Protein Family IF03258

Metagenome Isolate
138 Members
55 Samples
133 Scaffolds
391.49 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10347445|Ga0123353_103474451
Length
428 aa
Sequence
MLFAKNIFCVFLLFIXXIFVSLPAEKGKEMEELFDIFYRELRKTDLSFQRYLADDIHWEGRLSAITGARGAGKTTMMMQHIKKTFGNSPKEVLYVSLDNIWFSGNRLYDLANDFEKQGGKYLFIDEVHKYENWSQEIKNIYDSFNDLKVVFTGSSMLEIYRGNADLSRRAVHYILQGMSFREFLKFDQNIEFEKFTLEDILQNHTEIASAVNEKIRPLPLFDTYIKQGYYPYYKSDNRFYLSKLANTVNLILETDLPAIETIEMYSIRKIKKLLWIISQSVPFTPKITDLAANLGVSRNSLLNYLTILERGGLINLLQSNTKGVKSLAKPEKIYLNNTNLIYAFDSNKPNIGNLRETFFCNQLKAVSEVTSANKADFTINSEYVFEVGGKNKGHEQITGLDNAYLALDHLEYGFGNKIPLWLFGMLY*

📊 Sample Types

Isolate 3.6%
Metagenome 96.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.7%
Kalotermitidae 18.5%
Unclassified 13.0%
Passalidae 3.7%
Termopsidae 3.7%
Hodotermitidae 1.9%
Kiwaidae 1.9%
Culicidae 1.9%
Rhinotermitidae 1.9%

🌳 Taxonomy

Archaea 0
Bacteria 127
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
6 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
11 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
12 2820776227 Unclassified Bacteroidetes Emb289P4bin3 Isolate Unclassified
13 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
14 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
15 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
18 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
19 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
22 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
28 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
29 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
30 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
31 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
32 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
33 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
39 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
40 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
41 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae
42 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
43 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
44 2820781750 Unclassified Bacteroidetes Emb289P3bin89 Isolate Unclassified
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
47 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
48 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
49 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
50 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
51 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
52 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
53 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
54 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
55 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123357_10006137 3300009784 Bacteria 14565
2 Ga0123355_10248332 3300009826 Bacteria 2510
3 Ga0123356_10136441 3300010049 Bacteria 2412
4 Ga0123353_10015072 3300010167 Bacteria 11199
5 Ga0123353_10110159 3300010167 Bacteria 4436
6 Ga0123353_10126538 3300010167 Bacteria 4106
7 Ga0123354_10097095 3300010882 Bacteria 4018
8 Ga0123354_10159089 3300010882 Bacteria 2692
9 Ga0123354_10204657 3300010882 Unclassified 2156
10 IMNBL1DRAFT_c0044515 3300000062 Bacteria 1458
11 Ga0105524_107740 3300007733 Bacteria 1414
12 Ga0157631_100162 3300013007 Bacteria 9475
13 Ga0157631_102480 3300013007 Bacteria 5129
14 Ga0466690_206304 3300042590 Bacteria 14937
15 Ga0466693_277639 3300042592 Bacteria 1688
16 Ga0466691_042318 3300042593 Bacteria 15912
17 Ga0466699_390827 3300042597 Bacteria 1925
18 Ga0466735_099948 3300042624 Bacteria 1538
19 Ga0466715_048583 3300042616 Bacteria 3566
20 Ga0466728_020012 3300042620 Bacteria 18591
21 Ga0466719_480152 3300042606 Bacteria 2483
22 Ga0466719_576802 3300042606 Bacteria 3474
23 Ga0466722_033284 3300042609 Bacteria 7519
24 Ga0466697_119100 3300042611 Bacteria 2336
25 Ga0466705_095643 3300042612 Bacteria 15336
26 Ga0123357_10084206 3300009784 Bacteria 4169
27 Ga0123354_10256689 3300010882 Bacteria 1756
28 Ga0123354_10291908 3300010882 Bacteria 1561
29 Ga0123354_10297776 3300010882 Bacteria 1532
30 Ga0123357_10002496 3300009784 Bacteria 20568
31 Ga0466656_049425 3300042550 Bacteria 1890
32 Ga0466701_009514 3300042598 Bacteria 17288
33 Ga0466731_004209 3300042622 Bacteria 1762
34 Ga0466702_269660 3300042635 Bacteria 3124
35 Ga0466725_034760 3300042654 Bacteria 13871
36 Ga0466725_364489 3300042654 Bacteria 1586
37 Ga0466728_318794 3300042620 Bacteria 15039
38 Ga0466700_368270 3300042600 Bacteria 7465
39 Ga0466716_464898 3300042605 Bacteria 1830
40 Ga0466719_114278 3300042606 Bacteria 3052
41 Ga0466722_242029 3300042609 Bacteria 1796
42 Ga0466732_128756 3300042656 Bacteria 2820
43 Ga0123353_10347445 3300010167 Bacteria 2237
44 Ga0123354_10082160 3300010882 Bacteria 4544
45 JGI24702J35022_10080637 3300002462 Bacteria 1763
46 Ga0466706_086847 3300042599 Bacteria 7914
47 Ga0466713_006627 3300042602 Bacteria 53257
48 Ga0466719_337035 3300042606 Bacteria 1757
49 Ga0466719_376002 3300042606 Bacteria 2619
50 Ga0466719_434555 3300042606 Bacteria 1275
51 Ga0123356_10014528 3300010049 Bacteria 7568
52 Ga0123356_10105083 3300010049 Bacteria 2716
53 Ga0123356_10297415 3300010049 Bacteria 1718
54 Ga0123353_10023940 3300010167 Bacteria 9256
55 Ga0123353_10797423 3300010167 Bacteria 1305
56 Ga0123354_10142615 3300010882 Bacteria 2953
57 Ga0123354_10281276 3300010882 Bacteria 1615
58 JGI24696J40584_12924479 3300002834 Bacteria 1388
59 Ga0466657_173015 3300042582 Bacteria 9381
60 Ga0466694_242559 3300042594 Bacteria 2486
61 Ga0466731_123080 3300042622 Bacteria 1585
62 Ga0466725_383347 3300042654 Bacteria 1906
63 Ga0466705_519506 3300042612 Bacteria 1609
64 Ga0466715_132880 3300042616 Bacteria 7151
65 Ga0466719_497506 3300042606 Bacteria 1366
66 Ga0466719_503602 3300042606 Bacteria 5419
67 Ga0466705_289902 3300042612 Bacteria 1688
68 Ga0123355_10035664 3300009826 Bacteria 8084
69 IMNBL1DRAFT_c0008998 3300000062 Bacteria 5010
70 IMNBL1DRAFT_c0031965 3300000062 Bacteria 1905
71 JGI24698J34947_10072906 3300002449 Unclassified 1641
72 JGI24705J35276_12213540 3300002504 Bacteria 1927
73 Ga0105524_103240 3300007733 Bacteria 4167
74 Ga0160470_100980 3300012813 Bacteria 8007
75 Ga0466693_303615 3300042592 Unclassified 1201
76 Ga0466694_043198 3300042594 Bacteria 21278
77 Ga0466735_144679 3300042624 Bacteria 2680
78 Ga0466724_37797 3300042649 Bacteria 1816
79 Ga0466711_405984 3300042615 Bacteria 18483
80 Ga0466715_115556 3300042616 Bacteria 10345
81 Ga0466715_324184 3300042616 Bacteria 11897
82 Ga0466701_060515 3300042598 Bacteria 1573
83 Ga0466706_138012 3300042599 Bacteria 43154
84 Ga0466707_246433 3300042601 Bacteria 13329
85 Ga0466705_040046 3300042612 Bacteria 4639
86 Ga0466733_146065 3300042659 Bacteria 12551
87 Ga0123354_10097514 3300010882 Unclassified 4005
88 2227085283 2225789004 Unclassified 1858
89 IMNBL1DRAFT_c0006495 3300000062 Unclassified 6377
90 JGI24702J35022_10121701 3300002462 Unclassified 1442
91 JGI24705J35276_12180997 3300002504 Bacteria 1368
92 JGI24696J40584_12956850 3300002834 Unclassified 3260
93 Ga0466694_409062 3300042594 Bacteria 1761
94 Ga0466695_271029 3300042595 Bacteria 2305
95 Ga0466696_225783 3300042596 Bacteria 3325
96 Ga0466714_138519 3300042603 Bacteria 1652
97 Ga0466717_193628 3300042604 Bacteria 1737
98 Ga0466717_301807 3300042604 Bacteria 1456
99 Ga0466705_226303 3300042612 Bacteria 21197
100 Ga0123357_10032829 3300009784 Bacteria 7051
101 Ga0123357_10032876 3300009784 Bacteria 7046
102 Ga0123356_10379306 3300010049 Bacteria 1546
103 Ga0123353_10200843 3300010167 Bacteria 3137
104 Ga0123354_10209507 3300010882 Bacteria 2112
105 JGI24702J35022_10019955 3300002462 Bacteria 3643
106 JGI24702J35022_10046542 3300002462 Bacteria 2310
107 JGI24702J35022_10080861 3300002462 Bacteria 1760
108 Ga0466704_347575 3300042643 Unclassified 2202
109 Ga0466710_343674 3300042613 Bacteria 3706
110 Ga0466715_186831 3300042616 Bacteria 8143
111 Ga0466715_505413 3300042616 Bacteria 29515
112 Ga0466707_262428 3300042601 Bacteria 12401
113 Ga0466714_093285 3300042603 Bacteria 105352
114 Ga0466719_333138 3300042606 Bacteria 18795
115 Ga0466721_253481 3300042608 Bacteria 27977
116 Ga0466698_468474 3300042610 Bacteria 1821
117 Ga0123357_10033968 3300009784 Bacteria 6931
118 Ga0123357_10196115 3300009784 Bacteria 2312
119 Ga0123356_10003096 3300010049 Bacteria 17564
120 Ga0123353_10501579 3300010167 Bacteria 1768
121 IMNBL1DRAFT_c0013095 3300000062 Bacteria 3747
122 JGI24702J35022_10083617 3300002462 Bacteria 1731
123 Ga0157631_144729 3300013007 Bacteria 3745
124 Ga0466690_199492 3300042590 Bacteria 1500
125 Ga0466696_328519 3300042596 Bacteria 2068
126 Ga0466731_131898 3300042622 Bacteria 3385
127 Ga0466731_407570 3300042622 Unclassified 1614
128 Ga0466735_225168 3300042624 Bacteria 2006
129 Ga0466727_166293 3300042655 Bacteria 7612
130 Ga0466705_517820 3300042612 Bacteria 1530
131 Ga0466701_035303 3300042598 Bacteria 1940
132 Ga0466706_225636 3300042599 Unclassified 2770
133 Ga0466722_004757 3300042609 Bacteria 3044

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_225636 Ga0466706_225636_1878_2750 290
2 3300042606 Ga0466719_337035 Ga0466719_337035_304_1344 346
3 3300042597 Ga0466699_390827 Ga0466699_390827_102_1298 351
4 3300042599 Ga0466706_138012 Ga0466706_138012_30346_31401 351
5 3300042612 Ga0466705_040046 Ga0466705_040046_2724_3851 351
6 3300042592 Ga0466693_303615 Ga0466693_303615_19_1077 352
7 3300042610 Ga0466698_468474 Ga0466698_468474_99_1238 356
8 3300042635 Ga0466702_269660 Ga0466702_269660_611_1807 358
9 3300042594 Ga0466694_043198 Ga0466694_043198_3446_4594 359
10 2225789004 2227085283 2227461661 365
11 3300042601 Ga0466707_246433 Ga0466707_246433_7876_9078 365
12 3300010882 Ga0123354_10097514 Ga0123354_100975143 366
13 3300042606 Ga0466719_434555 Ga0466719_434555_88_1206 372
14 3300042606 Ga0466719_497506 Ga0466719_497506_179_1297 372
15 3300042609 Ga0466722_033284 Ga0466722_033284_2808_4004 373
16 3300042624 Ga0466735_144679 Ga0466735_144679_956_2158 374
17 3300009784 Ga0123357_10032876 Ga0123357_100328765 375
18 3300010882 Ga0123354_10291908 Ga0123354_102919081 376
19 3300042598 Ga0466701_060515 Ga0466701_060515_21_1151 376
20 3300042601 Ga0466707_262428 Ga0466707_262428_8019_9149 376
21 3300042605 Ga0466716_464898 Ga0466716_464898_302_1498 376
22 3300042612 Ga0466705_095643 Ga0466705_095643_980_2110 376
23 3300042612 Ga0466705_289902 Ga0466705_289902_234_1364 376
24 3300000062 IMNBL1DRAFT_c0013095 IMNBL1DRAFT_00130951 377
25 3300010882 Ga0123354_10142615 Ga0123354_101426151 377
26 3300042590 Ga0466690_206304 Ga0466690_206304_720_1910 377
27 3300042595 Ga0466695_271029 Ga0466695_271029_330_1526 377
28 3300042600 Ga0466700_368270 Ga0466700_368270_3056_4189 377
29 3300042612 Ga0466705_519506 Ga0466705_519506_101_1237 378
30 3300042599 Ga0466706_086847 Ga0466706_086847_1942_3081 379
31 3300042616 Ga0466715_048583 Ga0466715_048583_646_1785 379
32 3300042616 Ga0466715_115556 Ga0466715_115556_595_1791 380
33 3300000062 IMNBL1DRAFT_c0006495 IMNBL1DRAFT_00064956 382
34 3300042602 Ga0466713_006627 Ga0466713_006627_51243_52406 387
35 3300042604 Ga0466717_193628 Ga0466717_193628_556_1719 387
36 3300009784 Ga0123357_10084206 Ga0123357_100842062 388
37 3300042616 Ga0466715_505413 Ga0466715_505413_21547_22713 388
38 3300010049 Ga0123356_10297415 Ga0123356_102974152 389
39 3300042643 Ga0466704_347575 Ga0466704_347575_93_1283 389
40 3300042616 Ga0466715_132880 Ga0466715_132880_5463_6653 390
41 3300010882 Ga0123354_10082160 Ga0123354_100821601 391
42 3300013007 Ga0157631_144729 Ga0157631_1447293 393
43 3300007733 Ga0105524_103240 Ga0105524_1032403 396
44 3300042609 Ga0466722_242029 Ga0466722_242029_327_1517 396
45 3300042612 Ga0466705_226303 Ga0466705_226303_6481_7671 396
46 3300042550 Ga0466656_049425 Ga0466656_049425_668_1864 398
47 3300042582 Ga0466657_173015 Ga0466657_173015_889_2085 398
48 3300042590 Ga0466690_199492 Ga0466690_199492_166_1362 398
49 3300042592 Ga0466693_277639 Ga0466693_277639_151_1347 398
50 3300042593 Ga0466691_042318 Ga0466691_042318_9536_10732 398
51 3300042594 Ga0466694_242559 Ga0466694_242559_399_1595 398
52 3300042594 Ga0466694_409062 Ga0466694_409062_126_1322 398
53 3300042596 Ga0466696_225783 Ga0466696_225783_1831_3027 398
54 3300042596 Ga0466696_328519 Ga0466696_328519_627_1823 398
55 3300042598 Ga0466701_009514 Ga0466701_009514_11544_12740 398
56 3300042603 Ga0466714_093285 Ga0466714_093285_41715_42911 398
57 3300042603 Ga0466714_138519 Ga0466714_138519_50_1246 398
58 3300042604 Ga0466717_301807 Ga0466717_301807_30_1226 398
59 3300042606 Ga0466719_114278 Ga0466719_114278_1700_2896 398
60 3300042606 Ga0466719_333138 Ga0466719_333138_4257_5453 398
61 3300042606 Ga0466719_376002 Ga0466719_376002_1253_2449 398
62 3300042606 Ga0466719_480152 Ga0466719_480152_1028_2224 398
63 3300042606 Ga0466719_503602 Ga0466719_503602_1044_2240 398
64 3300042608 Ga0466721_253481 Ga0466721_253481_4994_6190 398
65 3300042609 Ga0466722_004757 Ga0466722_004757_1461_2657 398
66 3300042611 Ga0466697_119100 Ga0466697_119100_914_2110 398
67 3300042613 Ga0466710_343674 Ga0466710_343674_555_1751 398
68 3300042615 Ga0466711_405984 Ga0466711_405984_15187_16383 398
69 3300042616 Ga0466715_186831 Ga0466715_186831_946_2142 398
70 3300042616 Ga0466715_324184 Ga0466715_324184_8441_9637 398
71 3300042620 Ga0466728_020012 Ga0466728_020012_11423_12619 398
72 3300042622 Ga0466731_004209 Ga0466731_004209_538_1734 398
73 3300042622 Ga0466731_123080 Ga0466731_123080_188_1384 398
74 3300042622 Ga0466731_131898 Ga0466731_131898_2097_3293 398
75 3300042622 Ga0466731_407570 Ga0466731_407570_319_1515 398
76 3300042624 Ga0466735_099948 Ga0466735_099948_277_1473 398
77 3300042624 Ga0466735_225168 Ga0466735_225168_566_1762 398
78 3300042649 Ga0466724_37797 Ga0466724_37797_372_1568 398
79 3300042654 Ga0466725_034760 Ga0466725_034760_12534_13730 398
80 3300042654 Ga0466725_364489 Ga0466725_364489_31_1227 398
81 3300042654 Ga0466725_383347 Ga0466725_383347_207_1403 398
82 3300042655 Ga0466727_166293 Ga0466727_166293_202_1398 398
83 3300042656 Ga0466732_128756 Ga0466732_128756_1120_2316 398
84 3300042659 Ga0466733_146065 Ga0466733_146065_2065_3261 398
85 iso_pr_bacteria 2820651690 2820654149 398
86 iso_pr_bacteria 2820765201 2820766737 398
87 iso_pr_bacteria 2820776227 2820777283 398
88 iso_pr_bacteria 2820778767 2820780462 398
89 iso_pr_bacteria 2820781750 2820782197 398
90 3300000062 IMNBL1DRAFT_c0031965 IMNBL1DRAFT_00319651 399
91 3300000062 IMNBL1DRAFT_c0044515 IMNBL1DRAFT_00445151 399
92 3300002449 JGI24698J34947_10072906 JGI24698J34947_100729062 399
93 3300002462 JGI24702J35022_10046542 JGI24702J35022_100465421 399
94 3300002462 JGI24702J35022_10080861 JGI24702J35022_100808612 399
95 3300002462 JGI24702J35022_10083617 JGI24702J35022_100836171 399
96 3300002462 JGI24702J35022_10121701 JGI24702J35022_101217011 399
97 3300002504 JGI24705J35276_12180997 JGI24705J35276_121809971 399
98 3300002504 JGI24705J35276_12213540 JGI24705J35276_122135401 399
99 3300002834 JGI24696J40584_12924479 JGI24696J40584_129244791 399
100 3300002834 JGI24696J40584_12956850 JGI24696J40584_129568503 399
101 3300009784 Ga0123357_10006137 Ga0123357_100061377 399
102 3300009784 Ga0123357_10032829 Ga0123357_100328297 399
103 3300009784 Ga0123357_10033968 Ga0123357_100339685 399
104 3300009784 Ga0123357_10196115 Ga0123357_101961152 399
105 3300009826 Ga0123355_10035664 Ga0123355_100356648 399
106 3300009826 Ga0123355_10248332 Ga0123355_102483322 399
107 3300010049 Ga0123356_10003096 Ga0123356_100030962 399
108 3300010049 Ga0123356_10105083 Ga0123356_101050832 399
109 3300010049 Ga0123356_10136441 Ga0123356_101364413 399
110 3300010049 Ga0123356_10379306 Ga0123356_103793061 399
111 3300010167 Ga0123353_10015072 Ga0123353_100150728 399
112 3300010167 Ga0123353_10023940 Ga0123353_100239409 399
113 3300010167 Ga0123353_10110159 Ga0123353_101101592 399
114 3300010167 Ga0123353_10126538 Ga0123353_101265382 399
115 3300010167 Ga0123353_10200843 Ga0123353_102008433 399
116 3300010167 Ga0123353_10501579 Ga0123353_105015791 399
117 3300010167 Ga0123353_10797423 Ga0123353_107974231 399
118 3300010882 Ga0123354_10159089 Ga0123354_101590893 399
119 3300010882 Ga0123354_10204657 Ga0123354_102046572 399
120 3300010882 Ga0123354_10209507 Ga0123354_102095072 399
121 3300010882 Ga0123354_10256689 Ga0123354_102566892 399
122 3300010882 Ga0123354_10281276 Ga0123354_102812761 399
123 3300010882 Ga0123354_10297776 Ga0123354_102977762 399
124 3300012813 Ga0160470_100980 Ga0160470_1009807 399
125 3300042598 Ga0466701_035303 Ga0466701_035303_41_1240 399
126 3300042606 Ga0466719_576802 Ga0466719_576802_637_1836 399
127 3300042612 Ga0466705_517820 Ga0466705_517820_229_1449 399
128 3300010882 Ga0123354_10097095 Ga0123354_100970952 401
129 3300007733 Ga0105524_107740 Ga0105524_1077401 402
130 3300013007 Ga0157631_100162 Ga0157631_1001627 408
131 3300000062 IMNBL1DRAFT_c0008998 IMNBL1DRAFT_00089984 409
132 3300002462 JGI24702J35022_10080637 JGI24702J35022_100806373 410
133 3300013007 Ga0157631_102480 Ga0157631_1024802 412
134 3300042620 Ga0466728_318794 Ga0466728_318794_13554_14795 413
135 3300002462 JGI24702J35022_10019955 JGI24702J35022_100199553 417
136 3300009784 Ga0123357_10002496 Ga0123357_1000249619 420
137 3300010049 Ga0123356_10014528 Ga0123356_100145286 426
138 3300010167 Ga0123353_10347445 Ga0123353_103474451 428

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13173 AAA_14 AAA domain 61 184 0.94
PF13635 DUF4143 Domain of unknown function (DUF4143) 265 369 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.