466718_081242 Ga0466718_081242_400_1107 235
3 2225789003 2227063686 2227419437 238
4 2225789004 2227513524 2228010040 238
5 3300042596 Ga0466696_092398 Ga0466696_092398_14001_14717 238
6 3300042636 Ga0466703_151702 Ga0466703_151702_2736_3455 239
7 3300042643 Ga0466704_184466 Ga0466704_184466_1331_2050 239
8 3300042605 Ga0466716_217748 Ga0466716_217748_1380_2105 241
9 3300042603 Ga0466714_062004 Ga0466714_062004_421_1149 242
10 3300042615 Ga0466711_025702 Ga0466711_025702_1823_2551 242
11 3300042624 Ga0466735_008107 Ga0466735_008107_9550_10278 242
12 3300010167 Ga0123353_10321393 Ga0123353_103213933 243
13 3300000062 IMNBL1DRAFT_c0001357 IMNBL1DRAFT_00013577 244
14 3300010167 Ga0123353_11271089 Ga0123353_112710891 244
15 3300038395 Ga0415639_063222 Ga0415639_063222_2429_3163 244
16 3300010167 Ga0123353_10117619 Ga0123353_101176194 245
17 3300042616 Ga0466715_079603 Ga0466715_079603_183378_184115 245
18 3300005071 Ga0068302_10056840 Ga0068302_100568403 246
19 3300010049 Ga0123356_10302665 Ga0123356_103026652 247
20 3300010167 Ga0123353_10570127 Ga0123353_105701272 247
21 3300038395 Ga0415639_032949 Ga0415639_032949_7697_8440 247
22 3300010049 Ga0123356_10065709 Ga0123356_100657094 248
23 3300010049 Ga0123356_10117302 Ga0123356_101173024 249
24 3300010049 Ga0123356_10639890 Ga0123356_106398902 249
25 3300042608 Ga0466721_260002 Ga0466721_260002_162_911 249
26 2225789004 2227521855 2228026011 250
27 2225789004 2227540470 2228061625 250
28 2225789004 2227546855 2228073187 250
29 2225789004 2227606565 2228175809 250
30 3300010049 Ga0123356_10181268 Ga0123356_101812683 250
31 3300042590 Ga0466690_147886 Ga0466690_147886_3450_4202 250
32 3300042590 Ga0466690_216616 Ga0466690_216616_496_1248 250
33 3300042591 Ga0466692_062316 Ga0466692_062316_11_763 250
34 3300042591 Ga0466692_191126 Ga0466692_191126_344_1096 250
35 3300042593 Ga0466691_094593 Ga0466691_094593_1541_2293 250
36 3300042596 Ga0466696_255699 Ga0466696_255699_12704_13456 250
37 3300042597 Ga0466699_183756 Ga0466699_183756_4065_4817 250
38 3300042598 Ga0466701_037152 Ga0466701_037152_334_1086 250
39 3300042598 Ga0466701_079535 Ga0466701_079535_31837_32589 250
40 3300042599 Ga0466706_168300 Ga0466706_168300_21049_21801 250
41 3300042600 Ga0466700_003037 Ga0466700_003037_15406_16158 250
42 3300042600 Ga0466700_192757 Ga0466700_192757_64_816 250
43 3300042600 Ga0466700_252013 Ga0466700_252013_6786_7538 250
44 3300042601 Ga0466707_243595 Ga0466707_243595_10280_11032 250
45 3300042602 Ga0466713_007344 Ga0466713_007344_7748_8500 250
46 3300042605 Ga0466716_506121 Ga0466716_506121_7095_7847 250
47 3300042606 Ga0466719_245083 Ga0466719_245083_1887_2639 250
48 3300042606 Ga0466719_405593 Ga0466719_405593_1601_2353 250
49 3300042606 Ga0466719_515791 Ga0466719_515791_25_777 250
50 3300042609 Ga0466722_091635 Ga0466722_091635_754_1506 250
51 3300042609 Ga0466722_164511 Ga0466722_164511_1141_1893 250
52 3300042611 Ga0466697_253480 Ga0466697_253480_930_1682 250
53 3300042612 Ga0466705_064830 Ga0466705_064830_11762_12514 250
54 3300042618 Ga0466723_197818 Ga0466723_197818_4853_5605 250
55 3300042618 Ga0466723_367436 Ga0466723_367436_649_1401 250
56 3300042619 Ga0466726_370795 Ga0466726_370795_130_882 250
57 3300042620 Ga0466728_404258 Ga0466728_404258_14683_15435 250
58 3300042623 Ga0466734_133897 Ga0466734_133897_1646_2398 250
59 3300042623 Ga0466734_154502 Ga0466734_154502_270_1022 250
60 3300042624 Ga0466735_231182 Ga0466735_231182_389_1141 250
61 3300042636 Ga0466703_211262 Ga0466703_211262_1444_2196 250
62 3300042643 Ga0466704_130193 Ga0466704_130193_1450_2202 250
63 3300042659 Ga0466733_029574 Ga0466733_029574_2362_3114 250
64 3300042659 Ga0466733_066581 Ga0466733_066581_2663_3415 250
65 3300042659 Ga0466733_184316 Ga0466733_184316_30_782 250
66 iso_pr_bacteria 2820265624 2820267536 250
67 iso_pr_bacteria 2820566695 2820567767 250
68 iso_pr_bacteria 2820757377 2820759719 250
69 iso_pr_bacteria 2820759988 2820761401 250
70 iso_pr_bacteria 2820778767 2820780689 250
71 iso_pr_bacteria 2896321640 2896323786 250
72 iso_pr_bacteria 2896330536 2896332355 250
73 iso_pr_bacteria 2896350215 2896352167 250
74 iso_pr_bacteria 2898741527 2898744430 250
75 iso_pr_bacteria 2940199050 2940199898 250
76 iso_pr_bacteria 2940209341 2940210839 250
77 iso_pr_bacteria 2940216256 2940216687 250
78 iso_pr_bacteria 2940346213 2940346861 250
79 2225789004 2227519383 2228021363 251
80 3300000062 IMNBL1DRAFT_c0000303 IMNBL1DRAFT_000030332 251
81 3300000062 IMNBL1DRAFT_c0000345 IMNBL1DRAFT_000034529 251
82 3300000062 IMNBL1DRAFT_c0001100 IMNBL1DRAFT_00011006 251
83 3300002449 JGI24698J34947_10054383 JGI24698J34947_100543832 251
84 3300002450 JGI24695J34938_10109625 JGI24695J34938_101096252 251
85 3300002462 JGI24702J35022_10000738 JGI24702J35022_1000073813 251
86 3300002462 JGI24702J35022_10045890 JGI24702J35022_100458902 251
87 3300002462 JGI24702J35022_10145228 JGI24702J35022_101452282 251
88 3300002504 JGI24705J35276_12224125 JGI24705J35276_122241252 251
89 3300002509 JGI24699J35502_11134000 JGI24699J35502_1113400021 251
90 3300002509 JGI24699J35502_11134227 JGI24699J35502_1113422752 251
91 3300005201 Ga0072941_1405559 Ga0072941_14055593 251
92 3300007058 Ga0104043_1093643 Ga0104043_10936432 251
93 3300007153 Ga0104050_1002079 Ga0104050_10020797 251
94 3300009784 Ga0123357_10001078 Ga0123357_100010782 251
95 3300009784 Ga0123357_10001255 Ga0123357_100012557 251
96 3300009784 Ga0123357_10006387 Ga0123357_100063879 251
97 3300009784 Ga0123357_10010972 Ga0123357_100109727 251
98 3300009784 Ga0123357_10011226 Ga0123357_100112265 251
99 3300009784 Ga0123357_10012428 Ga0123357_1001242810 251
100 3300009784 Ga0123357_10030758 Ga0123357_100307587 251
101 3300009784 Ga0123357_10105389 Ga0123357_101053894 251
102 3300009784 Ga0123357_10189477 Ga0123357_101894773 251
103 3300009826 Ga0123355_10406681 Ga0123355_104066811 251
104 3300010049 Ga0123356_10000242 Ga0123356_1000024256 251
105 3300010049 Ga0123356_10010107 Ga0123356_100101075 251
106 3300010049 Ga0123356_10145613 Ga0123356_101456134 251
107 3300010049 Ga0123356_10321699 Ga0123356_103216992 251
108 3300010167 Ga0123353_10059700 Ga0123353_100597006 251
109 3300010167 Ga0123353_10371978 Ga0123353_103719783 251
110 3300010882 Ga0123354_10000328 Ga0123354_1000032828 251
111 3300010882 Ga0123354_10002448 Ga0123354_1000244821 251
112 3300010882 Ga0123354_10004885 Ga0123354_1000488516 251
113 3300010882 Ga0123354_10005281 Ga0123354_100052815 251
114 3300010882 Ga0123354_10005439 Ga0123354_1000543913 251
115 3300010882 Ga0123354_10006484 Ga0123354_100064844 251
116 3300010882 Ga0123354_10203287 Ga0123354_102032871 251
117 3300010882 Ga0123354_10597797 Ga0123354_105977971 251
118 3300042590 Ga0466690_138349 Ga0466690_138349_1410_2165 251
119 3300042590 Ga0466690_381813 Ga0466690_381813_3305_4060 251
120 3300042591 Ga0466692_077112 Ga0466692_077112_1740_2495 251
121 3300042592 Ga0466693_093736 Ga0466693_093736_927_1682 251
122 3300042593 Ga0466691_071826 Ga0466691_071826_11824_12579 251
123 3300042596 Ga0466696_040606 Ga0466696_040606_1859_2614 251
124 3300042596 Ga0466696_058283 Ga0466696_058283_30078_30833 251
125 3300042596 Ga0466696_416536 Ga0466696_416536_3181_3936 251
126 3300042596 Ga0466696_483456 Ga0466696_483456_5868_6623 251
127 3300042601 Ga0466707_050759 Ga0466707_050759_2727_3482 251
128 3300042601 Ga0466707_129085 Ga0466707_129085_120_875 251
129 3300042601 Ga0466707_167629 Ga0466707_167629_42413_43168 251
130 3300042602 Ga0466713_042000 Ga0466713_042000_15272_16027 251
131 3300042602 Ga0466713_042033 Ga0466713_042033_9578_10333 251
132 3300042602 Ga0466713_094733 Ga0466713_094733_1501_2256 251
133 3300042603 Ga0466714_018529 Ga0466714_018529_27067_27822 251
134 3300042604 Ga0466717_138477 Ga0466717_138477_276_1031 251
135 3300042604 Ga0466717_197012 Ga0466717_197012_9449_10204 251
136 3300042606 Ga0466719_491579 Ga0466719_491579_5642_6397 251
137 3300042606 Ga0466719_545997 Ga0466719_545997_2954_3709 251
138 3300042609 Ga0466722_016134 Ga0466722_016134_9042_9797 251
139 3300042609 Ga0466722_027463 Ga0466722_027463_171_926 251
140 3300042609 Ga0466722_069017 Ga0466722_069017_15286_16041 251
141 3300042610 Ga0466698_449763 Ga0466698_449763_149_904 251
142 3300042611 Ga0466697_107714 Ga0466697_107714_760_1515 251
143 3300042615 Ga0466711_223085 Ga0466711_223085_866_1621 251
144 3300042615 Ga0466711_289238 Ga0466711_289238_7545_8300 251
145 3300042616 Ga0466715_070660 Ga0466715_070660_5487_6242 251
146 3300042616 Ga0466715_096303 Ga0466715_096303_4001_4756 251
147 3300042616 Ga0466715_566191 Ga0466715_566191_1601_2356 251
148 3300042619 Ga0466726_145169 Ga0466726_145169_689_1444 251
149 3300042619 Ga0466726_218603 Ga0466726_218603_402_1157 251
150 3300042619 Ga0466726_373213 Ga0466726_373213_2203_2958 251
151 3300042621 Ga0466729_143931 Ga0466729_143931_1107_1862 251
152 3300042621 Ga0466729_240911 Ga0466729_240911_878_1633 251
153 3300042636 Ga0466703_137325 Ga0466703_137325_2639_3394 251
154 3300042643 Ga0466704_334341 Ga0466704_334341_1425_2180 251
155 3300042643 Ga0466704_460475 Ga0466704_460475_3421_4176 251
156 3300042648 Ga0466709_375890 Ga0466709_375890_1495_2250 251
157 3300042655 Ga0466727_216925 Ga0466727_216925_232_987 251
158 3300042659 Ga0466733_120525 Ga0466733_120525_2458_3213 251
159 3300056564 Ga0530661_000018 Ga0530661_000018_62166_62921 251
160 3300056564 Ga0530661_000025 Ga0530661_000025_144107_144862 251
161 3300056842 Ga0562377_0028 Ga0562377_0028_706567_707322 251
162 3300056856 Ga0562375_0015 Ga0562375_0015_415041_415796 251
163 3300056857 Ga0562376_0088 Ga0562376_0088_25319_26074 251
164 iso_pr_bacteria 2820442516 2820444775 251
165 iso_pr_bacteria 2834951433 2834952879 251
166 iso_pr_bacteria 2940205530 2940207698 251
167 iso_pr_bacteria 2940298504 2940300667 251
168 iso_pr_bacteria 2940317558 2940319357 251
169 iso_pr_bacteria 8007237282 8007239756 251
170 iso_pr_bacteria 8012939035 8012940807 251
171 iso_pr_bacteria 8018798118 8018800672 251
172 iso_pr_bacteria 8018802046 8018802553 251
173 iso_pr_bacteria 8114537524 8114540618 251
174 iso_pr_bacteria 8114541043 8114542609 251
175 2225789004 2227097482 2227479439 252
176 3300000036 IMNBGM34_c001209 IMNBGM34_0012093 252
177 3300000062 IMNBL1DRAFT_c0000489 IMNBL1DRAFT_00004896 252
178 3300000062 IMNBL1DRAFT_c0001758 IMNBL1DRAFT_00017585 252
179 3300000062 IMNBL1DRAFT_c0024839 IMNBL1DRAFT_00248392 252
180 3300002462 JGI24702J35022_10000485 JGI24702J35022_1000048519 252
181 3300002462 JGI24702J35022_10016372 JGI24702J35022_100163722 252
182 3300002834 JGI24696J40584_12938950 JGI24696J40584_129389502 252
183 3300002931 CVPL010W_10002427 CVPL010W_1000242729 252
184 3300005071 Ga0068302_10169609 Ga0068302_101696092 252
185 3300007149 Ga0104040_1154132 Ga0104040_11541322 252
186 3300009784 Ga0123357_10063888 Ga0123357_100638885 252
187 3300010049 Ga0123356_10171876 Ga0123356_101718762 252
188 3300010049 Ga0123356_10173410 Ga0123356_101734103 252
189 3300010049 Ga0123356_10175807 Ga0123356_101758072 252
190 3300010049 Ga0123356_10572832 Ga0123356_105728322 252
191 3300010049 Ga0123356_10931233 Ga0123356_109312332 252
192 3300010167 Ga0123353_10001822 Ga0123353_1000182211 252
193 3300010167 Ga0123353_10047690 Ga0123353_100476904 252
194 3300010167 Ga0123353_10055946 Ga0123353_100559464 252
195 3300010167 Ga0123353_10067673 Ga0123353_100676735 252
196 3300010167 Ga0123353_10078999 Ga0123353_100789995 252
197 3300010167 Ga0123353_10157048 Ga0123353_101570482 252
198 3300010167 Ga0123353_10276989 Ga0123353_102769894 252
199 3300010167 Ga0123353_10322080 Ga0123353_103220802 252
200 3300010167 Ga0123353_11009090 Ga0123353_110090901 252
201 3300010167 Ga0123353_11272110 Ga0123353_112721101 252
202 3300010882 Ga0123354_10180576 Ga0123354_101805762 252
203 3300010882 Ga0123354_10262374 Ga0123354_102623742 252
204 3300010882 Ga0123354_10300459 Ga0123354_103004591 252
205 3300042582 Ga0466657_092451 Ga0466657_092451_58_816 252
206 3300042591 Ga0466692_030052 Ga0466692_030052_67071_67829 252
207 3300042598 Ga0466701_047395 Ga0466701_047395_3177_3935 252
208 3300042601 Ga0466707_146743 Ga0466707_146743_729_1487 252
209 3300042603 Ga0466714_048239 Ga0466714_048239_54679_55437 252
210 3300042603 Ga0466714_069781 Ga0466714_069781_782_1540 252
211 3300042609 Ga0466722_026149 Ga0466722_026149_9986_10744 252
212 3300042609 Ga0466722_036334 Ga0466722_036334_2888_3646 252
213 3300042609 Ga0466722_204114 Ga0466722_204114_21822_22580 252
214 3300042610 Ga0466698_382854 Ga0466698_382854_207_965 252
215 3300042616 Ga0466715_593195 Ga0466715_593195_2291_3049 252
216 3300042619 Ga0466726_489928 Ga0466726_489928_1349_2107 252
217 3300042621 Ga0466729_099509 Ga0466729_099509_64_822 252
218 3300042636 Ga0466703_319363 Ga0466703_319363_4161_4919 252
219 3300042648 Ga0466709_020764 Ga0466709_020764_6007_6765 252
220 3300042655 Ga0466727_171635 Ga0466727_171635_1331_2089 252
221 iso_pr_bacteria 2820762746 2820762953 252
222 iso_pr_bacteria 643348524 643422674 252
223 3300002509 JGI24699J35502_11133377 JGI24699J35502_111333773 253
224 3300009826 Ga0123355_10022363 Ga0123355_100223636 253
225 3300009826 Ga0123355_10136228 Ga0123355_101362282 253
226 3300010049 Ga0123356_10015847 Ga0123356_100158472 253
227 3300010049 Ga0123356_10026054 Ga0123356_100260544 253
228 3300010049 Ga0123356_10082955 Ga0123356_100829553 253
229 3300010049 Ga0123356_10085804 Ga0123356_100858043 253
230 3300010049 Ga0123356_10109416 Ga0123356_101094163 253
231 3300010049 Ga0123356_10145716 Ga0123356_101457162 253
232 3300010049 Ga0123356_10298508 Ga0123356_102985082 253
233 3300010049 Ga0123356_10310317 Ga0123356_103103172 253
234 3300010049 Ga0123356_10325422 Ga0123356_103254222 253
235 3300010049 Ga0123356_10423703 Ga0123356_104237032 253
236 3300010049 Ga0123356_10472393 Ga0123356_104723932 253
237 3300010049 Ga0123356_10489439 Ga0123356_104894392 253
238 3300010049 Ga0123356_10515377 Ga0123356_105153772 253
239 3300010049 Ga0123356_10660764 Ga0123356_106607642 253
240 3300010049 Ga0123356_10878226 Ga0123356_108782261 253
241 3300010049 Ga0123356_11052117 Ga0123356_110521172 253
242 3300010167 Ga0123353_10028790 Ga0123353_100287906 253
243 3300010167 Ga0123353_10185411 Ga0123353_101854112 253
244 3300010167 Ga0123353_10285120 Ga0123353_102851202 253
245 3300010167 Ga0123353_10621686 Ga0123353_106216862 253
246 3300010167 Ga0123353_11263406 Ga0123353_112634061 253
247 3300010882 Ga0123354_10000047 Ga0123354_1000004721 253
248 3300042604 Ga0466717_057174 Ga0466717_057174_149_910 253
249 3300042604 Ga0466717_184543 Ga0466717_184543_126_887 253
250 3300042609 Ga0466722_252821 Ga0466722_252821_5452_6213 253
251 3300042612 Ga0466705_528022 Ga0466705_528022_6231_6992 253
252 3300042616 Ga0466715_058320 Ga0466715_058320_647_1408 253
253 3300042618 Ga0466723_097479 Ga0466723_097479_1645_2406 253
254 3300042636 Ga0466703_335745 Ga0466703_335745_2729_3490 253
255 3300042655 Ga0466727_215312 Ga0466727_215312_2028_2789 253
256 3300010049 Ga0123356_10054321 Ga0123356_100543213 254
257 3300010049 Ga0123356_10232158 Ga0123356_102321582 254
258 3300010049 Ga0123356_10271944 Ga0123356_102719443 254
259 3300010049 Ga0123356_10326485 Ga0123356_103264851 254
260 3300010167 Ga0123353_10084874 Ga0123353_100848743 254
261 3300010167 Ga0123353_10299802 Ga0123353_102998022 254
262 3300010167 Ga0123353_10699548 Ga0123353_106995481 254
263 3300042602 Ga0466713_075503 Ga0466713_075503_1113_1877 254
264 3300042602 Ga0466713_083056 Ga0466713_083056_1089_1853 254
265 3300042612 Ga0466705_191911 Ga0466705_191911_1608_2372 254
266 3300042643 Ga0466704_107169 Ga0466704_107169_7516_8280 254
267 3300042648 Ga0466709_295596 Ga0466709_295596_2073_2837 254
268 3300010049 Ga0123356_10000210 Ga0123356_1000021057 255
269 3300010049 Ga0123356_10668657 Ga0123356_106686572 255
270 3300010882 Ga0123354_10029978 Ga0123354_100299782 255
271 3300042598 Ga0466701_037990 Ga0466701_037990_7224_7991 255
272 3300010049 Ga0123356_10117888 Ga0123356_101178883 256
273 3300010049 Ga0123356_10253343 Ga0123356_102533432 256
274 3300010049 Ga0123356_10498013 Ga0123356_104980132 256
275 3300042590 Ga0466690_003105 Ga0466690_003105_50004_50774 256
276 3300042604 Ga0466717_059762 Ga0466717_059762_672_1442 256
277 3300042612 Ga0466705_347982 Ga0466705_347982_2242_3012 256
278 3300042616 Ga0466715_231386 Ga0466715_231386_4850_5620 256
279 3300042636 Ga0466703_098553 Ga0466703_098553_1974_2744 256
280 3300042643 Ga0466704_044023 Ga0466704_044023_24135_24905 256
281 3300042643 Ga0466704_048621 Ga0466704_048621_13_783 256
282 3300042643 Ga0466704_067334 Ga0466704_067334_4112_4882 256
283 3300042643 Ga0466704_251441 Ga0466704_251441_1971_2741 256
284 3300002504 JGI24705J35276_12215274 JGI24705J35276_122152742 257
285 3300010167 Ga0123353_10491138 Ga0123353_104911382 257
286 3300042602 Ga0466713_145405 Ga0466713_145405_27488_28261 257
287 3300042612 Ga0466705_319150 Ga0466705_319150_1685_2458 257
288 3300042636 Ga0466703_198952 Ga0466703_198952_926_1699 257
289 iso_pr_bacteria 2940302308 2940304328 257
290 iso_pr_bacteria 2940306115 2940307890 257
291 iso_pr_bacteria 2940309933 2940311847 257
292 iso_pr_bacteria 2940313741 2940315542 257
293 iso_pr_bacteria 2940321370 2940323602 257
294 iso_pr_bacteria 2940325180 2940327341 257
295 iso_pr_bacteria 2940328985 2940331004 257
296 iso_pr_bacteria 2940332795 2940334594 257
297 3300005083 Ga0068305_10167097 Ga0068305_101670977 258
298 3300010049 Ga0123356_10005549 Ga0123356_100055496 258
299 3300042624 Ga0466735_149350 Ga0466735_149350_2483_3259 258
300 iso_pr_bacteria 2967483437 2967485839 258
301 iso_pr_bacteria 2820951912 2820953167 259
302 3300009784 Ga0123357_10033439 Ga0123357_100334398 260
303 3300009826 Ga0123355_10621051 Ga0123355_106210511 260
304 3300010049 Ga0123356_10172600 Ga0123356_101726002 261
305 3300042659 Ga0466733_138016 Ga0466733_138016_3621_4412 263
306 3300010049 Ga0123356_10008707 Ga0123356_100087079 264
307 3300042590 Ga0466690_221039 Ga0466690_221039_11899_12693 264
308 3300042590 Ga0466690_270570 Ga0466690_270570_2815_3609 264
309 3300042619 Ga0466726_327879 Ga0466726_327879_434_1228 264
310 3300010049 Ga0123356_10119933 Ga0123356_101199332 265
311 3300010167 Ga0123353_10008024 Ga0123353_100080246 269
312 3300042616 Ga0466715_223117 Ga0466715_223117_688_1503 271
313 3300010167 Ga0123353_10673787 Ga0123353_106737872 273
314 3300010167 Ga0123353_10710722 Ga0123353_107107221 288

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00977 His_biosynth Histidine biosynthesis protein 41 269 0.98
PF03060 NMO Nitronate monooxygenase 95 143 0.87

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00977 GO:0000105 L-histidine biosynthetic process BP
PF03060 GO:0018580 nitronate monooxygenase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.