Protein Family IF03299

Metagenome Isolate
127 Members
56 Samples
110 Scaffolds
402.5 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10462950|Ga0123353_104629502
Length
480 aa
Sequence
MLSKLPTFQSQEHSKNAILKCLCAFQHIFHITRNKKVTNEMSRKSKKIFQKYSDIFELFLLLYKKKYFSEDLENDISRRIMVTANLNQTPISERMHIAFFGMRNAGKSSLINAVTGQELAIISPVPGTTTDPVHKTMELLPLGPVVLIDTPGIDDSGELGAQRINKTHQVLNKTDAAILVVDVNCELSKEDEELIELFREKKIPYIIALNKSDLKIGQERSTSAEYIFVSALTGQGIHELKERIAGLCKSDEPQHRLVTDLIDPSDFVVLVTPIDKAAPKGRLILPQQQVIRDILEANAVSIVTKENEFKNVLKNLAKKPRMIITDSQIFDKVAADTPHDIPLTSFSILMARYKGLLDDAVRSVKAIEHIEDGDKILIAEGCTHHRQCDDIGSVKLPRWIKNHTGKHPEFCFCSGAGFPSDLADYKLIVHCGGCMLNTREMQSRAQTAKRAGVPMTNYGILIACMQGILKRSIGIFPHL*

πŸ“Š Sample Types

Isolate 13.4%
Metagenome 86.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 36.4%
Termitidae 27.3%
Kalotermitidae 25.5%
Rhinotermitidae 5.5%
Termopsidae 3.6%
Hodotermitidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
2 2820072841 Unclassified Proteobacteria Nt197P3bin127 Isolate Unclassified
3 2820481688 Unclassified Firmicutes Lab288P1bin76 Isolate Unclassified
4 2820623020 Unclassified Firmicutes Emb289P1bin126 Isolate Unclassified
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
12 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
13 2820487239 Unclassified Firmicutes Lab288P1bin71 Isolate Unclassified
14 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
15 2820661146 Unclassified Firmicutes Co191P3bin61 Isolate Unclassified
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2820068815 Unclassified Proteobacteria Nt197P3bin4 Isolate Unclassified
24 2820464928 Unclassified Firmicutes Lab288P3bin121 Isolate Unclassified
25 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
26 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
27 2820690275 Unclassified Firmicutes Co191P1bin72 Isolate Unclassified
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 2820391468 Unclassified Firmicutes Nc150P3bin1 Isolate Unclassified
38 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
39 2820654856 Unclassified Firmicutes Cu122P1bin2 Isolate Unclassified
40 2758568796 Unclassified Deltaproteobacteria Th196P3_bin21 Isolate Unclassified
41 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
42 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
43 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
44 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
45 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
46 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
47 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
50 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
51 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
52 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
53 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
54 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
55 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1003142 3300000089 Bacteria 5956
2 AustNasuHG_c1027271 3300000089 Bacteria 1751
3 Ga0072940_1045225 3300005200 Bacteria 2447
4 Ga0123355_10146201 3300009826 Bacteria 3604
5 Ga0466706_107717 3300042599 Bacteria 7822
6 Ga0466713_046058 3300042602 Bacteria 20148
7 Ga0466719_415738 3300042606 Bacteria 31415
8 Ga0466720_026231 3300042607 Bacteria 14005
9 Ga0466698_377915 3300042610 Bacteria 3459
10 Ga0466691_178068 3300042593 Bacteria 1940
11 Ga0466723_006847 3300042618 Bacteria 9810
12 Ga0466703_337570 3300042636 Bacteria 7107
13 Ga0072940_1107829 3300005200 Bacteria 2563
14 Ga0123353_10001504 3300010167 Bacteria 28566
15 Ga0123353_10004353 3300010167 Bacteria 18220
16 Ga0466716_464066 3300042605 Bacteria 4626
17 Ga0466722_104430 3300042609 Bacteria 11163
18 Ga0466698_230914 3300042610 Bacteria 2206
19 Ga0466690_120505 3300042590 Bacteria 12764
20 Ga0466705_127615 3300042612 Bacteria 2724
21 Ga0466705_131741 3300042612 Bacteria 27262
22 Ga0123355_10065004 3300009826 Bacteria 5875
23 Ga0123356_10003415 3300010049 Bacteria 16643
24 Ga0123356_10036556 3300010049 Bacteria 4585
25 Ga0123353_10014815 3300010167 Bacteria 11273
26 Ga0466707_307614 3300042601 Bacteria 54795
27 Ga0466713_117049 3300042602 Bacteria 6094
28 Ga0466720_014873 3300042607 Bacteria 17297
29 Ga0466692_098045 3300042591 Bacteria 5630
30 Ga0466691_078853 3300042593 Bacteria 14289
31 Ga0466705_425307 3300042612 Bacteria 10180
32 Ga0466723_342020 3300042618 Bacteria 8898
33 Ga0466729_171889 3300042621 Bacteria 1774
34 Ga0466704_464165 3300042643 Bacteria 7440
35 AustNasuHG_c1023467 3300000089 Bacteria 1968
36 JGI24695J34938_10013553 3300002450 Unclassified 4274
37 Ga0068305_10004849 3300005083 Bacteria 48980
38 Ga0123353_10066709 3300010167 Bacteria 5777
39 Ga0123353_10462950 3300010167 Bacteria 1862
40 Ga0466715_096905 3300042616 Bacteria 21950
41 Ga0466715_197839 3300042616 Bacteria 8941
42 Ga0466718_170218 3300042617 Bacteria 3234
43 Ga0466723_029068 3300042618 Bacteria 62461
44 Ga0466723_367083 3300042618 Bacteria 3629
45 Ga0466729_025273 3300042621 Bacteria 16408
46 Ga0466703_026307 3300042636 Bacteria 33930
47 Ga0466704_029296 3300042643 Unclassified 1873
48 Ga0466727_134685 3300042655 Bacteria 2565
49 AustNasuHG_c1009599 3300000089 Bacteria 3391
50 Ga0123355_10457485 3300009826 Bacteria 1604
51 Ga0123356_10045708 3300010049 Bacteria 4074
52 Ga0466706_013636 3300042599 Bacteria 55525
53 Ga0466714_034143 3300042603 Bacteria 3137
54 Ga0466714_111268 3300042603 Bacteria 7329
55 Ga0466690_232584 3300042590 Bacteria 6542
56 Ga0466715_094268 3300042616 Bacteria 48463
57 Ga0466718_042383 3300042617 Bacteria 4578
58 Ga0466723_058021 3300042618 Bacteria 2242
59 Ga0466723_190304 3300042618 Bacteria 8181
60 Ga0466729_228310 3300042621 Bacteria 5950
61 Ga0466703_251170 3300042636 Bacteria 3296
62 Ga0466703_364622 3300042636 Bacteria 8517
63 Ga0466704_046152 3300042643 Bacteria 2503
64 Ga0466709_115669 3300042648 Bacteria 217304
65 Ga0466708_052039 3300042652 Bacteria 36354
66 Ga0466705_171514 3300042612 Bacteria 66002
67 Ga0466705_246311 3300042612 Bacteria 11069
68 AustNasuHG_c1001115 3300000089 Bacteria 9680
69 Ga0123355_10214137 3300009826 Bacteria 2785
70 Ga0123353_10196919 3300010167 Bacteria 3175
71 Ga0466696_196668 3300042596 Bacteria 24129
72 Ga0466723_001478 3300042618 Bacteria 12520
73 Ga0466704_302638 3300042643 Bacteria 3084
74 Ga0466705_022138 3300042612 Bacteria 8156
75 Ga0466705_032803 3300042612 Bacteria 6258
76 JGI24698J34947_10004953 3300002449 Bacteria 7301
77 Ga0074263_104627 3300005485 Bacteria 1920
78 Ga0123355_10029304 3300009826 Bacteria 8907
79 Ga0123355_10029715 3300009826 Bacteria 8852
80 Ga0466706_026793 3300042599 Bacteria 18030
81 Ga0466707_159669 3300042601 Bacteria 505639
82 Ga0264413_108352 3300024493 Bacteria 9200
83 Ga0466696_215724 3300042596 Bacteria 1627
84 Ga0466705_453255 3300042612 Bacteria 7157
85 Ga0466711_243757 3300042615 Bacteria 10062
86 Ga0466718_136296 3300042617 Bacteria 4791
87 Ga0466718_167832 3300042617 Bacteria 5294
88 Ga0466726_155806 3300042619 Bacteria 20529
89 Ga0466728_137320 3300042620 Bacteria 7589
90 Ga0466703_321083 3300042636 Bacteria 103995
91 Ga0466708_407719 3300042652 Bacteria 1798
92 Ga0466708_429360 3300042652 Bacteria 5865
93 JGI24695J34938_10000851 3300002450 Bacteria 28281
94 Ga0123355_10000016 3300009826 Bacteria 163334
95 Ga0123355_10000098 3300009826 Bacteria 93935
96 Ga0123355_10000279 3300009826 Bacteria 65611
97 Ga0123355_10107090 3300009826 Bacteria 4380
98 Ga0123356_10084940 3300010049 Bacteria 3001
99 Ga0123356_10171251 3300010049 Unclassified 2182
100 Ga0466707_322802 3300042601 Bacteria 14394
101 Ga0466722_009326 3300042609 Bacteria 7148
102 Ga0264413_123328 3300024493 Bacteria 3223
103 Ga0415639_191170 3300038395 Bacteria 1703
104 Ga0466693_051980 3300042592 Bacteria 1338
105 Ga0466715_081391 3300042616 Bacteria 24207
106 Ga0466715_203451 3300042616 Bacteria 9301
107 Ga0466715_284009 3300042616 Bacteria 28343
108 Ga0466723_228747 3300042618 Bacteria 2938
109 Ga0466703_392329 3300042636 Bacteria 2220
110 Ga0466724_20148 3300042649 Bacteria 5889

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042636 Ga0466703_392329 Ga0466703_392329_1108_2151 347
2 3300042618 Ga0466723_029068 Ga0466723_029068_51984_53036 350
3 iso_pr_bacteria 2820391468 2820391918 352
4 3300042593 Ga0466691_078853 Ga0466691_078853_6980_8104 374
5 3300042592 Ga0466693_051980 Ga0466693_051980_149_1279 376
6 iso_pr_bacteria 2820623020 2820623939 383
7 3300009826 Ga0123355_10000279 Ga0123355_1000027957 384
8 3300009826 Ga0123355_10107090 Ga0123355_101070906 384
9 3300042612 Ga0466705_453255 Ga0466705_453255_3968_5122 384
10 3300009826 Ga0123355_10065004 Ga0123355_100650042 386
11 3300010167 Ga0123353_10014815 Ga0123353_1001481515 389
12 iso_pr_bacteria 2820483401 2820485466 389
13 3300042607 Ga0466720_026231 Ga0466720_026231_12624_13796 390
14 iso_pr_bacteria 2820469612 2820469874 390
15 3300010049 Ga0123356_10045708 Ga0123356_100457082 391
16 iso_pr_bacteria 2820593525 2820593827 391
17 3300009826 Ga0123355_10029304 Ga0123355_100293047 392
18 3300009826 Ga0123355_10029715 Ga0123355_100297154 392
19 3300042606 Ga0466719_415738 Ga0466719_415738_22125_23303 392
20 3300042621 Ga0466729_228310 Ga0466729_228310_183_1364 393
21 iso_pr_bacteria 2820481688 2820482958 393
22 iso_pr_bacteria 2820654856 2820656628 393
23 iso_pr_bacteria 2820464928 2820466170 394
24 3300000089 AustNasuHG_c1023467 AustNasuHG_10234672 395
25 3300000089 AustNasuHG_c1027271 AustNasuHG_10272712 395
26 3300010167 Ga0123353_10004353 Ga0123353_100043537 395
27 3300010167 Ga0123353_10066709 Ga0123353_100667093 395
28 3300042610 Ga0466698_377915 Ga0466698_377915_86_1273 395
29 3300000089 AustNasuHG_c1003142 AustNasuHG_10031422 396
30 3300005200 Ga0072940_1045225 Ga0072940_10452253 396
31 3300009826 Ga0123355_10457485 Ga0123355_104574852 396
32 3300010049 Ga0123356_10084940 Ga0123356_100849402 396
33 3300000089 AustNasuHG_c1009599 AustNasuHG_10095994 397
34 3300005200 Ga0072940_1107829 Ga0072940_11078292 398
35 3300005485 Ga0074263_104627 Ga0074263_1046272 398
36 3300042601 Ga0466707_322802 Ga0466707_322802_1560_2756 398
37 3300042602 Ga0466713_046058 Ga0466713_046058_7773_8969 398
38 3300042616 Ga0466715_081391 Ga0466715_081391_3625_4821 398
39 3300042648 Ga0466709_115669 Ga0466709_115669_146175_147371 398
40 3300005083 Ga0068305_10004849 Ga0068305_1000484941 399
41 3300042643 Ga0466704_029296 Ga0466704_029296_213_1412 399
42 3300009826 Ga0123355_10000098 Ga0123355_1000009841 400
43 3300042636 Ga0466703_321083 Ga0466703_321083_57694_58896 400
44 3300024493 Ga0264413_123328 Ga0264413_1233284 401
45 3300042593 Ga0466691_178068 Ga0466691_178068_388_1593 401
46 3300042596 Ga0466696_196668 Ga0466696_196668_10338_11543 401
47 3300042612 Ga0466705_022138 Ga0466705_022138_6234_7439 401
48 3300042612 Ga0466705_131741 Ga0466705_131741_24200_25405 401
49 3300042616 Ga0466715_203451 Ga0466715_203451_117_1322 401
50 3300042617 Ga0466718_170218 Ga0466718_170218_124_1329 401
51 3300042618 Ga0466723_190304 Ga0466723_190304_6947_8152 401
52 3300042618 Ga0466723_228747 Ga0466723_228747_678_1883 401
53 3300042618 Ga0466723_367083 Ga0466723_367083_339_1544 401
54 3300042621 Ga0466729_025273 Ga0466729_025273_7210_8415 401
55 3300042636 Ga0466703_251170 Ga0466703_251170_1850_3055 401
56 3300042652 Ga0466708_052039 Ga0466708_052039_9828_11033 401
57 3300042652 Ga0466708_407719 Ga0466708_407719_211_1416 401
58 3300002449 JGI24698J34947_10004953 JGI24698J34947_100049536 402
59 3300042599 Ga0466706_107717 Ga0466706_107717_5444_6652 402
60 3300042609 Ga0466722_104430 Ga0466722_104430_5150_6358 402
61 3300042610 Ga0466698_230914 Ga0466698_230914_623_1831 402
62 3300042617 Ga0466718_167832 Ga0466718_167832_3588_4796 402
63 3300042636 Ga0466703_364622 Ga0466703_364622_6482_8191 402
64 3300042643 Ga0466704_046152 Ga0466704_046152_1035_2243 402
65 3300042655 Ga0466727_134685 Ga0466727_134685_34_1242 402
66 3300042607 Ga0466720_014873 Ga0466720_014873_5662_6873 403
67 3300042612 Ga0466705_032803 Ga0466705_032803_1988_3232 403
68 3300042612 Ga0466705_246311 Ga0466705_246311_3292_4503 403
69 3300042617 Ga0466718_136296 Ga0466718_136296_3046_4257 403
70 3300010049 Ga0123356_10036556 Ga0123356_100365563 404
71 3300042601 Ga0466707_307614 Ga0466707_307614_48412_49626 404
72 3300042612 Ga0466705_425307 Ga0466705_425307_3957_5171 404
73 3300042616 Ga0466715_096905 Ga0466715_096905_11576_12790 404
74 3300042617 Ga0466718_042383 Ga0466718_042383_3075_4289 404
75 3300042612 Ga0466705_127615 Ga0466705_127615_194_1411 405
76 3300042619 Ga0466726_155806 Ga0466726_155806_9970_11187 405
77 3300042620 Ga0466728_137320 Ga0466728_137320_429_1646 405
78 3300042599 Ga0466706_026793 Ga0466706_026793_10673_11893 406
79 3300042601 Ga0466707_159669 Ga0466707_159669_80412_81632 406
80 3300042605 Ga0466716_464066 Ga0466716_464066_2705_3925 406
81 3300042609 Ga0466722_009326 Ga0466722_009326_5907_7127 406
82 3300042649 Ga0466724_20148 Ga0466724_20148_459_1679 406
83 iso_pr_bacteria 2820185449 2820185647 406
84 iso_pr_bacteria 2820661146 2820662031 406
85 iso_pr_bacteria 2820690275 2820691326 406
86 3300002450 JGI24695J34938_10000851 JGI24695J34938_1000085115 407
87 3300010049 Ga0123356_10171251 Ga0123356_101712512 407
88 3300010167 Ga0123353_10196919 Ga0123353_101969194 407
89 3300042599 Ga0466706_013636 Ga0466706_013636_17002_18225 407
90 3300042602 Ga0466713_117049 Ga0466713_117049_4450_5673 407
91 3300042616 Ga0466715_094268 Ga0466715_094268_31968_33191 407
92 3300042618 Ga0466723_006847 Ga0466723_006847_1207_2430 407
93 iso_pr_bacteria 2989309576 2989314345 407
94 3300009826 Ga0123355_10146201 Ga0123355_101462012 408
95 3300009826 Ga0123355_10214137 Ga0123355_102141371 408
96 3300042591 Ga0466692_098045 Ga0466692_098045_1945_3171 408
97 3300042596 Ga0466696_215724 Ga0466696_215724_265_1491 408
98 3300042618 Ga0466723_001478 Ga0466723_001478_5460_6686 408
99 3300042618 Ga0466723_058021 Ga0466723_058021_319_1545 408
100 3300042618 Ga0466723_342020 Ga0466723_342020_3857_5083 408
101 3300042643 Ga0466704_302638 Ga0466704_302638_110_1336 408
102 3300042616 Ga0466715_197839 Ga0466715_197839_4627_5856 409
103 3300042616 Ga0466715_284009 Ga0466715_284009_5540_6769 409
104 3300042652 Ga0466708_429360 Ga0466708_429360_378_1607 409
105 iso_pr_bacteria 2820068815 2820069732 409
106 iso_pr_bacteria 2820072841 2820073433 409
107 iso_pr_bacteria 2820487239 2820488320 409
108 3300042615 Ga0466711_243757 Ga0466711_243757_3523_4755 410
109 3300042590 Ga0466690_232584 Ga0466690_232584_1163_2398 411
110 3300042612 Ga0466705_171514 Ga0466705_171514_22624_23859 411
111 3300042603 Ga0466714_111268 Ga0466714_111268_2588_3826 412
112 3300024493 Ga0264413_108352 Ga0264413_1083526 413
113 3300042603 Ga0466714_034143 Ga0466714_034143_1134_2375 413
114 3300009826 Ga0123355_10000016 Ga0123355_1000001652 414
115 3300042636 Ga0466703_337570 Ga0466703_337570_2710_3954 414
116 3300042643 Ga0466704_464165 Ga0466704_464165_4142_5386 414
117 3300042590 Ga0466690_120505 Ga0466690_120505_244_1491 415
118 3300038395 Ga0415639_191170 Ga0415639_191170_107_1375 422
119 3300042636 Ga0466703_026307 Ga0466703_026307_2417_3688 423
120 3300010167 Ga0123353_10001504 Ga0123353_100015044 424
121 iso_pr_bacteria 2781125661 2781334040 425
122 3300002450 JGI24695J34938_10013553 JGI24695J34938_100135531 426
123 3300000089 AustNasuHG_c1001115 AustNasuHG_10011155 430
124 3300042621 Ga0466729_171889 Ga0466729_171889_254_1555 433
125 iso_pr_bacteria 2758568796 2761047003 434
126 3300010049 Ga0123356_10003415 Ga0123356_1000341512 443
127 3300010167 Ga0123353_10462950 Ga0123353_104629502 480

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF18128 HydF_dimer Hydrogen maturase F dimerization domain 257 355 0.99
PF18133 HydF_tetramer Hydrogen maturase F tetramerization domain 360 473 0.98
PF00350 Dynamin_N Dynamin family 97 129 0.92
PF01926 MMR_HSR1 50S ribosome-binding GTPase 96 211 0.88
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 146 219 0.78
PF02421 FeoB_N Ferrous iron transport protein B 96 215 0.78

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01926 GO:0005525 GTP binding MF

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.8 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.