Protein Family IF03326

Metagenome Isolate
117 Members
42 Samples
111 Scaffolds
273.48 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10572550|Ga0123353_105725501
Length
294 aa
Sequence
LFGIFDSINEWLKELFMNGILENFGDMFAEVDSKIGEIATQVGQTPQGWNAGIFDMIRILSDTVVIPIAGIILTFVLCYELIQLIIERNNMHDFETFVFFKWIFKTFCAVYILTHTFDIVMGIFALAQNAVNQSAVTIADRFGFWTPDPMQNPMNILYAALQDMEWYEMLGLYIESGIISLAMNALSICIFIIIYGRMIEIYLTISVAPIPLSTMANREWSGIGNSYLKSLFALAFQGFLIMVCVAIYAILVKNIPNSTNIHSAIWGCLGYTVLLCFTLFKTGSLAKGLFSAH*

πŸ“Š Sample Types

Isolate 5.1%
Metagenome 94.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 48.8%
Kalotermitidae 17.1%
Unclassified 12.2%
Blattidae 7.3%
Passalidae 4.9%
Termopsidae 4.9%
Rhinotermitidae 2.4%
Hodotermitidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
8 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
9 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
10 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
13 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
14 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
15 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
16 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
19 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
20 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
25 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
26 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
30 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
31 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
32 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
33 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
34 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
35 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
36 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
37 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
38 2820414148 Unclassified Firmicutes Lab288P3bin93 Isolate Unclassified
39 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
41 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
42 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_137751 3300042659 Bacteria 1406
2 Ga0466706_285545 3300042599 Unclassified 6804
3 Ga0466700_359474 3300042600 Bacteria 1063
4 Ga0466719_399726 3300042606 Bacteria 6901
5 Ga0123355_10171479 3300009826 Bacteria 3242
6 Ga0123355_10460691 3300009826 Bacteria 1596
7 Ga0123356_10179853 3300010049 Bacteria 2136
8 Ga0123356_10512586 3300010049 Bacteria 1357
9 Ga0123353_10000462 3300010167 Bacteria 50662
10 Ga0123353_10130258 3300010167 Bacteria 4038
11 2227302990 2225789004 Bacteria 30105
12 Ga0466700_491450 3300042600 Bacteria 1558
13 Ga0466714_053061 3300042603 Bacteria 10415
14 Ga0466729_246148 3300042621 Bacteria 1423
15 Ga0466735_231574 3300042624 Bacteria 1687
16 Ga0466725_185168 3300042654 Bacteria 3939
17 Ga0123356_10939753 3300010049 Bacteria 1036
18 Ga0123353_10020947 3300010167 Bacteria 9789
19 Ga0123353_10230541 3300010167 Bacteria 2888
20 Ga0466693_030379 3300042592 Bacteria 3265
21 Ga0466696_328726 3300042596 Bacteria 1455
22 2227496304 2225789004 Bacteria 3924
23 JGI24702J35022_10013915 3300002462 Bacteria 4447
24 JGI24703J35330_11651316 3300002501 Bacteria 1600
25 Ga0466700_390492 3300042600 Bacteria 2282
26 Ga0466714_027115 3300042603 Bacteria 2559
27 Ga0466731_191111 3300042622 Bacteria 2061
28 Ga0466735_193300 3300042624 Bacteria 2207
29 Ga0466708_411893 3300042652 Bacteria 9527
30 Ga0123357_10114086 3300009784 Bacteria 3431
31 Ga0123355_10209922 3300009826 Bacteria 2824
32 Ga0123355_10781581 3300009826 Bacteria 1070
33 Ga0123356_10190932 3300010049 Bacteria 2079
34 Ga0123356_10374667 3300010049 Bacteria 1554
35 Ga0123353_10223165 3300010167 Bacteria 2945
36 Ga0466656_080856 3300042550 Bacteria 1066
37 Ga0466693_234234 3300042592 Bacteria 2425
38 IMNBL1DRAFT_c0009701 3300000062 Bacteria 4715
39 Ga0466733_171051 3300042659 Bacteria 1276
40 Ga0466707_231859 3300042601 Bacteria 1950
41 Ga0466714_037978 3300042603 Bacteria 2601
42 Ga0466714_088947 3300042603 Bacteria 1458
43 Ga0466717_124263 3300042604 Bacteria 1542
44 Ga0466719_522398 3300042606 Bacteria 6470
45 Ga0123357_10085722 3300009784 Bacteria 4123
46 Ga0123356_10028401 3300010049 Bacteria 5241
47 Ga0123356_10289194 3300010049 Bacteria 1738
48 Ga0123353_10259331 3300010167 Bacteria 2686
49 Ga0123353_11195194 3300010167 Bacteria 998
50 JGI24702J35022_10033781 3300002462 Bacteria 2735
51 Ga0466705_065075 3300042612 Bacteria 1360
52 Ga0466705_238343 3300042612 Bacteria 2314
53 Ga0466707_127242 3300042601 Bacteria 25891
54 Ga0466714_033129 3300042603 Bacteria 3908
55 Ga0466714_065248 3300042603 Bacteria 15378
56 Ga0466704_246827 3300042643 Bacteria 22232
57 Ga0123355_10506631 3300009826 Bacteria 1485
58 Ga0123356_10951717 3300010049 Bacteria 1030
59 Ga0123353_10572550 3300010167 Bacteria 1623
60 Ga0466693_253017 3300042592 Bacteria 4164
61 Ga0466696_170379 3300042596 Bacteria 3395
62 Ga0466696_400749 3300042596 Bacteria 2656
63 Ga0466705_028746 3300042612 Bacteria 4316
64 Ga0466700_239612 3300042600 Bacteria 1467
65 Ga0466714_024006 3300042603 Bacteria 24403
66 Ga0466714_043895 3300042603 Bacteria 3072
67 Ga0466719_158628 3300042606 Bacteria 11897
68 Ga0466698_443297 3300042610 Bacteria 1746
69 Ga0466735_168375 3300042624 Bacteria 6222
70 Ga0466735_184428 3300042624 Bacteria 2092
71 Ga0466703_205276 3300042636 Bacteria 2694
72 Ga0466704_039402 3300042643 Bacteria 43042
73 Ga0466725_164049 3300042654 Bacteria 6010
74 Ga0466715_272244 3300042616 Bacteria 9903
75 Ga0466718_065363 3300042617 Bacteria 1632
76 Ga0123356_10540868 3300010049 Bacteria 1325
77 Ga0415639_003061 3300038395 Bacteria 7618
78 Ga0466693_331279 3300042592 Bacteria 2364
79 JGI24695J34938_10001173 3300002450 Unclassified 23306
80 Ga0072941_1213051 3300005201 Bacteria 1565
81 Ga0466705_022808 3300042612 Bacteria 2127
82 Ga0466733_064532 3300042659 Bacteria 2099
83 Ga0466707_125024 3300042601 Bacteria 9495
84 Ga0466713_005228 3300042602 Bacteria 12538
85 Ga0466717_010905 3300042604 Bacteria 2203
86 Ga0466731_145043 3300042622 Bacteria 1240
87 Ga0466704_384918 3300042643 Bacteria 15430
88 Ga0466704_459934 3300042643 Bacteria 36651
89 Ga0466724_17059 3300042649 Bacteria 9603
90 Ga0466727_301368 3300042655 Bacteria 2786
91 Ga0123357_10290845 3300009784 Bacteria 1669
92 Ga0123355_10279160 3300009826 Bacteria 2309
93 Ga0123356_10043019 3300010049 Bacteria 4206
94 Ga0466696_177251 3300042596 Bacteria 2450
95 2227657947 2225789004 Bacteria 10604
96 IMNBL1DRAFT_c0000974 3300000062 Bacteria 22101
97 Ga0466697_099739 3300042611 Bacteria 1616
98 Ga0466706_061001 3300042599 Bacteria 2206
99 Ga0466714_114821 3300042603 Bacteria 3259
100 Ga0466731_192619 3300042622 Bacteria 1560
101 Ga0466715_608328 3300042616 Bacteria 2924
102 Ga0123357_10412192 3300009784 Bacteria 1216
103 Ga0123355_10016254 3300009826 Bacteria 11719
104 Ga0123355_10107247 3300009826 Bacteria 4376
105 Ga0123355_10447577 3300009826 Bacteria 1630
106 Ga0123353_10000645 3300010167 Bacteria 42689
107 Ga0123353_10530384 3300010167 Bacteria 1705
108 Ga0123353_10547938 3300010167 Bacteria 1669
109 Ga0415639_009612 3300038395 Bacteria 3240
110 Ga0466693_146343 3300042592 Bacteria 3583
111 JGI24695J34938_10000059 3300002450 Bacteria 89197

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_359474 Ga0466700_359474_15_725 236
2 3300010167 Ga0123353_10000645 Ga0123353_1000064529 237
3 3300042643 Ga0466704_246827 Ga0466704_246827_514_1374 237
4 3300009784 Ga0123357_10085722 Ga0123357_100857223 238
5 3300009826 Ga0123355_10107247 Ga0123355_101072474 238
6 3300042592 Ga0466693_331279 Ga0466693_331279_270_1139 238
7 3300038395 Ga0415639_009612 Ga0415639_009612_695_1561 240
8 3300010049 Ga0123356_10939753 Ga0123356_109397532 243
9 3300042636 Ga0466703_205276 Ga0466703_205276_1063_1935 243
10 3300042612 Ga0466705_028746 Ga0466705_028746_1764_2633 244
11 3300042643 Ga0466704_039402 Ga0466704_039402_15351_16220 244
12 3300009826 Ga0123355_10781581 Ga0123355_107815812 245
13 2225789004 2227657947 2228256984 246
14 3300009826 Ga0123355_10209922 Ga0123355_102099222 246
15 3300042617 Ga0466718_065363 Ga0466718_065363_519_1370 247
16 3300042603 Ga0466714_043895 Ga0466714_043895_778_1650 248
17 3300042606 Ga0466719_522398 Ga0466719_522398_3202_4071 248
18 3300042612 Ga0466705_065075 Ga0466705_065075_76_942 249
19 3300042659 Ga0466733_137751 Ga0466733_137751_34_903 249
20 2225789004 2227496304 2227973879 250
21 3300010167 Ga0123353_10223165 Ga0123353_102231653 253
22 3300042596 Ga0466696_328726 Ga0466696_328726_166_1041 254
23 3300042601 Ga0466707_125024 Ga0466707_125024_5452_6321 254
24 3300009784 Ga0123357_10114086 Ga0123357_101140862 255
25 3300009826 Ga0123355_10447577 Ga0123355_104475771 255
26 3300000062 IMNBL1DRAFT_c0009701 IMNBL1DRAFT_00097013 256
27 3300010049 Ga0123356_10374667 Ga0123356_103746673 257
28 3300042622 Ga0466731_145043 Ga0466731_145043_179_1045 257
29 3300010049 Ga0123356_10028401 Ga0123356_100284013 259
30 3300010049 Ga0123356_10190932 Ga0123356_101909323 259
31 3300042611 Ga0466697_099739 Ga0466697_099739_66_929 259
32 3300042643 Ga0466704_384918 Ga0466704_384918_6355_7224 259
33 3300042652 Ga0466708_411893 Ga0466708_411893_8645_9511 260
34 3300042624 Ga0466735_231574 Ga0466735_231574_601_1467 261
35 3300042596 Ga0466696_170379 Ga0466696_170379_2074_2937 262
36 3300042599 Ga0466706_061001 Ga0466706_061001_260_1129 262
37 3300042603 Ga0466714_033129 Ga0466714_033129_1043_1903 264
38 3300042603 Ga0466714_114821 Ga0466714_114821_541_1401 264
39 3300042612 Ga0466705_022808 Ga0466705_022808_437_1297 264
40 3300042616 Ga0466715_608328 Ga0466715_608328_1222_2091 264
41 3300010167 Ga0123353_10230541 Ga0123353_102305413 267
42 3300010049 Ga0123356_10289194 Ga0123356_102891942 268
43 3300042606 Ga0466719_399726 Ga0466719_399726_4110_4979 268
44 3300042624 Ga0466735_193300 Ga0466735_193300_250_1113 268
45 3300042655 Ga0466727_301368 Ga0466727_301368_1370_2221 268
46 iso_pr_bacteria 2820501819 2820503843 269
47 3300010167 Ga0123353_10547938 Ga0123353_105479382 271
48 3300042603 Ga0466714_037978 Ga0466714_037978_1506_2375 273
49 3300038395 Ga0415639_003061 Ga0415639_003061_686_1546 275
50 3300009826 Ga0123355_10460691 Ga0123355_104606912 277
51 3300042599 Ga0466706_285545 Ga0466706_285545_966_1829 278
52 3300042604 Ga0466717_124263 Ga0466717_124263_330_1193 279
53 3300010049 Ga0123356_10951717 Ga0123356_109517172 280
54 3300010049 Ga0123356_10043019 Ga0123356_100430195 282
55 3300010167 Ga0123353_10130258 Ga0123353_101302581 282
56 3300042610 Ga0466698_443297 Ga0466698_443297_105_959 284
57 3300042624 Ga0466735_184428 Ga0466735_184428_515_1369 284
58 3300005201 Ga0072941_1213051 Ga0072941_12130511 285
59 3300042654 Ga0466725_164049 Ga0466725_164049_4401_5258 285
60 3300002450 JGI24695J34938_10000059 JGI24695J34938_1000005916 286
61 3300009784 Ga0123357_10412192 Ga0123357_104121921 286
62 3300010167 Ga0123353_10020947 Ga0123353_100209478 286
63 3300010167 Ga0123353_10530384 Ga0123353_105303843 286
64 3300042592 Ga0466693_030379 Ga0466693_030379_613_1473 286
65 3300042592 Ga0466693_253017 Ga0466693_253017_183_1043 286
66 3300042622 Ga0466731_192619 Ga0466731_192619_124_984 286
67 3300002450 JGI24695J34938_10001173 JGI24695J34938_100011737 287
68 3300009826 Ga0123355_10279160 Ga0123355_102791601 287
69 3300009826 Ga0123355_10506631 Ga0123355_105066312 287
70 3300010167 Ga0123353_10259331 Ga0123353_102593312 287
71 3300010167 Ga0123353_11195194 Ga0123353_111951942 287
72 3300042550 Ga0466656_080856 Ga0466656_080856_42_905 287
73 3300042596 Ga0466696_400749 Ga0466696_400749_1543_2406 287
74 3300042600 Ga0466700_239612 Ga0466700_239612_329_1192 287
75 3300042600 Ga0466700_390492 Ga0466700_390492_733_1596 287
76 3300042600 Ga0466700_491450 Ga0466700_491450_446_1309 287
77 3300042603 Ga0466714_027115 Ga0466714_027115_411_1274 287
78 3300042604 Ga0466717_010905 Ga0466717_010905_164_1027 287
79 3300042612 Ga0466705_238343 Ga0466705_238343_1263_2126 287
80 3300042621 Ga0466729_246148 Ga0466729_246148_138_1001 287
81 3300042622 Ga0466731_191111 Ga0466731_191111_62_925 287
82 3300042649 Ga0466724_17059 Ga0466724_17059_5185_6048 287
83 3300042654 Ga0466725_185168 Ga0466725_185168_2100_2963 287
84 3300042659 Ga0466733_064532 Ga0466733_064532_389_1252 287
85 iso_pr_bacteria 2820272499 2820274532 287
86 iso_pr_bacteria 2820414148 2820414160 287
87 3300002462 JGI24702J35022_10013915 JGI24702J35022_100139153 288
88 3300002462 JGI24702J35022_10033781 JGI24702J35022_100337812 288
89 3300002501 JGI24703J35330_11651316 JGI24703J35330_116513162 288
90 3300009784 Ga0123357_10290845 Ga0123357_102908452 288
91 3300009826 Ga0123355_10016254 Ga0123355_100162544 288
92 3300009826 Ga0123355_10171479 Ga0123355_101714794 288
93 3300010049 Ga0123356_10512586 Ga0123356_105125861 288
94 3300010167 Ga0123353_10000462 Ga0123353_1000046212 288
95 3300042592 Ga0466693_146343 Ga0466693_146343_2131_2997 288
96 3300042596 Ga0466696_177251 Ga0466696_177251_1147_2013 288
97 3300042616 Ga0466715_272244 Ga0466715_272244_2331_3197 288
98 2225789004 2227302990 2227752639 289
99 3300042592 Ga0466693_234234 Ga0466693_234234_1425_2294 289
100 3300042601 Ga0466707_127242 Ga0466707_127242_16700_17569 289
101 3300042601 Ga0466707_231859 Ga0466707_231859_356_1225 289
102 3300042602 Ga0466713_005228 Ga0466713_005228_3939_4808 289
103 3300042603 Ga0466714_024006 Ga0466714_024006_4706_5575 289
104 3300042603 Ga0466714_053061 Ga0466714_053061_8873_9742 289
105 3300042603 Ga0466714_065248 Ga0466714_065248_9599_10468 289
106 3300042603 Ga0466714_088947 Ga0466714_088947_353_1222 289
107 3300042606 Ga0466719_158628 Ga0466719_158628_7253_8122 289
108 3300042624 Ga0466735_168375 Ga0466735_168375_3741_4610 289
109 3300042643 Ga0466704_459934 Ga0466704_459934_29090_29959 289
110 3300042659 Ga0466733_171051 Ga0466733_171051_217_1086 289
111 iso_pr_bacteria 2940230426 2940232073 289
112 iso_pr_bacteria 2940233634 2940235163 289
113 iso_pr_bacteria 2940283334 2940285069 289
114 3300000062 IMNBL1DRAFT_c0000974 IMNBL1DRAFT_00009744 290
115 3300010049 Ga0123356_10540868 Ga0123356_105408682 291
116 3300010167 Ga0123353_10572550 Ga0123353_105725501 294
117 3300010049 Ga0123356_10179853 Ga0123356_101798532 301

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF19478 TrbL_2 TrbL/VirB6 plasmid conjugal transfer like protein 31 209 0.94

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.81 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.