Protein Family IF03335

Metagenome Isolate
164 Members
46 Samples
159 Scaffolds
321.1 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10656617|Ga0123353_106566172
Length
362 aa
Sequence
LAAGDSGFCDTRGDHYQCDDQAEPRPNYTAPKGDIGGAMAEKTLSIQKPWSWKQFFFQWEWLLALIFILVNVINSIISPYYLNAGVFLNAPMNFLDKAFIVFPMMLVIMLGRIDISVSSNVALTSVLMAVLYNTGLPMPLALLAALLIGAALGGVTSLLQIKFPELPAMIVTLAAMIIYRGVAYVILQDKASSGFPEWFSFFAWGYVGPFPFILIVFAVVAVIFGIVIHKTGFGRTVYGMGSNLLACKYSGVKTDRVLMIVGLLTGLMCGVCAIFLTSRMGSTRPNIATGYELEVIAMVVLGGVSTSGGTGRIAGPLLAVFVIGFLNYGLGLMNIASQALLIIVGLLLILSVLVMNLRIKK*

📊 Sample Types

Isolate 3.0%
Metagenome 97.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Kalotermitidae 31.1%
Unclassified 11.1%
Termopsidae 6.7%
Rhinotermitidae 4.4%
Scarabaeidae 2.2%

🌳 Taxonomy

Archaea 0
Bacteria 151
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
9 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
10 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
11 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
12 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
13 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
18 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
19 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
20 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
27 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
30 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
31 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
32 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
39 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
40 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
41 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
42 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
43 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
44 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_229487 3300042612 Bacteria 9029
2 Ga0466705_247175 3300042612 Bacteria 6140
3 Ga0466705_348785 3300042612 Bacteria 46858
4 Ga0466732_137461 3300042656 Bacteria 5460
5 Ga0466732_227501 3300042656 Bacteria 3292
6 Ga0466703_332825 3300042636 Bacteria 6732
7 Ga0466708_073807 3300042652 Bacteria 5081
8 Ga0466708_294057 3300042652 Bacteria 6979
9 Ga0123357_10013404 3300009784 Bacteria 10640
10 Ga0123353_10707789 3300010167 Bacteria 1412
11 Ga0466712_159989 3300042614 Unclassified 1368
12 Ga0466715_029661 3300042616 Bacteria 14479
13 Ga0466715_092390 3300042616 Bacteria 8687
14 Ga0466715_117066 3300042616 Bacteria 10570
15 Ga0466723_192604 3300042618 Unclassified 1269
16 Ga0466726_289984 3300042619 Bacteria 1746
17 Ga0466726_308546 3300042619 Bacteria 3242
18 Ga0264413_146090 3300024493 Bacteria 3040
19 Ga0466690_003223 3300042590 Bacteria 10701
20 Ga0466694_155148 3300042594 Bacteria 33595
21 Ga0466694_392238 3300042594 Bacteria 3118
22 Ga0466696_014933 3300042596 Unclassified 2494
23 Ga0466716_487633 3300042605 Unclassified 2831
24 Ga0466716_524264 3300042605 Bacteria 3366
25 Ga0466720_231306 3300042607 Bacteria 3707
26 Ga0466732_033043 3300042656 Bacteria 1587
27 Ga0466703_062086 3300042636 Bacteria 35310
28 Ga0466703_071234 3300042636 Bacteria 32935
29 Ga0466704_181861 3300042643 Bacteria 1282
30 Ga0466704_392671 3300042643 Bacteria 4510
31 Ga0466727_024233 3300042655 Bacteria 3718
32 Ga0123357_10032769 3300009784 Bacteria 7058
33 Ga0123353_10153798 3300010167 Bacteria 3670
34 Ga0123353_10231343 3300010167 Bacteria 2881
35 Ga0466711_325368 3300042615 Bacteria 3524
36 Ga0466715_015876 3300042616 Bacteria 7726
37 Ga0466718_007983 3300042617 Bacteria 11353
38 Ga0466718_149828 3300042617 Bacteria 1737
39 Ga0466723_157692 3300042618 Bacteria 11721
40 Ga0466690_133902 3300042590 Unclassified 1530
41 Ga0466701_034158 3300042598 Bacteria 2601
42 Ga0466700_094570 3300042600 Bacteria 3922
43 Ga0466719_126527 3300042606 Bacteria 12884
44 Ga0466705_161115 3300042612 Bacteria 6549
45 Ga0466733_084293 3300042659 Bacteria 10083
46 Ga0466704_249516 3300042643 Bacteria 1732
47 Ga0466708_313738 3300042652 Bacteria 34279
48 Ga0466727_190677 3300042655 Bacteria 3724
49 Ga0123357_10071409 3300009784 Bacteria 4604
50 Ga0466715_104988 3300042616 Bacteria 7630
51 Ga0466715_276095 3300042616 Bacteria 16435
52 Ga0466715_337385 3300042616 Bacteria 28368
53 Ga0466715_352368 3300042616 Bacteria 41831
54 Ga0466723_005326 3300042618 Bacteria 6054
55 Ga0466692_188577 3300042591 Bacteria 2976
56 Ga0466691_142836 3300042593 Bacteria 24101
57 Ga0466691_216648 3300042593 Bacteria 4893
58 Ga0466696_243964 3300042596 Bacteria 16610
59 Ga0466717_018391 3300042604 Bacteria 1103
60 Ga0466719_126368 3300042606 Bacteria 8275
61 Ga0466722_046317 3300042609 Bacteria 10772
62 Ga0466722_109095 3300042609 Bacteria 5639
63 Ga0466705_245554 3300042612 Bacteria 9805
64 Ga0466733_202852 3300042659 Bacteria 5392
65 Ga0466731_160002 3300042622 Bacteria 1234
66 Ga0466703_099040 3300042636 Bacteria 5331
67 Ga0466704_268625 3300042643 Bacteria 59494
68 Ga0466709_267702 3300042648 Bacteria 14355
69 Ga0466708_319825 3300042652 Unclassified 1892
70 Ga0466727_080537 3300042655 Bacteria 3297
71 Ga0466727_174028 3300042655 Bacteria 2254
72 Ga0123355_10003085 3300009826 Bacteria 23756
73 Ga0466715_126460 3300042616 Bacteria 2517
74 Ga0466715_210750 3300042616 Bacteria 13270
75 Ga0466726_185739 3300042619 Bacteria 5905
76 Ga0466726_326083 3300042619 Bacteria 9566
77 Ga0466728_043318 3300042620 Bacteria 1770
78 Ga0466728_446107 3300042620 Bacteria 10681
79 Ga0466690_014464 3300042590 Bacteria 11796
80 Ga0466696_127694 3300042596 Bacteria 5067
81 Ga0466696_134615 3300042596 Unclassified 1607
82 Ga0466696_434531 3300042596 Bacteria 2827
83 Ga0466719_031011 3300042606 Bacteria 8405
84 AustNasuHG_c1000592 3300000089 Bacteria 12795
85 AustNasuHG_c1002678 3300000089 Bacteria 6431
86 JGI24698J34947_10005126 3300002449 Bacteria 7175
87 JGI24695J34938_10081226 3300002450 Bacteria 1339
88 JGI24702J35022_10001060 3300002462 Bacteria 17188
89 JGI24700J35501_10930275 3300002508 Bacteria 12671
90 Ga0072940_1040449 3300005200 Unclassified 2564
91 Ga0466735_058388 3300042624 Bacteria 11868
92 Ga0466703_207340 3300042636 Bacteria 4568
93 Ga0466704_217137 3300042643 Bacteria 1976
94 Ga0466709_006307 3300042648 Bacteria 4194
95 Ga0466709_190043 3300042648 Bacteria 3338
96 Ga0466712_169748 3300042614 Bacteria 1149
97 Ga0466711_041135 3300042615 Bacteria 9157
98 Ga0466711_176014 3300042615 Bacteria 31697
99 Ga0466715_357043 3300042616 Bacteria 5307
100 Ga0466718_158050 3300042617 Unclassified 1728
101 Ga0466723_057705 3300042618 Bacteria 15524
102 Ga0466728_418452 3300042620 Bacteria 4940
103 Ga0466692_048877 3300042591 Bacteria 18134
104 Ga0466691_050688 3300042593 Bacteria 2118
105 Ga0466700_009874 3300042600 Bacteria 1964
106 Ga0466698_180337 3300042610 Bacteria 2914
107 Ga0072940_1104099 3300005200 Bacteria 1416
108 Ga0466705_068030 3300042612 Bacteria 27444
109 Ga0466705_216735 3300042612 Bacteria 10484
110 Ga0466735_050164 3300042624 Bacteria 20969
111 Ga0466704_115918 3300042643 Unclassified 4540
112 Ga0466704_559996 3300042643 Bacteria 2176
113 Ga0466709_265960 3300042648 Bacteria 10518
114 Ga0466708_246011 3300042652 Bacteria 47079
115 Ga0466708_327322 3300042652 Bacteria 4193
116 Ga0466727_170013 3300042655 Bacteria 1725
117 Ga0466727_218481 3300042655 Bacteria 19155
118 Ga0123357_10115749 3300009784 Bacteria 3398
119 Ga0123353_10656617 3300010167 Bacteria 1483
120 Ga0466711_032012 3300042615 Bacteria 13247
121 Ga0466715_192223 3300042616 Bacteria 3594
122 Ga0466691_012570 3300042593 Bacteria 32910
123 Ga0466691_013607 3300042593 Unclassified 2072
124 Ga0466696_279697 3300042596 Bacteria 2984
125 Ga0466700_110693 3300042600 Bacteria 2109
126 Ga0466716_057758 3300042605 Bacteria 2808
127 Ga0466719_254442 3300042606 Bacteria 20977
128 Ga0466705_020647 3300042612 Bacteria 15474
129 Ga0466704_185777 3300042643 Bacteria 11287
130 Ga0466704_533934 3300042643 Unclassified 1586
131 Ga0466708_467196 3300042652 Bacteria 15542
132 Ga0466727_161083 3300042655 Bacteria 1134
133 Ga0466727_308455 3300042655 Bacteria 22441
134 Ga0466705_474230 3300042612 Bacteria 3028
135 Ga0466712_282692 3300042614 Bacteria 1718
136 Ga0466723_044227 3300042618 Bacteria 4677
137 Ga0466723_079792 3300042618 Bacteria 2200
138 Ga0466726_182054 3300042619 Bacteria 13107
139 Ga0466690_039238 3300042590 Unclassified 1665
140 Ga0466692_046781 3300042591 Bacteria 4682
141 Ga0466691_175646 3300042593 Bacteria 4110
142 Ga0466696_190790 3300042596 Bacteria 5684
143 Ga0466716_061126 3300042605 Bacteria 6240
144 Ga0466719_353863 3300042606 Bacteria 1292
145 Ga0072940_1049412 3300005200 Bacteria 2627
146 Ga0466705_321082 3300042612 Bacteria 4628
147 Ga0466731_416434 3300042622 Bacteria 1305
148 Ga0466703_039954 3300042636 Bacteria 32713
149 Ga0466704_236505 3300042643 Bacteria 15020
150 Ga0466704_365010 3300042643 Bacteria 2764
151 Ga0466704_499057 3300042643 Bacteria 60887
152 Ga0466711_309380 3300042615 Bacteria 9841
153 Ga0466711_367078 3300042615 Bacteria 4888
154 Ga0466711_512684 3300042615 Bacteria 9534
155 Ga0466723_217029 3300042618 Bacteria 6535
156 Ga0466707_239694 3300042601 Bacteria 2577
157 Ga0466722_012969 3300042609 Bacteria 7839
158 AustNasuHG_c1001812 3300000089 Bacteria 7726
159 JGI24698J34947_10005927 3300002449 Bacteria 6703

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042620 Ga0466728_446107 Ga0466728_446107_5349_6275 291
2 3300002450 JGI24695J34938_10081226 JGI24695J34938_100812262 294
3 3300024493 Ga0264413_146090 Ga0264413_1460903 295
4 3300005200 Ga0072940_1049412 Ga0072940_10494122 296
5 3300010167 Ga0123353_10153798 Ga0123353_101537982 297
6 3300042648 Ga0466709_265960 Ga0466709_265960_6361_7353 298
7 3300042656 Ga0466732_137461 Ga0466732_137461_3165_4154 298
8 3300042643 Ga0466704_115918 Ga0466704_115918_1714_2733 300
9 3300009784 Ga0123357_10115749 Ga0123357_101157495 301
10 3300042618 Ga0466723_057705 Ga0466723_057705_9654_10622 301
11 3300042622 Ga0466731_160002 Ga0466731_160002_219_1193 302
12 3300042616 Ga0466715_357043 Ga0466715_357043_2915_3880 303
13 3300042636 Ga0466703_207340 Ga0466703_207340_3341_4327 303
14 3300042643 Ga0466704_185777 Ga0466704_185777_4973_5983 303
15 3300042598 Ga0466701_034158 Ga0466701_034158_255_1169 304
16 3300042624 Ga0466735_050164 Ga0466735_050164_16111_17103 304
17 3300042616 Ga0466715_192223 Ga0466715_192223_1912_2880 305
18 3300042616 Ga0466715_352368 Ga0466715_352368_19324_20352 306
19 3300042643 Ga0466704_217137 Ga0466704_217137_864_1868 306
20 3300042593 Ga0466691_012570 Ga0466691_012570_26270_27271 307
21 3300042618 Ga0466723_044227 Ga0466723_044227_1046_2044 307
22 3300042605 Ga0466716_487633 Ga0466716_487633_629_1597 308
23 3300042619 Ga0466726_326083 Ga0466726_326083_4091_5080 308
24 3300042643 Ga0466704_236505 Ga0466704_236505_9715_10704 308
25 3300042594 Ga0466694_392238 Ga0466694_392238_247_1236 309
26 3300042612 Ga0466705_245554 Ga0466705_245554_7883_8872 309
27 3300042618 Ga0466723_079792 Ga0466723_079792_871_1845 309
28 3300042600 Ga0466700_009874 Ga0466700_009874_186_1175 310
29 3300042612 Ga0466705_020647 Ga0466705_020647_3790_4788 310
30 3300042643 Ga0466704_365010 Ga0466704_365010_490_1497 310
31 3300042600 Ga0466700_110693 Ga0466700_110693_506_1483 312
32 3300042614 Ga0466712_282692 Ga0466712_282692_580_1566 312
33 3300042620 Ga0466728_043318 Ga0466728_043318_485_1453 312
34 3300042618 Ga0466723_192604 Ga0466723_192604_182_1150 313
35 3300042636 Ga0466703_039954 Ga0466703_039954_17114_18100 313
36 3300042593 Ga0466691_175646 Ga0466691_175646_1485_2474 314
37 3300042596 Ga0466696_127694 Ga0466696_127694_1090_2109 314
38 3300042593 Ga0466691_013607 Ga0466691_013607_981_1949 315
39 3300042643 Ga0466704_268625 Ga0466704_268625_19048_20031 315
40 3300042652 Ga0466708_467196 Ga0466708_467196_7166_8152 315
41 3300042616 Ga0466715_092390 Ga0466715_092390_6631_7617 316
42 3300042596 Ga0466696_434531 Ga0466696_434531_1305_2291 317
43 3300042612 Ga0466705_229487 Ga0466705_229487_1054_2043 317
44 3300042636 Ga0466703_332825 Ga0466703_332825_1610_2587 317
45 3300042606 Ga0466719_353863 Ga0466719_353863_91_1080 318
46 3300042612 Ga0466705_068030 Ga0466705_068030_13600_14583 318
47 3300042618 Ga0466723_005326 Ga0466723_005326_3370_4356 318
48 3300042619 Ga0466726_308546 Ga0466726_308546_1306_2262 318
49 3300002449 JGI24698J34947_10005927 JGI24698J34947_100059277 319
50 3300009784 Ga0123357_10032769 Ga0123357_100327692 319
51 3300009784 Ga0123357_10071409 Ga0123357_100714093 319
52 3300042594 Ga0466694_155148 Ga0466694_155148_5261_6241 319
53 3300042612 Ga0466705_216735 Ga0466705_216735_2506_3495 319
54 3300042655 Ga0466727_080537 Ga0466727_080537_741_1727 319
55 3300042591 Ga0466692_046781 Ga0466692_046781_2456_3481 320
56 3300042615 Ga0466711_367078 Ga0466711_367078_2981_3997 320
57 3300042624 Ga0466735_058388 Ga0466735_058388_2502_3494 320
58 3300042616 Ga0466715_117066 Ga0466715_117066_5105_6070 321
59 3300005200 Ga0072940_1104099 Ga0072940_11040992 322
60 3300042590 Ga0466690_003223 Ga0466690_003223_9683_10651 322
61 3300042590 Ga0466690_039238 Ga0466690_039238_58_1026 322
62 3300042590 Ga0466690_133902 Ga0466690_133902_288_1256 322
63 3300042593 Ga0466691_050688 Ga0466691_050688_307_1275 322
64 3300042593 Ga0466691_142836 Ga0466691_142836_8093_9061 322
65 3300042596 Ga0466696_014933 Ga0466696_014933_1071_2039 322
66 3300042596 Ga0466696_190790 Ga0466696_190790_1396_2364 322
67 3300042596 Ga0466696_243964 Ga0466696_243964_731_1699 322
68 3300042596 Ga0466696_279697 Ga0466696_279697_1841_2809 322
69 3300042605 Ga0466716_057758 Ga0466716_057758_620_1588 322
70 3300042605 Ga0466716_524264 Ga0466716_524264_478_1464 322
71 3300042612 Ga0466705_247175 Ga0466705_247175_288_1256 322
72 3300042612 Ga0466705_321082 Ga0466705_321082_936_1904 322
73 3300042612 Ga0466705_474230 Ga0466705_474230_527_1495 322
74 3300042614 Ga0466712_169748 Ga0466712_169748_50_1036 322
75 3300042616 Ga0466715_126460 Ga0466715_126460_731_1699 322
76 3300042616 Ga0466715_276095 Ga0466715_276095_8768_9736 322
77 3300042616 Ga0466715_337385 Ga0466715_337385_14100_15086 322
78 3300042619 Ga0466726_182054 Ga0466726_182054_10322_11308 322
79 3300042620 Ga0466728_418452 Ga0466728_418452_2973_3941 322
80 3300042643 Ga0466704_249516 Ga0466704_249516_37_1005 322
81 3300042648 Ga0466709_006307 Ga0466709_006307_2846_3814 322
82 3300042648 Ga0466709_267702 Ga0466709_267702_4570_5538 322
83 3300042652 Ga0466708_073807 Ga0466708_073807_194_1162 322
84 3300042652 Ga0466708_246011 Ga0466708_246011_9591_10559 322
85 3300042652 Ga0466708_294057 Ga0466708_294057_486_1454 322
86 3300042652 Ga0466708_319825 Ga0466708_319825_219_1187 322
87 3300042655 Ga0466727_024233 Ga0466727_024233_1401_2411 322
88 3300042655 Ga0466727_161083 Ga0466727_161083_41_1009 322
89 3300042655 Ga0466727_170013 Ga0466727_170013_521_1489 322
90 3300042655 Ga0466727_218481 Ga0466727_218481_6970_7956 322
91 3300042656 Ga0466732_227501 Ga0466732_227501_1373_2365 322
92 3300042605 Ga0466716_061126 Ga0466716_061126_3130_4101 323
93 3300042614 Ga0466712_159989 Ga0466712_159989_74_1060 323
94 3300042616 Ga0466715_104988 Ga0466715_104988_882_1871 323
95 3300042619 Ga0466726_185739 Ga0466726_185739_1922_2893 323
96 3300042648 Ga0466709_190043 Ga0466709_190043_319_1317 323
97 3300009826 Ga0123355_10003085 Ga0123355_1000308516 324
98 3300010167 Ga0123353_10231343 Ga0123353_102313432 324
99 3300042609 Ga0466722_012969 Ga0466722_012969_5729_6751 324
100 3300042615 Ga0466711_512684 Ga0466711_512684_2302_3291 324
101 3300042617 Ga0466718_007983 Ga0466718_007983_5264_6238 324
102 3300042617 Ga0466718_149828 Ga0466718_149828_682_1656 324
103 3300042617 Ga0466718_158050 Ga0466718_158050_496_1470 324
104 3300042619 Ga0466726_289984 Ga0466726_289984_189_1181 324
105 3300042622 Ga0466731_416434 Ga0466731_416434_292_1266 324
106 3300042636 Ga0466703_099040 Ga0466703_099040_1836_2810 324
107 3300042655 Ga0466727_174028 Ga0466727_174028_26_1018 324
108 3300042656 Ga0466732_033043 Ga0466732_033043_584_1573 324
109 3300042606 Ga0466719_126368 Ga0466719_126368_465_1442 325
110 3300042609 Ga0466722_046317 Ga0466722_046317_4001_4993 325
111 3300042612 Ga0466705_161115 Ga0466705_161115_5328_6305 325
112 3300042636 Ga0466703_071234 Ga0466703_071234_6746_7723 325
113 3300042643 Ga0466704_181861 Ga0466704_181861_16_993 325
114 3300042643 Ga0466704_533934 Ga0466704_533934_16_993 325
115 3300042643 Ga0466704_559996 Ga0466704_559996_237_1214 325
116 3300042652 Ga0466708_327322 Ga0466708_327322_1258_2262 325
117 iso_pr_bacteria 2819994798 2819996449 326
118 3300002508 JGI24700J35501_10930275 JGI24700J35501_109302756 327
119 3300042600 Ga0466700_094570 Ga0466700_094570_128_1111 327
120 3300042606 Ga0466719_254442 Ga0466719_254442_19444_20427 327
121 3300042636 Ga0466703_062086 Ga0466703_062086_4228_5211 327
122 3300042610 Ga0466698_180337 Ga0466698_180337_1123_2109 328
123 3300042659 Ga0466733_202852 Ga0466733_202852_884_1885 328
124 iso_pr_bacteria 2781125629 2781263077 328
125 iso_pr_bacteria 2781125630 2781265131 328
126 iso_pr_bacteria 2781125693 2781434149 328
127 3300000089 AustNasuHG_c1001812 AustNasuHG_10018122 329
128 3300000089 AustNasuHG_c1002678 AustNasuHG_10026787 329
129 3300002449 JGI24698J34947_10005126 JGI24698J34947_100051265 329
130 3300010167 Ga0123353_10707789 Ga0123353_107077892 329
131 3300042591 Ga0466692_188577 Ga0466692_188577_449_1438 329
132 3300042593 Ga0466691_216648 Ga0466691_216648_1531_2520 329
133 3300042606 Ga0466719_126527 Ga0466719_126527_369_1358 329
134 3300042615 Ga0466711_309380 Ga0466711_309380_3127_4116 329
135 3300042616 Ga0466715_210750 Ga0466715_210750_7339_8328 329
136 3300042652 Ga0466708_313738 Ga0466708_313738_1382_2371 329
137 3300042655 Ga0466727_190677 Ga0466727_190677_1783_2772 329
138 3300000089 AustNasuHG_c1000592 AustNasuHG_10005929 330
139 3300002462 JGI24702J35022_10001060 JGI24702J35022_1000106010 330
140 3300005200 Ga0072940_1040449 Ga0072940_10404493 330
141 3300009784 Ga0123357_10013404 Ga0123357_100134044 330
142 3300042618 Ga0466723_157692 Ga0466723_157692_6427_7419 330
143 3300042590 Ga0466690_014464 Ga0466690_014464_4602_5597 331
144 3300042596 Ga0466696_134615 Ga0466696_134615_94_1089 331
145 3300042604 Ga0466717_018391 Ga0466717_018391_66_1061 331
146 3300042609 Ga0466722_109095 Ga0466722_109095_3453_4448 331
147 3300042612 Ga0466705_348785 Ga0466705_348785_21958_22953 331
148 3300042615 Ga0466711_176014 Ga0466711_176014_10991_11986 331
149 3300042615 Ga0466711_325368 Ga0466711_325368_1813_2808 331
150 3300042616 Ga0466715_029661 Ga0466715_029661_9933_10928 331
151 3300042618 Ga0466723_217029 Ga0466723_217029_1148_2143 331
152 3300042643 Ga0466704_499057 Ga0466704_499057_36163_37158 331
153 3300042591 Ga0466692_048877 Ga0466692_048877_5561_6559 332
154 3300042607 Ga0466720_231306 Ga0466720_231306_1220_2218 332
155 3300042615 Ga0466711_032012 Ga0466711_032012_7341_8339 332
156 3300042659 Ga0466733_084293 Ga0466733_084293_1979_2977 332
157 3300042615 Ga0466711_041135 Ga0466711_041135_4726_5733 335
158 3300042655 Ga0466727_308455 Ga0466727_308455_3129_4211 342
159 3300042606 Ga0466719_031011 Ga0466719_031011_6359_7399 346
160 3300042616 Ga0466715_015876 Ga0466715_015876_5402_6442 346
161 3300042643 Ga0466704_392671 Ga0466704_392671_725_1765 346
162 iso_pr_bacteria 2731957677 2732685875 350
163 3300042601 Ga0466707_239694 Ga0466707_239694_929_1990 353
164 3300010167 Ga0123353_10656617 Ga0123353_106566172 362

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02653 BPD_transp_2 Branched-chain amino acid transport system / permease component 100 351 0.89

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.82 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.