Protein Family IF03299
Metagenome
Isolate
127
Members
56
Samples
110
Scaffolds
402.5
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10462950|Ga0123353_104629502
- Length
- 480 aa
- Sequence
- MLSKLPTFQSQEHSKNAILKCLCAFQHIFHITRNKKVTNEMSRKSKKIFQKYSDIFELFLLLYKKKYFSEDLENDISRRIMVTANLNQTPISERMHIAFFGMRNAGKSSLINAVTGQELAIISPVPGTTTDPVHKTMELLPLGPVVLIDTPGIDDSGELGAQRINKTHQVLNKTDAAILVVDVNCELSKEDEELIELFREKKIPYIIALNKSDLKIGQERSTSAEYIFVSALTGQGIHELKERIAGLCKSDEPQHRLVTDLIDPSDFVVLVTPIDKAAPKGRLILPQQQVIRDILEANAVSIVTKENEFKNVLKNLAKKPRMIITDSQIFDKVAADTPHDIPLTSFSILMARYKGLLDDAVRSVKAIEHIEDGDKILIAEGCTHHRQCDDIGSVKLPRWIKNHTGKHPEFCFCSGAGFPSDLADYKLIVHCGGCMLNTREMQSRAQTAKRAGVPMTNYGILIACMQGILKRSIGIFPHL*
Sample Types
Isolate
13.4%
Metagenome
86.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
36.4%
Termitidae
27.3%
Kalotermitidae
25.5%
Rhinotermitidae
5.5%
Termopsidae
3.6%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 2820072841 | Unclassified Proteobacteria Nt197P3bin127 | Isolate | Unclassified |
| 3 | 2820481688 | Unclassified Firmicutes Lab288P1bin76 | Isolate | Unclassified |
| 4 | 2820623020 | Unclassified Firmicutes Emb289P1bin126 | Isolate | Unclassified |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 12 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 13 | 2820487239 | Unclassified Firmicutes Lab288P1bin71 | Isolate | Unclassified |
| 14 | 2820593525 | Unclassified Firmicutes Emb289P1bin7 | Isolate | Unclassified |
| 15 | 2820661146 | Unclassified Firmicutes Co191P3bin61 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 2820068815 | Unclassified Proteobacteria Nt197P3bin4 | Isolate | Unclassified |
| 24 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 25 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 26 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 27 | 2820690275 | Unclassified Firmicutes Co191P1bin72 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2820391468 | Unclassified Firmicutes Nc150P3bin1 | Isolate | Unclassified |
| 38 | 2820469612 | Unclassified Firmicutes Lab288P1bin92 | Isolate | Unclassified |
| 39 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 40 | 2758568796 | Unclassified Deltaproteobacteria Th196P3_bin21 | Isolate | Unclassified |
| 41 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 42 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 46 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 47 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 51 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 52 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 53 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 54 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 55 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | AustNasuHG_c1003142 | 3300000089 | Bacteria | 5956 |
| 2 | AustNasuHG_c1027271 | 3300000089 | Bacteria | 1751 |
| 3 | Ga0072940_1045225 | 3300005200 | Bacteria | 2447 |
| 4 | Ga0123355_10146201 | 3300009826 | Bacteria | 3604 |
| 5 | Ga0466706_107717 | 3300042599 | Bacteria | 7822 |
| 6 | Ga0466713_046058 | 3300042602 | Bacteria | 20148 |
| 7 | Ga0466719_415738 | 3300042606 | Bacteria | 31415 |
| 8 | Ga0466720_026231 | 3300042607 | Bacteria | 14005 |
| 9 | Ga0466698_377915 | 3300042610 | Bacteria | 3459 |
| 10 | Ga0466691_178068 | 3300042593 | Bacteria | 1940 |
| 11 | Ga0466723_006847 | 3300042618 | Bacteria | 9810 |
| 12 | Ga0466703_337570 | 3300042636 | Bacteria | 7107 |
| 13 | Ga0072940_1107829 | 3300005200 | Bacteria | 2563 |
| 14 | Ga0123353_10001504 | 3300010167 | Bacteria | 28566 |
| 15 | Ga0123353_10004353 | 3300010167 | Bacteria | 18220 |
| 16 | Ga0466716_464066 | 3300042605 | Bacteria | 4626 |
| 17 | Ga0466722_104430 | 3300042609 | Bacteria | 11163 |
| 18 | Ga0466698_230914 | 3300042610 | Bacteria | 2206 |
| 19 | Ga0466690_120505 | 3300042590 | Bacteria | 12764 |
| 20 | Ga0466705_127615 | 3300042612 | Bacteria | 2724 |
| 21 | Ga0466705_131741 | 3300042612 | Bacteria | 27262 |
| 22 | Ga0123355_10065004 | 3300009826 | Bacteria | 5875 |
| 23 | Ga0123356_10003415 | 3300010049 | Bacteria | 16643 |
| 24 | Ga0123356_10036556 | 3300010049 | Bacteria | 4585 |
| 25 | Ga0123353_10014815 | 3300010167 | Bacteria | 11273 |
| 26 | Ga0466707_307614 | 3300042601 | Bacteria | 54795 |
| 27 | Ga0466713_117049 | 3300042602 | Bacteria | 6094 |
| 28 | Ga0466720_014873 | 3300042607 | Bacteria | 17297 |
| 29 | Ga0466692_098045 | 3300042591 | Bacteria | 5630 |
| 30 | Ga0466691_078853 | 3300042593 | Bacteria | 14289 |
| 31 | Ga0466705_425307 | 3300042612 | Bacteria | 10180 |
| 32 | Ga0466723_342020 | 3300042618 | Bacteria | 8898 |
| 33 | Ga0466729_171889 | 3300042621 | Bacteria | 1774 |
| 34 | Ga0466704_464165 | 3300042643 | Bacteria | 7440 |
| 35 | AustNasuHG_c1023467 | 3300000089 | Bacteria | 1968 |
| 36 | JGI24695J34938_10013553 | 3300002450 | Unclassified | 4274 |
| 37 | Ga0068305_10004849 | 3300005083 | Bacteria | 48980 |
| 38 | Ga0123353_10066709 | 3300010167 | Bacteria | 5777 |
| 39 | Ga0123353_10462950 | 3300010167 | Bacteria | 1862 |
| 40 | Ga0466715_096905 | 3300042616 | Bacteria | 21950 |
| 41 | Ga0466715_197839 | 3300042616 | Bacteria | 8941 |
| 42 | Ga0466718_170218 | 3300042617 | Bacteria | 3234 |
| 43 | Ga0466723_029068 | 3300042618 | Bacteria | 62461 |
| 44 | Ga0466723_367083 | 3300042618 | Bacteria | 3629 |
| 45 | Ga0466729_025273 | 3300042621 | Bacteria | 16408 |
| 46 | Ga0466703_026307 | 3300042636 | Bacteria | 33930 |
| 47 | Ga0466704_029296 | 3300042643 | Unclassified | 1873 |
| 48 | Ga0466727_134685 | 3300042655 | Bacteria | 2565 |
| 49 | AustNasuHG_c1009599 | 3300000089 | Bacteria | 3391 |
| 50 | Ga0123355_10457485 | 3300009826 | Bacteria | 1604 |
| 51 | Ga0123356_10045708 | 3300010049 | Bacteria | 4074 |
| 52 | Ga0466706_013636 | 3300042599 | Bacteria | 55525 |
| 53 | Ga0466714_034143 | 3300042603 | Bacteria | 3137 |
| 54 | Ga0466714_111268 | 3300042603 | Bacteria | 7329 |
| 55 | Ga0466690_232584 | 3300042590 | Bacteria | 6542 |
| 56 | Ga0466715_094268 | 3300042616 | Bacteria | 48463 |
| 57 | Ga0466718_042383 | 3300042617 | Bacteria | 4578 |
| 58 | Ga0466723_058021 | 3300042618 | Bacteria | 2242 |
| 59 | Ga0466723_190304 | 3300042618 | Bacteria | 8181 |
| 60 | Ga0466729_228310 | 3300042621 | Bacteria | 5950 |
| 61 | Ga0466703_251170 | 3300042636 | Bacteria | 3296 |
| 62 | Ga0466703_364622 | 3300042636 | Bacteria | 8517 |
| 63 | Ga0466704_046152 | 3300042643 | Bacteria | 2503 |
| 64 | Ga0466709_115669 | 3300042648 | Bacteria | 217304 |
| 65 | Ga0466708_052039 | 3300042652 | Bacteria | 36354 |
| 66 | Ga0466705_171514 | 3300042612 | Bacteria | 66002 |
| 67 | Ga0466705_246311 | 3300042612 | Bacteria | 11069 |
| 68 | AustNasuHG_c1001115 | 3300000089 | Bacteria | 9680 |
| 69 | Ga0123355_10214137 | 3300009826 | Bacteria | 2785 |
| 70 | Ga0123353_10196919 | 3300010167 | Bacteria | 3175 |
| 71 | Ga0466696_196668 | 3300042596 | Bacteria | 24129 |
| 72 | Ga0466723_001478 | 3300042618 | Bacteria | 12520 |
| 73 | Ga0466704_302638 | 3300042643 | Bacteria | 3084 |
| 74 | Ga0466705_022138 | 3300042612 | Bacteria | 8156 |
| 75 | Ga0466705_032803 | 3300042612 | Bacteria | 6258 |
| 76 | JGI24698J34947_10004953 | 3300002449 | Bacteria | 7301 |
| 77 | Ga0074263_104627 | 3300005485 | Bacteria | 1920 |
| 78 | Ga0123355_10029304 | 3300009826 | Bacteria | 8907 |
| 79 | Ga0123355_10029715 | 3300009826 | Bacteria | 8852 |
| 80 | Ga0466706_026793 | 3300042599 | Bacteria | 18030 |
| 81 | Ga0466707_159669 | 3300042601 | Bacteria | 505639 |
| 82 | Ga0264413_108352 | 3300024493 | Bacteria | 9200 |
| 83 | Ga0466696_215724 | 3300042596 | Bacteria | 1627 |
| 84 | Ga0466705_453255 | 3300042612 | Bacteria | 7157 |
| 85 | Ga0466711_243757 | 3300042615 | Bacteria | 10062 |
| 86 | Ga0466718_136296 | 3300042617 | Bacteria | 4791 |
| 87 | Ga0466718_167832 | 3300042617 | Bacteria | 5294 |
| 88 | Ga0466726_155806 | 3300042619 | Bacteria | 20529 |
| 89 | Ga0466728_137320 | 3300042620 | Bacteria | 7589 |
| 90 | Ga0466703_321083 | 3300042636 | Bacteria | 103995 |
| 91 | Ga0466708_407719 | 3300042652 | Bacteria | 1798 |
| 92 | Ga0466708_429360 | 3300042652 | Bacteria | 5865 |
| 93 | JGI24695J34938_10000851 | 3300002450 | Bacteria | 28281 |
| 94 | Ga0123355_10000016 | 3300009826 | Bacteria | 163334 |
| 95 | Ga0123355_10000098 | 3300009826 | Bacteria | 93935 |
| 96 | Ga0123355_10000279 | 3300009826 | Bacteria | 65611 |
| 97 | Ga0123355_10107090 | 3300009826 | Bacteria | 4380 |
| 98 | Ga0123356_10084940 | 3300010049 | Bacteria | 3001 |
| 99 | Ga0123356_10171251 | 3300010049 | Unclassified | 2182 |
| 100 | Ga0466707_322802 | 3300042601 | Bacteria | 14394 |
| 101 | Ga0466722_009326 | 3300042609 | Bacteria | 7148 |
| 102 | Ga0264413_123328 | 3300024493 | Bacteria | 3223 |
| 103 | Ga0415639_191170 | 3300038395 | Bacteria | 1703 |
| 104 | Ga0466693_051980 | 3300042592 | Bacteria | 1338 |
| 105 | Ga0466715_081391 | 3300042616 | Bacteria | 24207 |
| 106 | Ga0466715_203451 | 3300042616 | Bacteria | 9301 |
| 107 | Ga0466715_284009 | 3300042616 | Bacteria | 28343 |
| 108 | Ga0466723_228747 | 3300042618 | Bacteria | 2938 |
| 109 | Ga0466703_392329 | 3300042636 | Bacteria | 2220 |
| 110 | Ga0466724_20148 | 3300042649 | Bacteria | 5889 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042636 | Ga0466703_392329 | Ga0466703_392329_1108_2151 | 347 |
| 2 | 3300042618 | Ga0466723_029068 | Ga0466723_029068_51984_53036 | 350 |
| 3 | iso_pr_bacteria | 2820391468 | 2820391918 | 352 |
| 4 | 3300042593 | Ga0466691_078853 | Ga0466691_078853_6980_8104 | 374 |
| 5 | 3300042592 | Ga0466693_051980 | Ga0466693_051980_149_1279 | 376 |
| 6 | iso_pr_bacteria | 2820623020 | 2820623939 | 383 |
| 7 | 3300009826 | Ga0123355_10000279 | Ga0123355_1000027957 | 384 |
| 8 | 3300009826 | Ga0123355_10107090 | Ga0123355_101070906 | 384 |
| 9 | 3300042612 | Ga0466705_453255 | Ga0466705_453255_3968_5122 | 384 |
| 10 | 3300009826 | Ga0123355_10065004 | Ga0123355_100650042 | 386 |
| 11 | 3300010167 | Ga0123353_10014815 | Ga0123353_1001481515 | 389 |
| 12 | iso_pr_bacteria | 2820483401 | 2820485466 | 389 |
| 13 | 3300042607 | Ga0466720_026231 | Ga0466720_026231_12624_13796 | 390 |
| 14 | iso_pr_bacteria | 2820469612 | 2820469874 | 390 |
| 15 | 3300010049 | Ga0123356_10045708 | Ga0123356_100457082 | 391 |
| 16 | iso_pr_bacteria | 2820593525 | 2820593827 | 391 |
| 17 | 3300009826 | Ga0123355_10029304 | Ga0123355_100293047 | 392 |
| 18 | 3300009826 | Ga0123355_10029715 | Ga0123355_100297154 | 392 |
| 19 | 3300042606 | Ga0466719_415738 | Ga0466719_415738_22125_23303 | 392 |
| 20 | 3300042621 | Ga0466729_228310 | Ga0466729_228310_183_1364 | 393 |
| 21 | iso_pr_bacteria | 2820481688 | 2820482958 | 393 |
| 22 | iso_pr_bacteria | 2820654856 | 2820656628 | 393 |
| 23 | iso_pr_bacteria | 2820464928 | 2820466170 | 394 |
| 24 | 3300000089 | AustNasuHG_c1023467 | AustNasuHG_10234672 | 395 |
| 25 | 3300000089 | AustNasuHG_c1027271 | AustNasuHG_10272712 | 395 |
| 26 | 3300010167 | Ga0123353_10004353 | Ga0123353_100043537 | 395 |
| 27 | 3300010167 | Ga0123353_10066709 | Ga0123353_100667093 | 395 |
| 28 | 3300042610 | Ga0466698_377915 | Ga0466698_377915_86_1273 | 395 |
| 29 | 3300000089 | AustNasuHG_c1003142 | AustNasuHG_10031422 | 396 |
| 30 | 3300005200 | Ga0072940_1045225 | Ga0072940_10452253 | 396 |
| 31 | 3300009826 | Ga0123355_10457485 | Ga0123355_104574852 | 396 |
| 32 | 3300010049 | Ga0123356_10084940 | Ga0123356_100849402 | 396 |
| 33 | 3300000089 | AustNasuHG_c1009599 | AustNasuHG_10095994 | 397 |
| 34 | 3300005200 | Ga0072940_1107829 | Ga0072940_11078292 | 398 |
| 35 | 3300005485 | Ga0074263_104627 | Ga0074263_1046272 | 398 |
| 36 | 3300042601 | Ga0466707_322802 | Ga0466707_322802_1560_2756 | 398 |
| 37 | 3300042602 | Ga0466713_046058 | Ga0466713_046058_7773_8969 | 398 |
| 38 | 3300042616 | Ga0466715_081391 | Ga0466715_081391_3625_4821 | 398 |
| 39 | 3300042648 | Ga0466709_115669 | Ga0466709_115669_146175_147371 | 398 |
| 40 | 3300005083 | Ga0068305_10004849 | Ga0068305_1000484941 | 399 |
| 41 | 3300042643 | Ga0466704_029296 | Ga0466704_029296_213_1412 | 399 |
| 42 | 3300009826 | Ga0123355_10000098 | Ga0123355_1000009841 | 400 |
| 43 | 3300042636 | Ga0466703_321083 | Ga0466703_321083_57694_58896 | 400 |
| 44 | 3300024493 | Ga0264413_123328 | Ga0264413_1233284 | 401 |
| 45 | 3300042593 | Ga0466691_178068 | Ga0466691_178068_388_1593 | 401 |
| 46 | 3300042596 | Ga0466696_196668 | Ga0466696_196668_10338_11543 | 401 |
| 47 | 3300042612 | Ga0466705_022138 | Ga0466705_022138_6234_7439 | 401 |
| 48 | 3300042612 | Ga0466705_131741 | Ga0466705_131741_24200_25405 | 401 |
| 49 | 3300042616 | Ga0466715_203451 | Ga0466715_203451_117_1322 | 401 |
| 50 | 3300042617 | Ga0466718_170218 | Ga0466718_170218_124_1329 | 401 |
| 51 | 3300042618 | Ga0466723_190304 | Ga0466723_190304_6947_8152 | 401 |
| 52 | 3300042618 | Ga0466723_228747 | Ga0466723_228747_678_1883 | 401 |
| 53 | 3300042618 | Ga0466723_367083 | Ga0466723_367083_339_1544 | 401 |
| 54 | 3300042621 | Ga0466729_025273 | Ga0466729_025273_7210_8415 | 401 |
| 55 | 3300042636 | Ga0466703_251170 | Ga0466703_251170_1850_3055 | 401 |
| 56 | 3300042652 | Ga0466708_052039 | Ga0466708_052039_9828_11033 | 401 |
| 57 | 3300042652 | Ga0466708_407719 | Ga0466708_407719_211_1416 | 401 |
| 58 | 3300002449 | JGI24698J34947_10004953 | JGI24698J34947_100049536 | 402 |
| 59 | 3300042599 | Ga0466706_107717 | Ga0466706_107717_5444_6652 | 402 |
| 60 | 3300042609 | Ga0466722_104430 | Ga0466722_104430_5150_6358 | 402 |
| 61 | 3300042610 | Ga0466698_230914 | Ga0466698_230914_623_1831 | 402 |
| 62 | 3300042617 | Ga0466718_167832 | Ga0466718_167832_3588_4796 | 402 |
| 63 | 3300042636 | Ga0466703_364622 | Ga0466703_364622_6482_8191 | 402 |
| 64 | 3300042643 | Ga0466704_046152 | Ga0466704_046152_1035_2243 | 402 |
| 65 | 3300042655 | Ga0466727_134685 | Ga0466727_134685_34_1242 | 402 |
| 66 | 3300042607 | Ga0466720_014873 | Ga0466720_014873_5662_6873 | 403 |
| 67 | 3300042612 | Ga0466705_032803 | Ga0466705_032803_1988_3232 | 403 |
| 68 | 3300042612 | Ga0466705_246311 | Ga0466705_246311_3292_4503 | 403 |
| 69 | 3300042617 | Ga0466718_136296 | Ga0466718_136296_3046_4257 | 403 |
| 70 | 3300010049 | Ga0123356_10036556 | Ga0123356_100365563 | 404 |
| 71 | 3300042601 | Ga0466707_307614 | Ga0466707_307614_48412_49626 | 404 |
| 72 | 3300042612 | Ga0466705_425307 | Ga0466705_425307_3957_5171 | 404 |
| 73 | 3300042616 | Ga0466715_096905 | Ga0466715_096905_11576_12790 | 404 |
| 74 | 3300042617 | Ga0466718_042383 | Ga0466718_042383_3075_4289 | 404 |
| 75 | 3300042612 | Ga0466705_127615 | Ga0466705_127615_194_1411 | 405 |
| 76 | 3300042619 | Ga0466726_155806 | Ga0466726_155806_9970_11187 | 405 |
| 77 | 3300042620 | Ga0466728_137320 | Ga0466728_137320_429_1646 | 405 |
| 78 | 3300042599 | Ga0466706_026793 | Ga0466706_026793_10673_11893 | 406 |
| 79 | 3300042601 | Ga0466707_159669 | Ga0466707_159669_80412_81632 | 406 |
| 80 | 3300042605 | Ga0466716_464066 | Ga0466716_464066_2705_3925 | 406 |
| 81 | 3300042609 | Ga0466722_009326 | Ga0466722_009326_5907_7127 | 406 |
| 82 | 3300042649 | Ga0466724_20148 | Ga0466724_20148_459_1679 | 406 |
| 83 | iso_pr_bacteria | 2820185449 | 2820185647 | 406 |
| 84 | iso_pr_bacteria | 2820661146 | 2820662031 | 406 |
| 85 | iso_pr_bacteria | 2820690275 | 2820691326 | 406 |
| 86 | 3300002450 | JGI24695J34938_10000851 | JGI24695J34938_1000085115 | 407 |
| 87 | 3300010049 | Ga0123356_10171251 | Ga0123356_101712512 | 407 |
| 88 | 3300010167 | Ga0123353_10196919 | Ga0123353_101969194 | 407 |
| 89 | 3300042599 | Ga0466706_013636 | Ga0466706_013636_17002_18225 | 407 |
| 90 | 3300042602 | Ga0466713_117049 | Ga0466713_117049_4450_5673 | 407 |
| 91 | 3300042616 | Ga0466715_094268 | Ga0466715_094268_31968_33191 | 407 |
| 92 | 3300042618 | Ga0466723_006847 | Ga0466723_006847_1207_2430 | 407 |
| 93 | iso_pr_bacteria | 2989309576 | 2989314345 | 407 |
| 94 | 3300009826 | Ga0123355_10146201 | Ga0123355_101462012 | 408 |
| 95 | 3300009826 | Ga0123355_10214137 | Ga0123355_102141371 | 408 |
| 96 | 3300042591 | Ga0466692_098045 | Ga0466692_098045_1945_3171 | 408 |
| 97 | 3300042596 | Ga0466696_215724 | Ga0466696_215724_265_1491 | 408 |
| 98 | 3300042618 | Ga0466723_001478 | Ga0466723_001478_5460_6686 | 408 |
| 99 | 3300042618 | Ga0466723_058021 | Ga0466723_058021_319_1545 | 408 |
| 100 | 3300042618 | Ga0466723_342020 | Ga0466723_342020_3857_5083 | 408 |
| 101 | 3300042643 | Ga0466704_302638 | Ga0466704_302638_110_1336 | 408 |
| 102 | 3300042616 | Ga0466715_197839 | Ga0466715_197839_4627_5856 | 409 |
| 103 | 3300042616 | Ga0466715_284009 | Ga0466715_284009_5540_6769 | 409 |
| 104 | 3300042652 | Ga0466708_429360 | Ga0466708_429360_378_1607 | 409 |
| 105 | iso_pr_bacteria | 2820068815 | 2820069732 | 409 |
| 106 | iso_pr_bacteria | 2820072841 | 2820073433 | 409 |
| 107 | iso_pr_bacteria | 2820487239 | 2820488320 | 409 |
| 108 | 3300042615 | Ga0466711_243757 | Ga0466711_243757_3523_4755 | 410 |
| 109 | 3300042590 | Ga0466690_232584 | Ga0466690_232584_1163_2398 | 411 |
| 110 | 3300042612 | Ga0466705_171514 | Ga0466705_171514_22624_23859 | 411 |
| 111 | 3300042603 | Ga0466714_111268 | Ga0466714_111268_2588_3826 | 412 |
| 112 | 3300024493 | Ga0264413_108352 | Ga0264413_1083526 | 413 |
| 113 | 3300042603 | Ga0466714_034143 | Ga0466714_034143_1134_2375 | 413 |
| 114 | 3300009826 | Ga0123355_10000016 | Ga0123355_1000001652 | 414 |
| 115 | 3300042636 | Ga0466703_337570 | Ga0466703_337570_2710_3954 | 414 |
| 116 | 3300042643 | Ga0466704_464165 | Ga0466704_464165_4142_5386 | 414 |
| 117 | 3300042590 | Ga0466690_120505 | Ga0466690_120505_244_1491 | 415 |
| 118 | 3300038395 | Ga0415639_191170 | Ga0415639_191170_107_1375 | 422 |
| 119 | 3300042636 | Ga0466703_026307 | Ga0466703_026307_2417_3688 | 423 |
| 120 | 3300010167 | Ga0123353_10001504 | Ga0123353_100015044 | 424 |
| 121 | iso_pr_bacteria | 2781125661 | 2781334040 | 425 |
| 122 | 3300002450 | JGI24695J34938_10013553 | JGI24695J34938_100135531 | 426 |
| 123 | 3300000089 | AustNasuHG_c1001115 | AustNasuHG_10011155 | 430 |
| 124 | 3300042621 | Ga0466729_171889 | Ga0466729_171889_254_1555 | 433 |
| 125 | iso_pr_bacteria | 2758568796 | 2761047003 | 434 |
| 126 | 3300010049 | Ga0123356_10003415 | Ga0123356_1000341512 | 443 |
| 127 | 3300010167 | Ga0123353_10462950 | Ga0123353_104629502 | 480 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF18128 | HydF_dimer | Hydrogen maturase F dimerization domain | 257 | 355 | 0.99 |
| PF18133 | HydF_tetramer | Hydrogen maturase F tetramerization domain | 360 | 473 | 0.98 |
| PF00350 | Dynamin_N | Dynamin family | 97 | 129 | 0.92 |
| PF01926 | MMR_HSR1 | 50S ribosome-binding GTPase | 96 | 211 | 0.88 |
| PF00009 | GTP_EFTU | Elongation factor Tu GTP binding domain | 146 | 219 | 0.78 |
| PF02421 | FeoB_N | Ferrous iron transport protein B | 96 | 215 | 0.78 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01926 | GO:0005525 | GTP binding | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.77 | 0.8 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.