Protein Family IF03326
Metagenome
Isolate
117
Members
42
Samples
111
Scaffolds
273.48
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10572550|Ga0123353_105725501
- Length
- 294 aa
- Sequence
- LFGIFDSINEWLKELFMNGILENFGDMFAEVDSKIGEIATQVGQTPQGWNAGIFDMIRILSDTVVIPIAGIILTFVLCYELIQLIIERNNMHDFETFVFFKWIFKTFCAVYILTHTFDIVMGIFALAQNAVNQSAVTIADRFGFWTPDPMQNPMNILYAALQDMEWYEMLGLYIESGIISLAMNALSICIFIIIYGRMIEIYLTISVAPIPLSTMANREWSGIGNSYLKSLFALAFQGFLIMVCVAIYAILVKNIPNSTNIHSAIWGCLGYTVLLCFTLFKTGSLAKGLFSAH*
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.8%
Kalotermitidae
17.1%
Unclassified
12.2%
Blattidae
7.3%
Passalidae
4.9%
Termopsidae
4.9%
Rhinotermitidae
2.4%
Hodotermitidae
2.4%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2940230426 | Lachnospiraceae bacterium PH5-48 | Isolate | Blattidae |
| 8 | 2940283334 | Lachnospiraceae bacterium PF1-4 | Isolate | Blattidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 14 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 15 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 16 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2820272499 | Unclassified Firmicutes Th196P3bin18 | Isolate | Unclassified |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 21 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 22 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 32 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 33 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 34 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 35 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 2940233634 | Lachnoclostridium sp. PF5-10 | Isolate | Blattidae |
| 38 | 2820414148 | Unclassified Firmicutes Lab288P3bin93 | Isolate | Unclassified |
| 39 | 2820501819 | Unclassified Firmicutes Lab288P1bin51 | Isolate | Unclassified |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 42 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_137751 | 3300042659 | Bacteria | 1406 |
| 2 | Ga0466706_285545 | 3300042599 | Unclassified | 6804 |
| 3 | Ga0466700_359474 | 3300042600 | Bacteria | 1063 |
| 4 | Ga0466719_399726 | 3300042606 | Bacteria | 6901 |
| 5 | Ga0123355_10171479 | 3300009826 | Bacteria | 3242 |
| 6 | Ga0123355_10460691 | 3300009826 | Bacteria | 1596 |
| 7 | Ga0123356_10179853 | 3300010049 | Bacteria | 2136 |
| 8 | Ga0123356_10512586 | 3300010049 | Bacteria | 1357 |
| 9 | Ga0123353_10000462 | 3300010167 | Bacteria | 50662 |
| 10 | Ga0123353_10130258 | 3300010167 | Bacteria | 4038 |
| 11 | 2227302990 | 2225789004 | Bacteria | 30105 |
| 12 | Ga0466700_491450 | 3300042600 | Bacteria | 1558 |
| 13 | Ga0466714_053061 | 3300042603 | Bacteria | 10415 |
| 14 | Ga0466729_246148 | 3300042621 | Bacteria | 1423 |
| 15 | Ga0466735_231574 | 3300042624 | Bacteria | 1687 |
| 16 | Ga0466725_185168 | 3300042654 | Bacteria | 3939 |
| 17 | Ga0123356_10939753 | 3300010049 | Bacteria | 1036 |
| 18 | Ga0123353_10020947 | 3300010167 | Bacteria | 9789 |
| 19 | Ga0123353_10230541 | 3300010167 | Bacteria | 2888 |
| 20 | Ga0466693_030379 | 3300042592 | Bacteria | 3265 |
| 21 | Ga0466696_328726 | 3300042596 | Bacteria | 1455 |
| 22 | 2227496304 | 2225789004 | Bacteria | 3924 |
| 23 | JGI24702J35022_10013915 | 3300002462 | Bacteria | 4447 |
| 24 | JGI24703J35330_11651316 | 3300002501 | Bacteria | 1600 |
| 25 | Ga0466700_390492 | 3300042600 | Bacteria | 2282 |
| 26 | Ga0466714_027115 | 3300042603 | Bacteria | 2559 |
| 27 | Ga0466731_191111 | 3300042622 | Bacteria | 2061 |
| 28 | Ga0466735_193300 | 3300042624 | Bacteria | 2207 |
| 29 | Ga0466708_411893 | 3300042652 | Bacteria | 9527 |
| 30 | Ga0123357_10114086 | 3300009784 | Bacteria | 3431 |
| 31 | Ga0123355_10209922 | 3300009826 | Bacteria | 2824 |
| 32 | Ga0123355_10781581 | 3300009826 | Bacteria | 1070 |
| 33 | Ga0123356_10190932 | 3300010049 | Bacteria | 2079 |
| 34 | Ga0123356_10374667 | 3300010049 | Bacteria | 1554 |
| 35 | Ga0123353_10223165 | 3300010167 | Bacteria | 2945 |
| 36 | Ga0466656_080856 | 3300042550 | Bacteria | 1066 |
| 37 | Ga0466693_234234 | 3300042592 | Bacteria | 2425 |
| 38 | IMNBL1DRAFT_c0009701 | 3300000062 | Bacteria | 4715 |
| 39 | Ga0466733_171051 | 3300042659 | Bacteria | 1276 |
| 40 | Ga0466707_231859 | 3300042601 | Bacteria | 1950 |
| 41 | Ga0466714_037978 | 3300042603 | Bacteria | 2601 |
| 42 | Ga0466714_088947 | 3300042603 | Bacteria | 1458 |
| 43 | Ga0466717_124263 | 3300042604 | Bacteria | 1542 |
| 44 | Ga0466719_522398 | 3300042606 | Bacteria | 6470 |
| 45 | Ga0123357_10085722 | 3300009784 | Bacteria | 4123 |
| 46 | Ga0123356_10028401 | 3300010049 | Bacteria | 5241 |
| 47 | Ga0123356_10289194 | 3300010049 | Bacteria | 1738 |
| 48 | Ga0123353_10259331 | 3300010167 | Bacteria | 2686 |
| 49 | Ga0123353_11195194 | 3300010167 | Bacteria | 998 |
| 50 | JGI24702J35022_10033781 | 3300002462 | Bacteria | 2735 |
| 51 | Ga0466705_065075 | 3300042612 | Bacteria | 1360 |
| 52 | Ga0466705_238343 | 3300042612 | Bacteria | 2314 |
| 53 | Ga0466707_127242 | 3300042601 | Bacteria | 25891 |
| 54 | Ga0466714_033129 | 3300042603 | Bacteria | 3908 |
| 55 | Ga0466714_065248 | 3300042603 | Bacteria | 15378 |
| 56 | Ga0466704_246827 | 3300042643 | Bacteria | 22232 |
| 57 | Ga0123355_10506631 | 3300009826 | Bacteria | 1485 |
| 58 | Ga0123356_10951717 | 3300010049 | Bacteria | 1030 |
| 59 | Ga0123353_10572550 | 3300010167 | Bacteria | 1623 |
| 60 | Ga0466693_253017 | 3300042592 | Bacteria | 4164 |
| 61 | Ga0466696_170379 | 3300042596 | Bacteria | 3395 |
| 62 | Ga0466696_400749 | 3300042596 | Bacteria | 2656 |
| 63 | Ga0466705_028746 | 3300042612 | Bacteria | 4316 |
| 64 | Ga0466700_239612 | 3300042600 | Bacteria | 1467 |
| 65 | Ga0466714_024006 | 3300042603 | Bacteria | 24403 |
| 66 | Ga0466714_043895 | 3300042603 | Bacteria | 3072 |
| 67 | Ga0466719_158628 | 3300042606 | Bacteria | 11897 |
| 68 | Ga0466698_443297 | 3300042610 | Bacteria | 1746 |
| 69 | Ga0466735_168375 | 3300042624 | Bacteria | 6222 |
| 70 | Ga0466735_184428 | 3300042624 | Bacteria | 2092 |
| 71 | Ga0466703_205276 | 3300042636 | Bacteria | 2694 |
| 72 | Ga0466704_039402 | 3300042643 | Bacteria | 43042 |
| 73 | Ga0466725_164049 | 3300042654 | Bacteria | 6010 |
| 74 | Ga0466715_272244 | 3300042616 | Bacteria | 9903 |
| 75 | Ga0466718_065363 | 3300042617 | Bacteria | 1632 |
| 76 | Ga0123356_10540868 | 3300010049 | Bacteria | 1325 |
| 77 | Ga0415639_003061 | 3300038395 | Bacteria | 7618 |
| 78 | Ga0466693_331279 | 3300042592 | Bacteria | 2364 |
| 79 | JGI24695J34938_10001173 | 3300002450 | Unclassified | 23306 |
| 80 | Ga0072941_1213051 | 3300005201 | Bacteria | 1565 |
| 81 | Ga0466705_022808 | 3300042612 | Bacteria | 2127 |
| 82 | Ga0466733_064532 | 3300042659 | Bacteria | 2099 |
| 83 | Ga0466707_125024 | 3300042601 | Bacteria | 9495 |
| 84 | Ga0466713_005228 | 3300042602 | Bacteria | 12538 |
| 85 | Ga0466717_010905 | 3300042604 | Bacteria | 2203 |
| 86 | Ga0466731_145043 | 3300042622 | Bacteria | 1240 |
| 87 | Ga0466704_384918 | 3300042643 | Bacteria | 15430 |
| 88 | Ga0466704_459934 | 3300042643 | Bacteria | 36651 |
| 89 | Ga0466724_17059 | 3300042649 | Bacteria | 9603 |
| 90 | Ga0466727_301368 | 3300042655 | Bacteria | 2786 |
| 91 | Ga0123357_10290845 | 3300009784 | Bacteria | 1669 |
| 92 | Ga0123355_10279160 | 3300009826 | Bacteria | 2309 |
| 93 | Ga0123356_10043019 | 3300010049 | Bacteria | 4206 |
| 94 | Ga0466696_177251 | 3300042596 | Bacteria | 2450 |
| 95 | 2227657947 | 2225789004 | Bacteria | 10604 |
| 96 | IMNBL1DRAFT_c0000974 | 3300000062 | Bacteria | 22101 |
| 97 | Ga0466697_099739 | 3300042611 | Bacteria | 1616 |
| 98 | Ga0466706_061001 | 3300042599 | Bacteria | 2206 |
| 99 | Ga0466714_114821 | 3300042603 | Bacteria | 3259 |
| 100 | Ga0466731_192619 | 3300042622 | Bacteria | 1560 |
| 101 | Ga0466715_608328 | 3300042616 | Bacteria | 2924 |
| 102 | Ga0123357_10412192 | 3300009784 | Bacteria | 1216 |
| 103 | Ga0123355_10016254 | 3300009826 | Bacteria | 11719 |
| 104 | Ga0123355_10107247 | 3300009826 | Bacteria | 4376 |
| 105 | Ga0123355_10447577 | 3300009826 | Bacteria | 1630 |
| 106 | Ga0123353_10000645 | 3300010167 | Bacteria | 42689 |
| 107 | Ga0123353_10530384 | 3300010167 | Bacteria | 1705 |
| 108 | Ga0123353_10547938 | 3300010167 | Bacteria | 1669 |
| 109 | Ga0415639_009612 | 3300038395 | Bacteria | 3240 |
| 110 | Ga0466693_146343 | 3300042592 | Bacteria | 3583 |
| 111 | JGI24695J34938_10000059 | 3300002450 | Bacteria | 89197 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042600 | Ga0466700_359474 | Ga0466700_359474_15_725 | 236 |
| 2 | 3300010167 | Ga0123353_10000645 | Ga0123353_1000064529 | 237 |
| 3 | 3300042643 | Ga0466704_246827 | Ga0466704_246827_514_1374 | 237 |
| 4 | 3300009784 | Ga0123357_10085722 | Ga0123357_100857223 | 238 |
| 5 | 3300009826 | Ga0123355_10107247 | Ga0123355_101072474 | 238 |
| 6 | 3300042592 | Ga0466693_331279 | Ga0466693_331279_270_1139 | 238 |
| 7 | 3300038395 | Ga0415639_009612 | Ga0415639_009612_695_1561 | 240 |
| 8 | 3300010049 | Ga0123356_10939753 | Ga0123356_109397532 | 243 |
| 9 | 3300042636 | Ga0466703_205276 | Ga0466703_205276_1063_1935 | 243 |
| 10 | 3300042612 | Ga0466705_028746 | Ga0466705_028746_1764_2633 | 244 |
| 11 | 3300042643 | Ga0466704_039402 | Ga0466704_039402_15351_16220 | 244 |
| 12 | 3300009826 | Ga0123355_10781581 | Ga0123355_107815812 | 245 |
| 13 | 2225789004 | 2227657947 | 2228256984 | 246 |
| 14 | 3300009826 | Ga0123355_10209922 | Ga0123355_102099222 | 246 |
| 15 | 3300042617 | Ga0466718_065363 | Ga0466718_065363_519_1370 | 247 |
| 16 | 3300042603 | Ga0466714_043895 | Ga0466714_043895_778_1650 | 248 |
| 17 | 3300042606 | Ga0466719_522398 | Ga0466719_522398_3202_4071 | 248 |
| 18 | 3300042612 | Ga0466705_065075 | Ga0466705_065075_76_942 | 249 |
| 19 | 3300042659 | Ga0466733_137751 | Ga0466733_137751_34_903 | 249 |
| 20 | 2225789004 | 2227496304 | 2227973879 | 250 |
| 21 | 3300010167 | Ga0123353_10223165 | Ga0123353_102231653 | 253 |
| 22 | 3300042596 | Ga0466696_328726 | Ga0466696_328726_166_1041 | 254 |
| 23 | 3300042601 | Ga0466707_125024 | Ga0466707_125024_5452_6321 | 254 |
| 24 | 3300009784 | Ga0123357_10114086 | Ga0123357_101140862 | 255 |
| 25 | 3300009826 | Ga0123355_10447577 | Ga0123355_104475771 | 255 |
| 26 | 3300000062 | IMNBL1DRAFT_c0009701 | IMNBL1DRAFT_00097013 | 256 |
| 27 | 3300010049 | Ga0123356_10374667 | Ga0123356_103746673 | 257 |
| 28 | 3300042622 | Ga0466731_145043 | Ga0466731_145043_179_1045 | 257 |
| 29 | 3300010049 | Ga0123356_10028401 | Ga0123356_100284013 | 259 |
| 30 | 3300010049 | Ga0123356_10190932 | Ga0123356_101909323 | 259 |
| 31 | 3300042611 | Ga0466697_099739 | Ga0466697_099739_66_929 | 259 |
| 32 | 3300042643 | Ga0466704_384918 | Ga0466704_384918_6355_7224 | 259 |
| 33 | 3300042652 | Ga0466708_411893 | Ga0466708_411893_8645_9511 | 260 |
| 34 | 3300042624 | Ga0466735_231574 | Ga0466735_231574_601_1467 | 261 |
| 35 | 3300042596 | Ga0466696_170379 | Ga0466696_170379_2074_2937 | 262 |
| 36 | 3300042599 | Ga0466706_061001 | Ga0466706_061001_260_1129 | 262 |
| 37 | 3300042603 | Ga0466714_033129 | Ga0466714_033129_1043_1903 | 264 |
| 38 | 3300042603 | Ga0466714_114821 | Ga0466714_114821_541_1401 | 264 |
| 39 | 3300042612 | Ga0466705_022808 | Ga0466705_022808_437_1297 | 264 |
| 40 | 3300042616 | Ga0466715_608328 | Ga0466715_608328_1222_2091 | 264 |
| 41 | 3300010167 | Ga0123353_10230541 | Ga0123353_102305413 | 267 |
| 42 | 3300010049 | Ga0123356_10289194 | Ga0123356_102891942 | 268 |
| 43 | 3300042606 | Ga0466719_399726 | Ga0466719_399726_4110_4979 | 268 |
| 44 | 3300042624 | Ga0466735_193300 | Ga0466735_193300_250_1113 | 268 |
| 45 | 3300042655 | Ga0466727_301368 | Ga0466727_301368_1370_2221 | 268 |
| 46 | iso_pr_bacteria | 2820501819 | 2820503843 | 269 |
| 47 | 3300010167 | Ga0123353_10547938 | Ga0123353_105479382 | 271 |
| 48 | 3300042603 | Ga0466714_037978 | Ga0466714_037978_1506_2375 | 273 |
| 49 | 3300038395 | Ga0415639_003061 | Ga0415639_003061_686_1546 | 275 |
| 50 | 3300009826 | Ga0123355_10460691 | Ga0123355_104606912 | 277 |
| 51 | 3300042599 | Ga0466706_285545 | Ga0466706_285545_966_1829 | 278 |
| 52 | 3300042604 | Ga0466717_124263 | Ga0466717_124263_330_1193 | 279 |
| 53 | 3300010049 | Ga0123356_10951717 | Ga0123356_109517172 | 280 |
| 54 | 3300010049 | Ga0123356_10043019 | Ga0123356_100430195 | 282 |
| 55 | 3300010167 | Ga0123353_10130258 | Ga0123353_101302581 | 282 |
| 56 | 3300042610 | Ga0466698_443297 | Ga0466698_443297_105_959 | 284 |
| 57 | 3300042624 | Ga0466735_184428 | Ga0466735_184428_515_1369 | 284 |
| 58 | 3300005201 | Ga0072941_1213051 | Ga0072941_12130511 | 285 |
| 59 | 3300042654 | Ga0466725_164049 | Ga0466725_164049_4401_5258 | 285 |
| 60 | 3300002450 | JGI24695J34938_10000059 | JGI24695J34938_1000005916 | 286 |
| 61 | 3300009784 | Ga0123357_10412192 | Ga0123357_104121921 | 286 |
| 62 | 3300010167 | Ga0123353_10020947 | Ga0123353_100209478 | 286 |
| 63 | 3300010167 | Ga0123353_10530384 | Ga0123353_105303843 | 286 |
| 64 | 3300042592 | Ga0466693_030379 | Ga0466693_030379_613_1473 | 286 |
| 65 | 3300042592 | Ga0466693_253017 | Ga0466693_253017_183_1043 | 286 |
| 66 | 3300042622 | Ga0466731_192619 | Ga0466731_192619_124_984 | 286 |
| 67 | 3300002450 | JGI24695J34938_10001173 | JGI24695J34938_100011737 | 287 |
| 68 | 3300009826 | Ga0123355_10279160 | Ga0123355_102791601 | 287 |
| 69 | 3300009826 | Ga0123355_10506631 | Ga0123355_105066312 | 287 |
| 70 | 3300010167 | Ga0123353_10259331 | Ga0123353_102593312 | 287 |
| 71 | 3300010167 | Ga0123353_11195194 | Ga0123353_111951942 | 287 |
| 72 | 3300042550 | Ga0466656_080856 | Ga0466656_080856_42_905 | 287 |
| 73 | 3300042596 | Ga0466696_400749 | Ga0466696_400749_1543_2406 | 287 |
| 74 | 3300042600 | Ga0466700_239612 | Ga0466700_239612_329_1192 | 287 |
| 75 | 3300042600 | Ga0466700_390492 | Ga0466700_390492_733_1596 | 287 |
| 76 | 3300042600 | Ga0466700_491450 | Ga0466700_491450_446_1309 | 287 |
| 77 | 3300042603 | Ga0466714_027115 | Ga0466714_027115_411_1274 | 287 |
| 78 | 3300042604 | Ga0466717_010905 | Ga0466717_010905_164_1027 | 287 |
| 79 | 3300042612 | Ga0466705_238343 | Ga0466705_238343_1263_2126 | 287 |
| 80 | 3300042621 | Ga0466729_246148 | Ga0466729_246148_138_1001 | 287 |
| 81 | 3300042622 | Ga0466731_191111 | Ga0466731_191111_62_925 | 287 |
| 82 | 3300042649 | Ga0466724_17059 | Ga0466724_17059_5185_6048 | 287 |
| 83 | 3300042654 | Ga0466725_185168 | Ga0466725_185168_2100_2963 | 287 |
| 84 | 3300042659 | Ga0466733_064532 | Ga0466733_064532_389_1252 | 287 |
| 85 | iso_pr_bacteria | 2820272499 | 2820274532 | 287 |
| 86 | iso_pr_bacteria | 2820414148 | 2820414160 | 287 |
| 87 | 3300002462 | JGI24702J35022_10013915 | JGI24702J35022_100139153 | 288 |
| 88 | 3300002462 | JGI24702J35022_10033781 | JGI24702J35022_100337812 | 288 |
| 89 | 3300002501 | JGI24703J35330_11651316 | JGI24703J35330_116513162 | 288 |
| 90 | 3300009784 | Ga0123357_10290845 | Ga0123357_102908452 | 288 |
| 91 | 3300009826 | Ga0123355_10016254 | Ga0123355_100162544 | 288 |
| 92 | 3300009826 | Ga0123355_10171479 | Ga0123355_101714794 | 288 |
| 93 | 3300010049 | Ga0123356_10512586 | Ga0123356_105125861 | 288 |
| 94 | 3300010167 | Ga0123353_10000462 | Ga0123353_1000046212 | 288 |
| 95 | 3300042592 | Ga0466693_146343 | Ga0466693_146343_2131_2997 | 288 |
| 96 | 3300042596 | Ga0466696_177251 | Ga0466696_177251_1147_2013 | 288 |
| 97 | 3300042616 | Ga0466715_272244 | Ga0466715_272244_2331_3197 | 288 |
| 98 | 2225789004 | 2227302990 | 2227752639 | 289 |
| 99 | 3300042592 | Ga0466693_234234 | Ga0466693_234234_1425_2294 | 289 |
| 100 | 3300042601 | Ga0466707_127242 | Ga0466707_127242_16700_17569 | 289 |
| 101 | 3300042601 | Ga0466707_231859 | Ga0466707_231859_356_1225 | 289 |
| 102 | 3300042602 | Ga0466713_005228 | Ga0466713_005228_3939_4808 | 289 |
| 103 | 3300042603 | Ga0466714_024006 | Ga0466714_024006_4706_5575 | 289 |
| 104 | 3300042603 | Ga0466714_053061 | Ga0466714_053061_8873_9742 | 289 |
| 105 | 3300042603 | Ga0466714_065248 | Ga0466714_065248_9599_10468 | 289 |
| 106 | 3300042603 | Ga0466714_088947 | Ga0466714_088947_353_1222 | 289 |
| 107 | 3300042606 | Ga0466719_158628 | Ga0466719_158628_7253_8122 | 289 |
| 108 | 3300042624 | Ga0466735_168375 | Ga0466735_168375_3741_4610 | 289 |
| 109 | 3300042643 | Ga0466704_459934 | Ga0466704_459934_29090_29959 | 289 |
| 110 | 3300042659 | Ga0466733_171051 | Ga0466733_171051_217_1086 | 289 |
| 111 | iso_pr_bacteria | 2940230426 | 2940232073 | 289 |
| 112 | iso_pr_bacteria | 2940233634 | 2940235163 | 289 |
| 113 | iso_pr_bacteria | 2940283334 | 2940285069 | 289 |
| 114 | 3300000062 | IMNBL1DRAFT_c0000974 | IMNBL1DRAFT_00009744 | 290 |
| 115 | 3300010049 | Ga0123356_10540868 | Ga0123356_105408682 | 291 |
| 116 | 3300010167 | Ga0123353_10572550 | Ga0123353_105725501 | 294 |
| 117 | 3300010049 | Ga0123356_10179853 | Ga0123356_101798532 | 301 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19478 | TrbL_2 | TrbL/VirB6 plasmid conjugal transfer like protein | 31 | 209 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.81 | 0.81 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.