Protein Family IF03217

Metagenome Isolate
111 Members
40 Samples
94 Scaffolds
381.18 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10253353|Ga0123353_102533532
Length
364 aa
Sequence
MEYRELGKTGKKVGVIGLGGEHLDKKPYEQVKETIDAALEHGVNIIDVFMPGKEVREFIAKALGNRRSEVMIQGHIGATNVNEQYDISRDLPTVKKYFEELLRIFGGYIDFGMMFFIDSEKNYNDVFETGFAGSSHNPVTAMKVINTGLPEMFMFSVNPAFDMLPSDEYALDHLDGNFETSMLKGIDPKRAQLYKLCEAKQIGITVMKSLGVGKLISKEHTPFDKPMTVPQCVHYALTRPAVGCILPGCKTAAEVHDIMKYFETTDTERDYSEIISSKKSDFRGSCVYCSHCQPCPEEIDIAAVMKLLDVARLDKQNIPPVIKSQYQNLKHKGDECIGCGSCEERCPFGVEIIENMSEASSLL*

📊 Sample Types

Isolate 15.3%
Metagenome 84.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 52.6%
Unclassified 39.5%
Passalidae 5.3%
Termopsidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 106
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
2 2820333861 Unclassified Firmicutes Nt197P3bin72 Isolate Unclassified
3 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
12 2820292184 Unclassified Firmicutes Th196P3bin109 Isolate Unclassified
13 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
14 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
15 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
16 2590828841 Oscillospiraceae bacterium Ne3 Isolate Termitidae
17 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
18 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
19 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
20 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
25 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
26 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
30 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
31 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
32 2820573558 Unclassified Firmicutes Emb289P3bin140 Isolate Unclassified
33 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
34 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
35 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
39 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
40 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10411837 3300009826 Bacteria 1735
2 Ga0123356_10019582 3300010049 Bacteria 6414
3 Ga0123353_10679886 3300010167 Bacteria 1450
4 2227158579 2225789004 Bacteria 8401
5 Ga0466697_139962 3300042611 Bacteria 2582
6 Ga0123357_10010964 3300009784 Bacteria 11575
7 Ga0123356_10068725 3300010049 Bacteria 3320
8 Ga0123356_10109029 3300010049 Bacteria 2671
9 Ga0123356_10236350 3300010049 Bacteria 1895
10 Ga0123356_10252775 3300010049 Bacteria 1841
11 Ga0123353_10379161 3300010167 Bacteria 2116
12 Ga0123353_10533309 3300010167 Bacteria 1699
13 Ga0123353_10647378 3300010167 Bacteria 1497
14 Ga0123354_10185582 3300010882 Bacteria 2354
15 Ga0466700_116978 3300042600 Bacteria 5106
16 Ga0466700_452767 3300042600 Bacteria 1187
17 Ga0466720_037962 3300042607 Bacteria 7195
18 JGI24702J35022_10000122 3300002462 Bacteria 37778
19 Ga0466699_008840 3300042597 Unclassified 2837
20 Ga0466727_014635 3300042655 Bacteria 2427
21 Ga0123356_10004744 3300010049 Bacteria 14006
22 Ga0123356_10080222 3300010049 Bacteria 3085
23 Ga0123356_10185002 3300010049 Bacteria 2108
24 Ga0123356_10187055 3300010049 Bacteria 2098
25 Ga0123353_10187192 3300010167 Bacteria 3272
26 Ga0123353_10230752 3300010167 Bacteria 2886
27 Ga0123353_10252749 3300010167 Bacteria 2728
28 Ga0123353_10253353 3300010167 Bacteria 2724
29 Ga0123353_10647916 3300010167 Bacteria 1496
30 Ga0123354_10078148 3300010882 Bacteria 4707
31 JGI24705J35276_12234786 3300002504 Bacteria 5843
32 Ga0466693_093300 3300042592 Bacteria 1741
33 Ga0123355_10004010 3300009826 Bacteria 21317
34 Ga0123355_10425389 3300009826 Bacteria 1694
35 Ga0123356_10017298 3300010049 Bacteria 6859
36 Ga0123356_10020426 3300010049 Bacteria 6267
37 Ga0123356_10061247 3300010049 Bacteria 3514
38 Ga0123356_10156509 3300010049 Bacteria 2270
39 Ga0123353_10060906 3300010167 Bacteria 6052
40 Ga0123353_10420292 3300010167 Bacteria 1981
41 IMNBL1DRAFT_c0000277 3300000062 Bacteria 45333
42 IMNBL1DRAFT_c0011581 3300000062 Unclassified 4108
43 JGI24702J35022_10002914 3300002462 Bacteria 10353
44 Ga0123356_10090455 3300010049 Unclassified 2914
45 Ga0123353_10149532 3300010167 Bacteria 3730
46 Ga0123353_10170535 3300010167 Bacteria 3455
47 JGI24702J35022_10000200 3300002462 Bacteria 32566
48 Ga0264413_149030 3300024493 Bacteria 1477
49 Ga0415639_049002 3300038395 Bacteria 8380
50 Ga0123355_10003096 3300009826 Bacteria 23724
51 Ga0123355_10077006 3300009826 Bacteria 5332
52 Ga0123356_10000039 3300010049 Bacteria 138853
53 Ga0123356_10000722 3300010049 Unclassified 36504
54 Ga0123356_10005174 3300010049 Bacteria 13337
55 Ga0123356_10005395 3300010049 Bacteria 13022
56 Ga0123356_10013047 3300010049 Bacteria 8038
57 Ga0123356_10020559 3300010049 Bacteria 6244
58 Ga0123356_10044193 3300010049 Bacteria 4147
59 Ga0123353_10215722 3300010167 Bacteria 3006
60 Ga0123353_10266841 3300010167 Bacteria 2640
61 Ga0123353_10289780 3300010167 Bacteria 2507
62 Ga0123353_10523867 3300010167 Bacteria 1719
63 Ga0123354_10241212 3300010882 Bacteria 1859
64 Ga0072941_1166387 3300005201 Bacteria 2037
65 Ga0415639_011173 3300038395 Bacteria 2820
66 Ga0466693_199471 3300042592 Bacteria 54862
67 Ga0466695_018716 3300042595 Bacteria 1624
68 Ga0466734_119922 3300042623 Bacteria 4189
69 Ga0466734_153019 3300042623 Bacteria 6238
70 Ga0123356_10001943 3300010049 Bacteria 22375
71 Ga0123356_10072489 3300010049 Bacteria 3236
72 Ga0123356_10072656 3300010049 Bacteria 3232
73 Ga0123356_10237524 3300010049 Bacteria 1891
74 Ga0123356_10508160 3300010049 Bacteria 1362
75 Ga0123353_10015435 3300010167 Bacteria 11096
76 Ga0123353_10176221 3300010167 Bacteria 3390
77 Ga0123353_10253783 3300010167 Bacteria 2721
78 Ga0123353_10485073 3300010167 Bacteria 1807
79 Ga0466714_150039 3300042603 Bacteria 3459
80 Ga0466720_009658 3300042607 Bacteria 10989
81 Ga0466720_088552 3300042607 Unclassified 6430
82 AustNasuHG_c1011568 3300000089 Bacteria 3056
83 Ga0415639_016194 3300038395 Bacteria 7482
84 Ga0415639_019469 3300038395 Bacteria 1279
85 Ga0415639_053356 3300038395 Bacteria 2045
86 Ga0466725_152990 3300042654 Bacteria 5185
87 Ga0123356_10058835 3300010049 Bacteria 3584
88 Ga0123353_10004516 3300010167 Bacteria 17931
89 Ga0123353_10478329 3300010167 Bacteria 1823
90 Ga0123354_10224278 3300010882 Bacteria 1986
91 Ga0466714_122666 3300042603 Bacteria 1590
92 Ga0466697_003557 3300042611 Bacteria 1415
93 IMNBL1DRAFT_c0000791 3300000062 Bacteria 24938
94 Ga0466694_177432 3300042594 Bacteria 1227

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042600 Ga0466700_452767 Ga0466700_452767_171_1169 332
2 3300005201 Ga0072941_1166387 Ga0072941_11663872 360
3 3300038395 Ga0415639_053356 Ga0415639_053356_31_1113 360
4 3300010049 Ga0123356_10020426 Ga0123356_100204262 364
5 3300010167 Ga0123353_10253353 Ga0123353_102533532 364
6 3300038395 Ga0415639_016194 Ga0415639_016194_4031_5173 364
7 3300038395 Ga0415639_049002 Ga0415639_049002_2189_3355 371
8 3300010167 Ga0123353_10379161 Ga0123353_103791612 372
9 3300010049 Ga0123356_10000039 Ga0123356_10000039139 373
10 iso_pr_bacteria 2820420508 2820420812 377
11 3300010167 Ga0123353_10004516 Ga0123353_100045166 378
12 iso_pr_bacteria 2820267566 2820269057 379
13 2225789004 2227158579 2227567229 380
14 3300010049 Ga0123356_10013047 Ga0123356_100130474 380
15 3300010167 Ga0123353_10252749 Ga0123353_102527492 380
16 3300010167 Ga0123353_10266841 Ga0123353_102668412 380
17 3300010167 Ga0123353_10289780 Ga0123353_102897802 380
18 3300010167 Ga0123353_10647378 Ga0123353_106473782 380
19 3300038395 Ga0415639_011173 Ga0415639_011173_37_1179 380
20 3300038395 Ga0415639_019469 Ga0415639_019469_66_1208 380
21 3300042597 Ga0466699_008840 Ga0466699_008840_985_2127 380
22 iso_pr_bacteria 2590828841 2593259965 380
23 iso_pr_bacteria 2820333861 2820334933 380
24 iso_pr_bacteria 2820560510 2820560836 380
25 iso_pr_bacteria 2820573558 2820574126 380
26 3300000062 IMNBL1DRAFT_c0000791 IMNBL1DRAFT_000079122 381
27 3300000062 IMNBL1DRAFT_c0011581 IMNBL1DRAFT_00115812 381
28 3300000089 AustNasuHG_c1011568 AustNasuHG_10115682 381
29 3300002504 JGI24705J35276_12234786 JGI24705J35276_122347863 381
30 3300009826 Ga0123355_10004010 Ga0123355_100040104 381
31 3300010049 Ga0123356_10000722 Ga0123356_100007229 381
32 3300010049 Ga0123356_10005174 Ga0123356_1000517410 381
33 3300010049 Ga0123356_10005395 Ga0123356_100053955 381
34 3300010049 Ga0123356_10061247 Ga0123356_100612472 381
35 3300010049 Ga0123356_10072489 Ga0123356_100724892 381
36 3300010049 Ga0123356_10072656 Ga0123356_100726562 381
37 3300010049 Ga0123356_10109029 Ga0123356_101090291 381
38 3300010049 Ga0123356_10187055 Ga0123356_101870552 381
39 3300010049 Ga0123356_10236350 Ga0123356_102363502 381
40 3300010049 Ga0123356_10252775 Ga0123356_102527751 381
41 3300010049 Ga0123356_10508160 Ga0123356_105081602 381
42 3300010167 Ga0123353_10215722 Ga0123353_102157222 381
43 3300010167 Ga0123353_10253783 Ga0123353_102537832 381
44 3300010167 Ga0123353_10679886 Ga0123353_106798861 381
45 3300010882 Ga0123354_10078148 Ga0123354_100781483 381
46 3300024493 Ga0264413_149030 Ga0264413_1490301 381
47 3300042592 Ga0466693_093300 Ga0466693_093300_330_1475 381
48 3300042594 Ga0466694_177432 Ga0466694_177432_49_1194 381
49 3300042595 Ga0466695_018716 Ga0466695_018716_149_1294 381
50 3300042607 Ga0466720_009658 Ga0466720_009658_1056_2201 381
51 3300042607 Ga0466720_037962 Ga0466720_037962_3951_5096 381
52 3300042607 Ga0466720_088552 Ga0466720_088552_1959_3104 381
53 3300042611 Ga0466697_139962 Ga0466697_139962_33_1178 381
54 3300042654 Ga0466725_152990 Ga0466725_152990_2688_3833 381
55 iso_pr_bacteria 2781125661 2781333742 381
56 iso_pr_bacteria 2781125663 2781338867 381
57 iso_pr_bacteria 2820272499 2820275142 381
58 iso_pr_bacteria 2820292184 2820293822 381
59 iso_pr_bacteria 2820318056 2820319048 381
60 3300009826 Ga0123355_10003096 Ga0123355_1000309621 382
61 3300009826 Ga0123355_10411837 Ga0123355_104118373 382
62 3300009826 Ga0123355_10425389 Ga0123355_104253892 382
63 3300010049 Ga0123356_10001943 Ga0123356_1000194319 382
64 3300010049 Ga0123356_10020559 Ga0123356_100205593 382
65 3300010049 Ga0123356_10044193 Ga0123356_100441932 382
66 3300010049 Ga0123356_10068725 Ga0123356_100687252 382
67 3300010049 Ga0123356_10156509 Ga0123356_101565092 382
68 3300010049 Ga0123356_10237524 Ga0123356_102375242 382
69 3300010167 Ga0123353_10015435 Ga0123353_100154359 382
70 3300010167 Ga0123353_10060906 Ga0123353_100609062 382
71 3300010167 Ga0123353_10149532 Ga0123353_101495322 382
72 3300010882 Ga0123354_10224278 Ga0123354_102242782 382
73 3300042603 Ga0466714_122666 Ga0466714_122666_358_1506 382
74 3300042603 Ga0466714_150039 Ga0466714_150039_2119_3267 382
75 3300042611 Ga0466697_003557 Ga0466697_003557_84_1232 382
76 iso_pr_bacteria 2820227065 2820227384 382
77 iso_pr_bacteria 2820231849 2820232125 382
78 iso_pr_bacteria 2820238527 2820239162 382
79 3300002462 JGI24702J35022_10000122 JGI24702J35022_1000012222 383
80 3300002462 JGI24702J35022_10002914 JGI24702J35022_100029143 383
81 3300010049 Ga0123356_10058835 Ga0123356_100588353 383
82 3300010049 Ga0123356_10185002 Ga0123356_101850022 383
83 3300010882 Ga0123354_10241212 Ga0123354_102412121 383
84 iso_pr_bacteria 2820234266 2820235492 383
85 3300000062 IMNBL1DRAFT_c0000277 IMNBL1DRAFT_000027737 384
86 3300009784 Ga0123357_10010964 Ga0123357_100109644 384
87 3300009826 Ga0123355_10077006 Ga0123355_100770062 384
88 3300010049 Ga0123356_10080222 Ga0123356_100802221 384
89 3300010167 Ga0123353_10420292 Ga0123353_104202921 384
90 3300010167 Ga0123353_10523867 Ga0123353_105238672 384
91 3300010167 Ga0123353_10533309 Ga0123353_105333092 384
92 3300010167 Ga0123353_10647916 Ga0123353_106479161 384
93 3300042655 Ga0466727_014635 Ga0466727_014635_277_1431 384
94 3300010049 Ga0123356_10017298 Ga0123356_100172982 385
95 3300010167 Ga0123353_10187192 Ga0123353_101871922 385
96 3300010167 Ga0123353_10230752 Ga0123353_102307521 385
97 3300010882 Ga0123354_10185582 Ga0123354_101855823 385
98 3300042623 Ga0466734_119922 Ga0466734_119922_2019_3176 385
99 iso_pr_bacteria 2820223845 2820224344 385
100 3300002462 JGI24702J35022_10000200 JGI24702J35022_100002003 386
101 3300010049 Ga0123356_10019582 Ga0123356_100195822 387
102 3300010049 Ga0123356_10090455 Ga0123356_100904553 387
103 3300010167 Ga0123353_10478329 Ga0123353_104783292 387
104 3300042592 Ga0466693_199471 Ga0466693_199471_20796_21959 387
105 3300010167 Ga0123353_10485073 Ga0123353_104850732 389
106 3300010167 Ga0123353_10170535 Ga0123353_101705352 390
107 3300042623 Ga0466734_153019 Ga0466734_153019_3598_4779 393
108 iso_pr_bacteria 2781125661 2781333317 394
109 3300010049 Ga0123356_10004744 Ga0123356_100047445 395
110 3300042600 Ga0466700_116978 Ga0466700_116978_3055_4260 401
111 3300010167 Ga0123353_10176221 Ga0123353_101762213 405

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13187 Fer4_9 4Fe-4S dicluster domain 286 349 0.91
PF13183 Fer4_8 4Fe-4S dicluster domain 285 350 0.62

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.71 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.