Protein Family IF03302

Metagenome Isolate
145 Members
74 Samples
113 Scaffolds
229.65 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10477562|Ga0123353_104775622
Length
267 aa
Sequence
MTGYDYISSNIEALRRRVEAAAEKSGRKASDIDIIAVSKTKPIEMIIAATKSGLYRFGENRAQELLEKQRAAEAYGIDTAARVIVAEPRGCSSGSTGEAADIDNGNAAGIEWHFIGSLQTNKVRQIVGRTKLIHSLDRFELADEIQRCASKRGIVVDTLVQVNIAKEDSKSGFFHENIEEILIKLSEMRNIRINGLMTIAPFVDDPEENRTFFRALNKIFVDMSMKKMDNVNMAVLSAGMSNDFEVAIEEGANMVRIGTSVFGERI*

📊 Sample Types

Isolate 22.1%
Metagenome 77.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 29.2%
Unclassified 29.2%
Kalotermitidae 18.1%
Blattidae 13.9%
Rhinotermitidae 4.2%
Passalidae 2.8%
Hodotermitidae 1.4%
Termopsidae 1.4%

🌳 Taxonomy

Archaea 2
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
2 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
7 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
8 2590828839 Clostridium sp. 1 Isolate Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
20 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
21 2820619171 Unclassified Firmicutes Emb289P1bin130 Isolate Unclassified
22 2820637417 Unclassified Firmicutes Emb289P1bin108 Isolate Unclassified
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
26 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
29 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
30 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
31 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
32 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
33 2754412482 Unclassified Elusimicrobia Emb289P3bin85 Isolate Unclassified
34 2820290662 Unclassified Firmicutes Th196P3bin135 Isolate Unclassified
35 2820492969 Unclassified Firmicutes Lab288P1bin6 Isolate Unclassified
36 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
37 2820713307 Unclassified Firmicutes Co191P1bin2 Isolate Unclassified
38 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
41 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
42 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
45 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
46 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
47 2772190891 Unclassified Elusimicrobia Emb289P1_bin41 Isolate Unclassified
48 2820319488 Unclassified Firmicutes Nt197P3bin88 Isolate Unclassified
49 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
54 2590828840 Clostridium sp. 2 Isolate Termitidae
55 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
56 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
59 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
60 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
61 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
62 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
63 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
64 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
65 2820282995 Unclassified Firmicutes Th196P3bin147 Isolate Unclassified
66 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
67 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
68 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
69 2593339125 Clostridium sp. 5 Isolate Termitidae
70 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
71 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
72 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
73 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
74 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_259821 3300042612 Bacteria 2113
2 Ga0466733_094999 3300042659 Bacteria 11543
3 Ga0466696_033860 3300042596 Bacteria 26168
4 Ga0466699_384974 3300042597 Bacteria 3717
5 JGI24703J35330_11595272 3300002501 Bacteria 1356
6 Ga0466706_032378 3300042599 Bacteria 30404
7 Ga0466706_172371 3300042599 Bacteria 29745
8 Ga0466706_185797 3300042599 Bacteria 15499
9 Ga0466716_158835 3300042605 Bacteria 1624
10 Ga0466715_107934 3300042616 Bacteria 37998
11 Ga0466705_074496 3300042612 Bacteria 2742
12 Ga0415639_010684 3300038395 Unclassified 1491
13 Ga0466691_127214 3300042593 Bacteria 11182
14 Ga0466694_262844 3300042594 Bacteria 2273
15 Ga0123357_10132419 3300009784 Archaea 3098
16 Ga0123356_10534396 3300010049 Bacteria 1332
17 Ga0123353_10148261 3300010167 Bacteria 3749
18 Ga0123353_10380474 3300010167 Bacteria 2111
19 JGI24702J35022_10000438 3300002462 Bacteria 25142
20 Ga0466714_029359 3300042603 Bacteria 2270
21 Ga0466714_064238 3300042603 Bacteria 1545
22 Ga0466716_093751 3300042605 Bacteria 4551
23 Ga0466719_415738 3300042606 Bacteria 31415
24 Ga0466703_079143 3300042636 Bacteria 4254
25 Ga0466703_250320 3300042636 Bacteria 592480
26 Ga0466705_208745 3300042612 Bacteria 7801
27 Ga0466705_285725 3300042612 Bacteria 2949
28 Ga0456237_0006313 3300041968 Bacteria 1865
29 Ga0466691_009517 3300042593 Bacteria 1097
30 Ga0466691_053196 3300042593 Bacteria 5500
31 Ga0466696_011595 3300042596 Bacteria 4838
32 Ga0123357_10043246 3300009784 Bacteria 6121
33 Ga0123355_10067764 3300009826 Bacteria 5742
34 Ga0123356_10229554 3300010049 Bacteria 1919
35 Ga0123353_10013317 3300010167 Bacteria 11774
36 Ga0123354_10034760 3300010882 Bacteria 7879
37 2227152466 2225789004 Bacteria 1583
38 IMNBL1DRAFT_c0027673 3300000062 Bacteria 2127
39 AustNasuHG_c1016849 3300000089 Bacteria 2439
40 Ga0466706_180157 3300042599 Bacteria 2253
41 Ga0466714_063647 3300042603 Bacteria 1347
42 Ga0466714_104720 3300042603 Bacteria 6585
43 Ga0466711_293800 3300042615 Archaea 7582
44 Ga0466708_131845 3300042652 Bacteria 3640
45 Ga0123355_10228770 3300009826 Bacteria 2660
46 Ga0123353_10000082 3300010167 Bacteria 106066
47 Ga0123353_10240773 3300010167 Bacteria 2811
48 Ga0123354_10000678 3300010882 Unclassified 36133
49 Ga0123354_10322294 3300010882 Unclassified 1424
50 IMNBL1DRAFT_c0000028 3300000062 Bacteria 135353
51 IMNBL1DRAFT_c0051369 3300000062 Bacteria 1298
52 Ga0072940_1580733 3300005200 Bacteria 2126
53 Ga0466706_114969 3300042599 Bacteria 9799
54 Ga0466700_481782 3300042600 Bacteria 1112
55 Ga0466707_120764 3300042601 Bacteria 3073
56 Ga0466714_011312 3300042603 Bacteria 10883
57 Ga0466716_512378 3300042605 Bacteria 2058
58 Ga0466719_395112 3300042606 Bacteria 1638
59 Ga0466715_084831 3300042616 Unclassified 3146
60 Ga0466703_096281 3300042636 Bacteria 1411
61 Ga0466690_104317 3300042590 Bacteria 11630
62 Ga0123355_10739181 3300009826 Bacteria 1116
63 Ga0123356_10974308 3300010049 Bacteria 1018
64 Ga0123354_10089831 3300010882 Bacteria 4260
65 2227507954 2225789004 Bacteria 68559
66 IMNBL1DRAFT_c0000719 3300000062 Bacteria 26318
67 JGI24702J35022_10034689 3300002462 Bacteria 2699
68 Ga0466706_123767 3300042599 Bacteria 4306
69 Ga0466713_010930 3300042602 Bacteria 1489
70 Ga0466713_052392 3300042602 Bacteria 216200
71 Ga0466719_553205 3300042606 Bacteria 2350
72 Ga0466719_553307 3300042606 Bacteria 1236
73 Ga0466698_400157 3300042610 Bacteria 1265
74 Ga0466715_261230 3300042616 Bacteria 2079
75 Ga0466697_263519 3300042611 Bacteria 1651
76 Ga0466733_174480 3300042659 Bacteria 1175
77 Ga0160452_100662 3300012834 Bacteria 17923
78 Ga0466692_065183 3300042591 Bacteria 29706
79 Ga0123355_10003996 3300009826 Bacteria 21347
80 Ga0123355_10102756 3300009826 Bacteria 4494
81 Ga0068302_10261581 3300005071 Bacteria 2274
82 Ga0466706_151671 3300042599 Bacteria 4625
83 Ga0466719_193891 3300042606 Bacteria 3395
84 Ga0466719_524336 3300042606 Bacteria 382683
85 Ga0123355_10000775 3300009826 Bacteria 43658
86 Ga0123356_10000001 3300010049 Bacteria 411946
87 Ga0123353_10477562 3300010167 Bacteria 1825
88 JGI24702J35022_10059969 3300002462 Unclassified 2033
89 Ga0466706_178778 3300042599 Bacteria 21790
90 Ga0466700_185062 3300042600 Bacteria 1709
91 Ga0466700_249837 3300042600 Bacteria 1255
92 Ga0466707_232145 3300042601 Bacteria 1969
93 Ga0466713_077242 3300042602 Bacteria 12347
94 Ga0466716_003199 3300042605 Bacteria 14921
95 Ga0466715_456889 3300042616 Bacteria 238254
96 Ga0466728_029017 3300042620 Bacteria 35653
97 Ga0466729_106043 3300042621 Bacteria 6189
98 Ga0466703_122769 3300042636 Bacteria 3183
99 Ga0466704_545329 3300042643 Bacteria 3747
100 Ga0466697_144079 3300042611 Bacteria 2327
101 Ga0466690_318538 3300042590 Bacteria 1934
102 Ga0466696_116778 3300042596 Bacteria 6285
103 Ga0123355_10292864 3300009826 Bacteria 2231
104 JGI24702J35022_10000998 3300002462 Bacteria 17737
105 Ga0068302_10007354 3300005071 Bacteria 4120
106 Ga0072941_1004049 3300005201 Bacteria 64418
107 Ga0466706_173798 3300042599 Bacteria 56728
108 Ga0466714_133124 3300042603 Bacteria 1674
109 Ga0466719_525725 3300042606 Bacteria 1192
110 Ga0466715_199726 3300042616 Bacteria 77370
111 Ga0466723_220805 3300042618 Bacteria 17867
112 Ga0466702_214429 3300042635 Bacteria 23846
113 Ga0466708_143766 3300042652 Bacteria 5547

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_114969 Ga0466706_114969_1127_1705 192
2 3300042599 Ga0466706_123767 Ga0466706_123767_932_1510 192
3 3300009826 Ga0123355_10003996 Ga0123355_1000399617 196
4 3300042593 Ga0466691_127214 Ga0466691_127214_9595_10200 201
5 3300042596 Ga0466696_116778 Ga0466696_116778_3850_4461 203
6 3300042599 Ga0466706_151671 Ga0466706_151671_3889_4515 208
7 3300042599 Ga0466706_172371 Ga0466706_172371_14425_15054 209
8 3300042605 Ga0466716_003199 Ga0466716_003199_11745_12380 211
9 3300042643 Ga0466704_545329 Ga0466704_545329_2006_2974 214
10 3300010049 Ga0123356_10534396 Ga0123356_105343961 217
11 3300005200 Ga0072940_1580733 Ga0072940_15807332 218
12 3300005201 Ga0072941_1004049 Ga0072941_100404954 218
13 3300042611 Ga0466697_263519 Ga0466697_263519_256_912 218
14 3300010167 Ga0123353_10240773 Ga0123353_102407733 219
15 3300042599 Ga0466706_173798 Ga0466706_173798_23606_24265 219
16 3300042599 Ga0466706_178778 Ga0466706_178778_7280_7939 219
17 3300042606 Ga0466719_553205 Ga0466719_553205_1679_2338 219
18 2225789004 2227507954 2227998429 220
19 3300042606 Ga0466719_525725 Ga0466719_525725_201_863 220
20 3300042612 Ga0466705_285725 Ga0466705_285725_2074_2736 220
21 3300000062 IMNBL1DRAFT_c0000719 IMNBL1DRAFT_000071928 221
22 3300042590 Ga0466690_104317 Ga0466690_104317_6119_6784 221
23 3300042593 Ga0466691_053196 Ga0466691_053196_3805_4470 221
24 3300042596 Ga0466696_011595 Ga0466696_011595_1703_2368 221
25 3300042603 Ga0466714_011312 Ga0466714_011312_2970_3635 221
26 3300042603 Ga0466714_063647 Ga0466714_063647_25_690 221
27 3300042603 Ga0466714_133124 Ga0466714_133124_104_769 221
28 3300042606 Ga0466719_395112 Ga0466719_395112_146_811 221
29 3300042616 Ga0466715_084831 Ga0466715_084831_2245_2910 221
30 3300042616 Ga0466715_261230 Ga0466715_261230_1301_1966 221
31 3300042620 Ga0466728_029017 Ga0466728_029017_22862_23527 221
32 3300042636 Ga0466703_079143 Ga0466703_079143_3356_4021 221
33 3300042652 Ga0466708_143766 Ga0466708_143766_735_1400 221
34 iso_pr_bacteria 2590828839 2593249639 221
35 3300042615 Ga0466711_293800 Ga0466711_293800_5611_6315 223
36 iso_pr_bacteria 2989309576 2989311721 223
37 3300042602 Ga0466713_077242 Ga0466713_077242_8376_9050 224
38 3300042618 Ga0466723_220805 Ga0466723_220805_16163_16837 224
39 3300042590 Ga0466690_318538 Ga0466690_318538_1239_1916 225
40 3300042600 Ga0466700_481782 Ga0466700_481782_55_732 225
41 3300042601 Ga0466707_232145 Ga0466707_232145_82_759 225
42 3300042605 Ga0466716_512378 Ga0466716_512378_70_747 225
43 3300009826 Ga0123355_10067764 Ga0123355_100677642 226
44 3300042599 Ga0466706_032378 Ga0466706_032378_2273_2953 226
45 3300042602 Ga0466713_052392 Ga0466713_052392_143318_143998 226
46 3300042606 Ga0466719_553307 Ga0466719_553307_456_1136 226
47 iso_pr_bacteria 2590828840 2593255271 226
48 iso_pr_bacteria 2593339125 2595067033 226
49 iso_pr_bacteria 2820501819 2820503240 226
50 iso_pr_bacteria 2820535361 2820536416 226
51 3300009826 Ga0123355_10739181 Ga0123355_107391811 227
52 3300042605 Ga0466716_093751 Ga0466716_093751_1441_2124 227
53 3300042612 Ga0466705_074496 Ga0466705_074496_1212_1895 227
54 iso_pr_bacteria 2820290662 2820290921 227
55 iso_pr_bacteria 2902916284 2902920047 227
56 3300042635 Ga0466702_214429 Ga0466702_214429_11325_12011 228
57 3300042659 Ga0466733_094999 Ga0466733_094999_2958_3644 228
58 iso_pr_bacteria 2820619171 2820620082 228
59 iso_pr_bacteria 2820713307 2820713853 228
60 3300009784 Ga0123357_10132419 Ga0123357_101324193 229
61 3300042606 Ga0466719_415738 Ga0466719_415738_15165_15854 229
62 3300042616 Ga0466715_107934 Ga0466715_107934_14658_15347 229
63 iso_pr_bacteria 2940230426 2940231230 229
64 iso_pr_bacteria 2940233634 2940234435 229
65 iso_pr_bacteria 2940277027 2940277395 229
66 iso_pr_bacteria 2940280053 2940280586 229
67 iso_pr_bacteria 2940283334 2940283969 229
68 iso_pr_bacteria 2940286528 2940286645 229
69 iso_pr_bacteria 2940289514 2940289813 229
70 iso_pr_bacteria 2940292506 2940292992 229
71 iso_pr_bacteria 2940295490 2940295789 229
72 iso_pr_bacteria 2944625312 2944625844 229
73 3300002462 JGI24702J35022_10034689 JGI24702J35022_100346894 230
74 3300002462 JGI24702J35022_10059969 JGI24702J35022_100599692 230
75 3300042601 Ga0466707_120764 Ga0466707_120764_1672_2364 230
76 3300042606 Ga0466719_524336 Ga0466719_524336_66064_66756 230
77 iso_pr_bacteria 2820282995 2820284504 230
78 3300000089 AustNasuHG_c1016849 AustNasuHG_10168493 231
79 3300002462 JGI24702J35022_10000438 JGI24702J35022_1000043818 231
80 3300041968 Ga0456237_0006313 Ga0456237_0006313_340_1035 231
81 3300042591 Ga0466692_065183 Ga0466692_065183_1092_1787 231
82 3300042603 Ga0466714_064238 Ga0466714_064238_326_1021 231
83 3300042616 Ga0466715_456889 Ga0466715_456889_207218_207913 231
84 3300042636 Ga0466703_250320 Ga0466703_250320_200408_201103 231
85 3300042659 Ga0466733_174480 Ga0466733_174480_146_841 231
86 iso_pr_bacteria 2820319488 2820320551 231
87 iso_pr_bacteria 2820593525 2820594620 231
88 2225789004 2227152466 2227558780 232
89 3300000062 IMNBL1DRAFT_c0051369 IMNBL1DRAFT_00513692 232
90 3300002501 JGI24703J35330_11595272 JGI24703J35330_115952722 232
91 3300009826 Ga0123355_10228770 Ga0123355_102287704 232
92 3300009826 Ga0123355_10292864 Ga0123355_102928644 232
93 3300010049 Ga0123356_10229554 Ga0123356_102295541 232
94 3300010167 Ga0123353_10000082 Ga0123353_10000082103 232
95 3300042597 Ga0466699_384974 Ga0466699_384974_1165_1863 232
96 3300042612 Ga0466705_259821 Ga0466705_259821_744_1490 232
97 iso_pr_bacteria 2754412483 2755216717 232
98 iso_pr_bacteria 2772190892 2773436641 232
99 iso_pr_bacteria 2820637417 2820638147 232
100 3300000062 IMNBL1DRAFT_c0000028 IMNBL1DRAFT_0000028107 233
101 3300000062 IMNBL1DRAFT_c0027673 IMNBL1DRAFT_00276732 233
102 3300009826 Ga0123355_10102756 Ga0123355_101027562 233
103 3300010882 Ga0123354_10000678 Ga0123354_1000067819 233
104 3300012834 Ga0160452_100662 Ga0160452_10066212 233
105 iso_pr_bacteria 2636416028 2638993542 233
106 3300005071 Ga0068302_10007354 Ga0068302_100073543 234
107 3300010049 Ga0123356_10974308 Ga0123356_109743082 234
108 3300010167 Ga0123353_10013317 Ga0123353_1001331715 234
109 3300010167 Ga0123353_10380474 Ga0123353_103804743 234
110 3300042599 Ga0466706_180157 Ga0466706_180157_1171_1875 234
111 3300042652 Ga0466708_131845 Ga0466708_131845_1580_2284 234
112 iso_pr_bacteria 2820836992 2820837354 234
113 3300010882 Ga0123354_10034760 Ga0123354_100347606 235
114 3300038395 Ga0415639_010684 Ga0415639_010684_32_739 235
115 3300042610 Ga0466698_400157 Ga0466698_400157_339_1046 235
116 3300042600 Ga0466700_185062 Ga0466700_185062_653_1363 236
117 3300042603 Ga0466714_104720 Ga0466714_104720_5502_6212 236
118 iso_pr_bacteria 2754412482 2755214881 236
119 iso_pr_bacteria 2772190891 2773434841 236
120 iso_pr_bacteria 2820272499 2820273471 236
121 3300010049 Ga0123356_10000001 Ga0123356_10000001135 237
122 3300010167 Ga0123353_10148261 Ga0123353_101482613 237
123 3300042596 Ga0466696_033860 Ga0466696_033860_5897_6610 237
124 3300042599 Ga0466706_185797 Ga0466706_185797_2427_3140 237
125 3300042602 Ga0466713_010930 Ga0466713_010930_519_1268 237
126 3300042594 Ga0466694_262844 Ga0466694_262844_801_1517 238
127 3300042603 Ga0466714_029359 Ga0466714_029359_1484_2200 238
128 3300042621 Ga0466729_106043 Ga0466729_106043_4899_5615 238
129 3300042612 Ga0466705_208745 Ga0466705_208745_2529_3440 240
130 3300042636 Ga0466703_122769 Ga0466703_122769_2202_2930 242
131 3300005071 Ga0068302_10261581 Ga0068302_102615812 243
132 3300009784 Ga0123357_10043246 Ga0123357_100432466 243
133 3300042593 Ga0466691_009517 Ga0466691_009517_303_1034 243
134 3300042600 Ga0466700_249837 Ga0466700_249837_288_1022 244
135 iso_pr_bacteria 2820492969 2820493384 245
136 3300042616 Ga0466715_199726 Ga0466715_199726_8623_9366 247
137 3300009826 Ga0123355_10000775 Ga0123355_1000077543 249
138 3300010882 Ga0123354_10089831 Ga0123354_100898314 249
139 3300042611 Ga0466697_144079 Ga0466697_144079_1179_1937 252
140 3300042605 Ga0466716_158835 Ga0466716_158835_156_947 263
141 3300042606 Ga0466719_193891 Ga0466719_193891_2258_3049 263
142 3300002462 JGI24702J35022_10000998 JGI24702J35022_1000099815 264
143 3300010882 Ga0123354_10322294 Ga0123354_103222942 264
144 3300042636 Ga0466703_096281 Ga0466703_096281_48_842 264
145 3300010167 Ga0123353_10477562 Ga0123353_104775622 267

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01168 Ala_racemase_N Alanine racemase, N-terminal domain 10 264 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.