Protein Family IF03304

Metagenome Isolate
151 Members
91 Samples
115 Scaffolds
262.28 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10479639|Ga0123353_104796392
Length
297 aa
Sequence
VKLSRAVYKGKICENAACLLDFSNMNDMESIIIFKIGGNVIDHPPTLEAVLSDFAAWQNRKILVHGGGKIASKLMIKLGIVPKMVDGRRITDRETLEVVTMAYAGLINKNIVAAIQRHGCNAIGLTGADANLITAVKRPVKDIDYGFVGDLNPECISVNTLINFVNSGLVPVIAPITHDGSGLLLNTNADTIASNLAIALAKTFRVQLVFCFEKKGVLRNPDDEQSVIDFLDEALYQQYRDEGVITAGMIPKLDNAFAALHSGVAEVRICNHENLNSGTKINRSQPVITGRIVVDE*

📊 Sample Types

Isolate 23.8%
Metagenome 76.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 20.5%
Cryptocercidae 13.3%
Culicidae 10.8%
Kalotermitidae 8.4%
Armadillidiidae 8.4%
Cicadellidae 6.0%
Unclassified 4.8%
Elmidae 4.8%
Rhinotermitidae 2.4%
Passalidae 2.4%
Corydiidae 2.4%
Drosophilidae 2.4%
Formicidae 2.4%
Termopsidae 2.4%
Hodotermitidae 1.2%
Hydrophilidae 1.2%
Aphrophoridae 1.2%
Daphniidae 1.2%
Apidae 1.2%
Blattellidae 1.2%
Cambaridae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2833034481 Blattabacterium punctulatus CPUwf Isolate Cryptocercidae
2 2904728850 Flavobacterium sp. xlx-214 Isolate
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
6 638341057 Candidatus Sulcia muelleri Hc Isolate Cicadellidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
10 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
11 2833030225 Blattabacterium punctulatus CPUmp Isolate Cryptocercidae
12 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
13 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
17 646564518 Candidatus Sulcia muelleri DMIN (unscreened) Isolate Cicadellidae
18 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
19 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
20 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
21 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
22 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 2833047020 Blattabacterium punctulatus CPUbt Isolate Cryptocercidae
27 2833050843 Blattabacterium punctulatus CPUmc Isolate Cryptocercidae
28 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
29 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
30 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
31 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
34 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
35 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
36 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
37 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
40 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
41 2833037493 Blattabacterium punctulatus CPUsv Isolate Cryptocercidae
42 2833042786 Blattabacterium punctulatus CPUsm Isolate Cryptocercidae
43 2833051446 Blattabacterium punctulatus CPUml Isolate Cryptocercidae
44 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
45 641228484 Candidatus Sulcia muelleri GWSS Isolate Cicadellidae
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3002032411 Blattabacterium cuenoti POLYPHAGsp Isolate Corydiidae
48 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
49 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
50 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
51 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
52 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
53 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
54 3002004002 Blattabacterium cuenoti EUPOLsin Isolate Corydiidae
55 2864836148 Arcicella rosea S00070 Isolate Elmidae
56 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
57 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
58 2718218155 Flavobacteriaceae bacterium UJ101 Isolate
59 2718218185 Candidatus Sulcia muelleri NC Isolate Cicadellidae
60 3002026852 Blattabacterium cuenoti BEYBkur Isolate Blattellidae
61 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
62 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
63 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
64 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
65 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
66 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
67 2833043393 Blattabacterium clevelandi CCLhc Isolate Cryptocercidae
68 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
69 2599185120 Candidatus Sulcia muelleri BGSS Isolate Cicadellidae
70 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
71 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
72 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
73 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
74 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
75 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
76 2833033875 Blattabacterium punctulatus CPUpc Isolate Cryptocercidae
77 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
78 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
79 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
80 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
81 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
82 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
83 2833044002 Blattabacterium punctulatus CPUbr Isolate Cryptocercidae
84 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
85 2511231112 Blattabacterium punctulatus Cpu Isolate Cryptocercidae
86 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
87 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
88 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
89 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
90 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
91 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466700_082314 3300042600 Bacteria 2058
2 Ga0466714_052255 3300042603 Bacteria 17302
3 Ga0123353_10347987 3300010167 Bacteria 2235
4 Ga0123354_10017809 3300010882 Bacteria 11129
5 Ga0123354_10510663 3300010882 Bacteria 930
6 Ga0160460_100045 3300012845 Bacteria 232961
7 Ga0160433_100012 3300012846 Bacteria 265415
8 Ga0160435_1000020 3300012857 Bacteria 147036
9 Ga0466692_025449 3300042591 Bacteria 12448
10 Ga0466733_207009 3300042659 Bacteria 10181
11 Ga0466700_002804 3300042600 Bacteria 7874
12 Ga0123357_10103460 3300009784 Bacteria 3662
13 Ga0123357_10112694 3300009784 Bacteria 3460
14 Ga0123356_10282610 3300010049 Bacteria 1756
15 Ga0123356_11029838 3300010049 Bacteria 993
16 Ga0123353_10479639 3300010167 Bacteria 1820
17 Ga0123354_10005802 3300010882 Bacteria 18105
18 Ga0160464_103719 3300012805 Bacteria 2097
19 Ga0160441_100064 3300012825 Bacteria 139665
20 Ga0265387_1001492 3300024582 Bacteria 3432
21 Ga0466657_244006 3300042582 Bacteria 1020
22 2227513552 2225789004 Bacteria 3501
23 Ga0102734_1003017 3300007129 Bacteria 4318
24 Ga0466697_134583 3300042611 Bacteria 2183
25 Ga0466711_049656 3300042615 Bacteria 7333
26 Ga0466711_131930 3300042615 Bacteria 6622
27 Ga0466714_031498 3300042603 Bacteria 6892
28 Ga0466714_040333 3300042603 Bacteria 3417
29 Ga0123357_10076475 3300009784 Bacteria 4420
30 Ga0123357_10156346 3300009784 Bacteria 2749
31 Ga0123357_10174153 3300009784 Bacteria 2535
32 Ga0123356_10022111 3300010049 Bacteria 6006
33 Ga0123354_10045541 3300010882 Bacteria 6713
34 Ga0123354_10065817 3300010882 Bacteria 5300
35 Ga0123354_10122526 3300010882 Bacteria 3346
36 Ga0123354_10369785 3300010882 Bacteria 1252
37 Ga0160445_107263 3300012847 Bacteria 1761
38 Ga0466692_053965 3300042591 Bacteria 14214
39 Ga0466691_017179 3300042593 Bacteria 4469
40 Ga0466691_039436 3300042593 Bacteria 9462
41 Ga0466696_097705 3300042596 Bacteria 18993
42 Ga0466734_086063 3300042623 Bacteria 1137
43 Ga0466735_225132 3300042624 Bacteria 8588
44 Ga0466708_083951 3300042652 Bacteria 21435
45 Ga0103264_1000022 3300007188 Bacteria 178022
46 Ga0123357_10002170 3300009784 Bacteria 21623
47 Ga0466733_099338 3300042659 Bacteria 1443
48 Ga0466733_149748 3300042659 Unclassified 1092
49 Ga0466713_137226 3300042602 Bacteria 80436
50 Ga0466714_170292 3300042603 Unclassified 1210
51 Ga0466719_034925 3300042606 Bacteria 7896
52 Ga0123357_10005383 3300009784 Bacteria 15315
53 Ga0123354_10097237 3300010882 Bacteria 4014
54 Ga0160468_100141 3300012819 Unclassified 67795
55 Ga0160457_1001115 3300012858 Bacteria 8337
56 Ga0466657_172892 3300042582 Bacteria 3836
57 Meta3P_1008364 3300002464 Bacteria 6575
58 Ga0466733_107402 3300042659 Bacteria 5275
59 Ga0466733_207631 3300042659 Bacteria 3177
60 Ga0466713_030735 3300042602 Bacteria 2173
61 Ga0466713_046052 3300042602 Bacteria 2669
62 Ga0466714_138438 3300042603 Bacteria 3093
63 Ga0123354_10133971 3300010882 Bacteria 3110
64 Ga0160469_100021 3300012824 Bacteria 326466
65 Ga0160469_101374 3300012824 Bacteria 6655
66 Ga0160455_100062 3300012837 Bacteria 204480
67 Ga0160445_100054 3300012847 Bacteria 132397
68 Ga0160457_1001207 3300012858 Bacteria 7808
69 Ga0466734_163987 3300042623 Bacteria 9064
70 JGI24699J35502_11133850 3300002509 Bacteria 17080
71 Ga0104045_1005804 3300007085 Bacteria 3437
72 Ga0466706_002092 3300042599 Bacteria 2347
73 Ga0466713_080175 3300042602 Bacteria 2580
74 Ga0466698_091855 3300042610 Bacteria 3484
75 Ga0123356_10078120 3300010049 Bacteria 3123
76 Ga0123356_11096443 3300010049 Bacteria 964
77 Ga0123353_10735815 3300010167 Bacteria 1376
78 Ga0123354_10093559 3300010882 Bacteria 4131
79 Ga0160466_100006 3300012809 Bacteria 498369
80 Ga0160430_100584 3300012852 Bacteria 18773
81 Ga0466731_252691 3300042622 Bacteria 2826
82 Ga0466735_064509 3300042624 Bacteria 16715
83 Ga0466730_053826 3300042625 Bacteria 92011
84 Ga0466703_398874 3300042636 Archaea 2125
85 Ga0466725_198172 3300042654 Bacteria 1365
86 Ga0068305_10000087 3300005083 Bacteria 586632
87 Ga0104048_1002413 3300007143 Bacteria 15419
88 Ga0123357_10000306 3300009784 Bacteria 46839
89 Ga0466713_152224 3300042602 Bacteria 8280
90 Ga0123357_10397384 3300009784 Bacteria 1259
91 Ga0160445_100027 3300012847 Bacteria 190794
92 Ga0160443_100103 3300012848 Bacteria 135933
93 Ga0160443_101432 3300012848 Unclassified 8083
94 Ga0466692_168579 3300042591 Bacteria 1995
95 Ga0466724_59158 3300042649 Bacteria 434991
96 IMNBGM34_c000764 3300000036 Bacteria 7541
97 Ga0104045_1027581 3300007085 Bacteria 3284
98 Ga0466733_177143 3300042659 Bacteria 3601
99 Ga0466715_295221 3300042616 Bacteria 21128
100 Ga0466715_462246 3300042616 Bacteria 5559
101 Ga0466726_379868 3300042619 Bacteria 5327
102 Ga0466717_024600 3300042604 Bacteria 3222
103 Ga0466719_165796 3300042606 Bacteria 8509
104 Ga0466722_125067 3300042609 Bacteria 1441
105 Ga0466698_425211 3300042610 Bacteria 1076
106 Ga0123357_10237885 3300009784 Bacteria 1979
107 Ga0123353_10188622 3300010167 Bacteria 3257
108 Ga0123353_10660217 3300010167 Bacteria 1478
109 Ga0160453_100018 3300012814 Bacteria 253724
110 Ga0160433_100152 3300012846 Bacteria 59634
111 Ga0160434_100107 3300012850 Bacteria 49722
112 Ga0160436_1005051 3300012861 Bacteria 3115
113 Ga0466696_250156 3300042596 Bacteria 2357
114 Ga0466708_023087 3300042652 Bacteria 8254
115 2227510475 2225789004 Bacteria 3572

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300009784 Ga0123357_10076475 Ga0123357_100764752 238
2 3300007143 Ga0104048_1002413 Ga0104048_100241312 243
3 3300007188 Ga0103264_1000022 Ga0103264_1000022164 244
4 3300042659 Ga0466733_149748 Ga0466733_149748_227_1015 246
5 3300007085 Ga0104045_1027581 Ga0104045_10275812 249
6 iso_pr_bacteria 2718218185 2720434011 254
7 iso_pr_bacteria 646564518 646708210 254
8 2225789004 2227513552 2228010327 255
9 3300042591 Ga0466692_053965 Ga0466692_053965_3676_4443 255
10 3300042593 Ga0466691_017179 Ga0466691_017179_878_1645 255
11 3300042600 Ga0466700_002804 Ga0466700_002804_2727_3494 255
12 3300042602 Ga0466713_046052 Ga0466713_046052_1750_2517 255
13 3300042606 Ga0466719_165796 Ga0466719_165796_1730_2497 255
14 3300042623 Ga0466734_086063 Ga0466734_086063_240_1007 255
15 3300042624 Ga0466735_225132 Ga0466735_225132_4536_5303 255
16 iso_pr_bacteria 2820759988 2820760993 255
17 3300002509 JGI24699J35502_11133850 JGI24699J35502_1113385011 256
18 3300009784 Ga0123357_10000306 Ga0123357_1000030640 256
19 3300009784 Ga0123357_10005383 Ga0123357_1000538311 256
20 3300009784 Ga0123357_10103460 Ga0123357_101034603 256
21 3300009784 Ga0123357_10112694 Ga0123357_101126943 256
22 3300009784 Ga0123357_10174153 Ga0123357_101741534 256
23 3300009784 Ga0123357_10237885 Ga0123357_102378851 256
24 3300010882 Ga0123354_10005802 Ga0123354_1000580212 256
25 3300010882 Ga0123354_10017809 Ga0123354_100178094 256
26 3300010882 Ga0123354_10045541 Ga0123354_100455414 256
27 3300010882 Ga0123354_10097237 Ga0123354_100972373 256
28 3300010882 Ga0123354_10122526 Ga0123354_101225262 256
29 3300042593 Ga0466691_039436 Ga0466691_039436_5547_6317 256
30 3300042596 Ga0466696_097705 Ga0466696_097705_8952_9722 256
31 3300042596 Ga0466696_250156 Ga0466696_250156_1274_2044 256
32 3300042602 Ga0466713_152224 Ga0466713_152224_6733_7503 256
33 3300042616 Ga0466715_295221 Ga0466715_295221_2072_2842 256
34 3300042616 Ga0466715_462246 Ga0466715_462246_385_1155 256
35 3300042636 Ga0466703_398874 Ga0466703_398874_1332_2102 256
36 3300042652 Ga0466708_023087 Ga0466708_023087_7377_8147 256
37 3300042659 Ga0466733_107402 Ga0466733_107402_733_1503 256
38 3300009784 Ga0123357_10156346 Ga0123357_101563462 257
39 3300010049 Ga0123356_11029838 Ga0123356_110298381 257
40 3300010049 Ga0123356_11096443 Ga0123356_110964431 257
41 3300010167 Ga0123353_10188622 Ga0123353_101886223 257
42 3300010167 Ga0123353_10347987 Ga0123353_103479872 257
43 3300010882 Ga0123354_10093559 Ga0123354_100935593 257
44 3300024582 Ga0265387_1001492 Ga0265387_10014923 257
45 3300042591 Ga0466692_025449 Ga0466692_025449_11030_11803 257
46 3300042599 Ga0466706_002092 Ga0466706_002092_301_1074 257
47 3300042603 Ga0466714_052255 Ga0466714_052255_7373_8146 257
48 3300042624 Ga0466735_064509 Ga0466735_064509_13516_14289 257
49 iso_pr_bacteria 2510917001 2510921511 257
50 iso_pr_bacteria 648028014 648180181 257
51 2225789004 2227510475 2228004040 258
52 3300009784 Ga0123357_10397384 Ga0123357_103973842 258
53 3300010049 Ga0123356_10078120 Ga0123356_100781201 258
54 3300042609 Ga0466722_125067 Ga0466722_125067_248_1024 258
55 3300042615 Ga0466711_049656 Ga0466711_049656_6324_7100 258
56 3300042652 Ga0466708_083951 Ga0466708_083951_12268_13044 258
57 3300042659 Ga0466733_207009 Ga0466733_207009_3833_4609 258
58 iso_pr_bacteria 2599185120 2599224927 258
59 3300042602 Ga0466713_030735 Ga0466713_030735_677_1456 259
60 iso_pr_bacteria 2904728850 2904731097 259
61 iso_pr_bacteria 2958471994 2958474174 259
62 iso_pr_bacteria 638341057 638952605 259
63 iso_pr_bacteria 641228484 641331657 259
64 3300042611 Ga0466697_134583 Ga0466697_134583_1372_2154 260
65 3300042659 Ga0466733_099338 Ga0466733_099338_492_1274 260
66 3300007129 Ga0102734_1003017 Ga0102734_10030175 261
67 3300042591 Ga0466692_168579 Ga0466692_168579_968_1753 261
68 3300042603 Ga0466714_040333 Ga0466714_040333_1541_2497 261
69 3300042619 Ga0466726_379868 Ga0466726_379868_369_1154 261
70 3300042623 Ga0466734_163987 Ga0466734_163987_2245_3030 261
71 3300042659 Ga0466733_177143 Ga0466733_177143_2429_3214 261
72 iso_pr_bacteria 2864836148 2864840528 261
73 3300010049 Ga0123356_10282610 Ga0123356_102826102 262
74 3300010882 Ga0123354_10065817 Ga0123354_100658172 262
75 3300010882 Ga0123354_10369785 Ga0123354_103697851 262
76 3300012861 Ga0160436_1005051 Ga0160436_10050514 262
77 iso_pr_bacteria 2718218155 2720330065 262
78 iso_pr_bacteria 2833030225 2833030530 262
79 iso_pr_bacteria 2833033875 2833034181 262
80 iso_pr_bacteria 2833037493 2833037797 262
81 iso_pr_bacteria 2833042786 2833043093 262
82 iso_pr_bacteria 2833047020 2833047324 262
83 iso_pr_bacteria 2833050843 2833051151 262
84 iso_pr_bacteria 2873776654 2873778185 262
85 iso_pr_bacteria 3002004002 3002004319 262
86 3300000036 IMNBGM34_c000764 IMNBGM34_0007644 263
87 3300012805 Ga0160464_103719 Ga0160464_1037192 263
88 3300012819 Ga0160468_100141 Ga0160468_10014141 263
89 3300012825 Ga0160441_100064 Ga0160441_10006493 263
90 3300012846 Ga0160433_100152 Ga0160433_10015234 263
91 3300012847 Ga0160445_100027 Ga0160445_10002777 263
92 3300012848 Ga0160443_101432 Ga0160443_1014323 263
93 3300012858 Ga0160457_1001115 Ga0160457_10011154 263
94 3300012858 Ga0160457_1001207 Ga0160457_10012077 263
95 3300042602 Ga0466713_080175 Ga0466713_080175_713_1504 263
96 3300042602 Ga0466713_137226 Ga0466713_137226_33326_34117 263
97 3300042649 Ga0466724_59158 Ga0466724_59158_147518_148309 263
98 iso_pr_bacteria 2511231112 2511677484 263
99 iso_pr_bacteria 2529292732 2529758952 263
100 iso_pr_bacteria 2833034481 2833034782 263
101 iso_pr_bacteria 2833043393 2833043703 263
102 iso_pr_bacteria 2833044002 2833044303 263
103 iso_pr_bacteria 2833051446 2833051752 263
104 iso_pr_bacteria 2847090942 2847093133 263
105 iso_pr_bacteria 2864788197 2864791015 263
106 iso_pr_bacteria 2864923010 2864925829 263
107 iso_pr_bacteria 2864948220 2864951037 263
108 iso_pr_bacteria 3002026852 3002027176 263
109 iso_pr_bacteria 8020009074 8020012634 263
110 iso_pr_bacteria 8114076984 8114079537 263
111 3300002464 Meta3P_1008364 Meta3P_10083642 264
112 3300005083 Ga0068305_10000087 Ga0068305_10000087337 264
113 3300010049 Ga0123356_10022111 Ga0123356_100221112 264
114 3300010167 Ga0123353_10735815 Ga0123353_107358152 264
115 3300012837 Ga0160455_100062 Ga0160455_10006241 264
116 3300042604 Ga0466717_024600 Ga0466717_024600_2326_3120 264
117 3300009784 Ga0123357_10002170 Ga0123357_100021702 265
118 3300010167 Ga0123353_10660217 Ga0123353_106602172 265
119 3300010882 Ga0123354_10133971 Ga0123354_101339713 265
120 3300012814 Ga0160453_100018 Ga0160453_100018106 265
121 3300012845 Ga0160460_100045 Ga0160460_10004545 265
122 3300042610 Ga0466698_425211 Ga0466698_425211_52_849 265
123 3300042615 Ga0466711_131930 Ga0466711_131930_4946_5743 265
124 3300042625 Ga0466730_053826 Ga0466730_053826_78719_79516 265
125 3300007085 Ga0104045_1005804 Ga0104045_10058042 266
126 3300012809 Ga0160466_100006 Ga0160466_100006379 266
127 3300042603 Ga0466714_138438 Ga0466714_138438_307_1392 266
128 iso_pr_bacteria 3002032411 3002032738 266
129 3300012846 Ga0160433_100012 Ga0160433_10001231 267
130 3300012848 Ga0160443_100103 Ga0160443_10010335 267
131 3300012850 Ga0160434_100107 Ga0160434_10010734 269
132 3300012857 Ga0160435_1000020 Ga0160435_1000020100 269
133 3300042603 Ga0466714_031498 Ga0466714_031498_4868_5704 269
134 3300042610 Ga0466698_091855 Ga0466698_091855_1041_1850 269
135 3300042606 Ga0466719_034925 Ga0466719_034925_5894_6709 271
136 3300012847 Ga0160445_107263 Ga0160445_1072633 276
137 3300042582 Ga0466657_172892 Ga0466657_172892_2544_3374 276
138 3300012852 Ga0160430_100584 Ga0160430_10058410 277
139 3300042659 Ga0466733_207631 Ga0466733_207631_1351_2184 277
140 iso_pr_bacteria 8065497608 8065499735 277
141 3300042654 Ga0466725_198172 Ga0466725_198172_402_1241 279
142 3300012824 Ga0160469_100021 Ga0160469_100021170 281
143 3300010882 Ga0123354_10510663 Ga0123354_105106631 282
144 3300012824 Ga0160469_101374 Ga0160469_1013745 284
145 3300012847 Ga0160445_100054 Ga0160445_10005483 284
146 iso_pr_bacteria 2590828803 2592927027 284
147 3300042622 Ga0466731_252691 Ga0466731_252691_1812_2669 285
148 3300042582 Ga0466657_244006 Ga0466657_244006_122_988 288
149 3300042603 Ga0466714_170292 Ga0466714_170292_79_951 290
150 3300042600 Ga0466700_082314 Ga0466700_082314_986_1864 292
151 3300010167 Ga0123353_10479639 Ga0123353_104796392 297

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00696 AA_kinase Amino acid kinase family 31 271 0.91

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.87 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.