Protein Family IF03207

Metagenome Isolate
126 Members
47 Samples
120 Scaffolds
220.87 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10227438|Ga0123353_102274383
Length
244 aa
Sequence
MYLPFTIKYDIMSKTNYLFWEATMDDAFILSHVDHTLLAATASWAEIEQLCTEAIENNTASVCIPPCYIGRIKKTFPNLNVCTVIGFPLGYDVVSAKAASAQAAIDDGAGELDMVINITDVKNGDFAAITAEIATLKAIAGQHILKVIIETCYLTEPEKIAMCKAVTDAGADYIKTSTGFGTAGATIEDIILFKAHIGPNVKIKAAGGIRTREDMVAYIEAGCSRLGTSSAIKILAGGKTTGY*

📊 Sample Types

Isolate 4.8%
Metagenome 95.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Kalotermitidae 27.7%
Unclassified 19.1%
Passalidae 6.4%
Rhinotermitidae 4.3%
Termopsidae 4.3%
Hodotermitidae 2.1%
Armadillidiidae 2.1%

🌳 Taxonomy

Archaea 4
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
5 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
6 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
7 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
8 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
9 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
10 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
11 2820512088 Unclassified Firmicutes Lab288P1bin4 Isolate Unclassified
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
21 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
22 2820257794 Unclassified Firmicutes Th196P3bin47 Isolate Unclassified
23 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
24 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
27 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
28 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
29 2820223845 Unclassified Firmicutes Th196P4bin57 Isolate Unclassified
30 2820318056 Unclassified Firmicutes Nt197P3bin94 Isolate Unclassified
31 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
32 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
37 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
38 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466726_211052 3300042619 Bacteria 6208
2 Ga0123355_10274789 3300009826 Bacteria 2335
3 Ga0123356_10478288 3300010049 Bacteria 1398
4 Ga0123353_10227438 3300010167 Bacteria 2911
5 Ga0123353_11219013 3300010167 Bacteria 985
6 Ga0466730_015918 3300042625 Bacteria 2175
7 Ga0466690_172364 3300042590 Bacteria 2619
8 JGI24702J35022_10000013 3300002462 Bacteria 68740
9 Ga0068305_10000975 3300005083 Bacteria 96425
10 Ga0466728_416519 3300042620 Bacteria 3279
11 Ga0123353_10145715 3300010167 Bacteria 3787
12 Ga0123353_10210806 3300010167 Unclassified 3047
13 Ga0123353_10219590 3300010167 Archaea 2974
14 Ga0123354_10331035 3300010882 Bacteria 1388
15 Ga0466696_050727 3300042596 Bacteria 9606
16 Ga0466721_072332 3300042608 Bacteria 6986
17 2227646847 2225789004 Unclassified 10924
18 Ga0466705_309406 3300042612 Bacteria 1218
19 Ga0466733_209352 3300042659 Bacteria 6690
20 Ga0123356_10029869 3300010049 Bacteria 5102
21 Ga0123356_10037608 3300010049 Bacteria 4514
22 Ga0123356_10129091 3300010049 Bacteria 2473
23 Ga0123356_10631888 3300010049 Bacteria 1237
24 Ga0123353_10541097 3300010167 Bacteria 1683
25 Ga0123353_10606143 3300010167 Bacteria 1563
26 Ga0123354_10160957 3300010882 Archaea 2665
27 Ga0123354_10447715 3300010882 Bacteria 1049
28 Ga0466729_226048 3300042621 Bacteria 2388
29 Ga0466704_034743 3300042643 Bacteria 5765
30 Ga0466708_379448 3300042652 Bacteria 15234
31 Ga0466691_049270 3300042593 Bacteria 6339
32 Ga0466691_150732 3300042593 Bacteria 2692
33 Ga0466694_022674 3300042594 Bacteria 1132
34 Ga0466694_355848 3300042594 Bacteria 3008
35 JGI24702J35022_10223069 3300002462 Unclassified 1087
36 Ga0466728_460206 3300042620 Bacteria 5122
37 Ga0123356_10076338 3300010049 Bacteria 3158
38 Ga0123356_10128621 3300010049 Bacteria 2477
39 Ga0123356_10166814 3300010049 Bacteria 2207
40 Ga0123356_10427609 3300010049 Bacteria 1468
41 Ga0123353_10092511 3300010167 Bacteria 4872
42 Ga0123353_10183434 3300010167 Bacteria 3311
43 Ga0123353_10621821 3300010167 Bacteria 1537
44 Ga0123353_10923331 3300010167 Bacteria 1185
45 Ga0123353_11082362 3300010167 Unclassified 1067
46 Ga0466704_104976 3300042643 Bacteria 8139
47 Ga0160469_101976 3300012824 Bacteria 4447
48 Ga0415639_073210 3300038395 Bacteria 2685
49 Ga0466696_271359 3300042596 Bacteria 4888
50 Ga0466713_146406 3300042602 Bacteria 1636
51 Ga0466719_326392 3300042606 Bacteria 1187
52 JGI24702J35022_10140321 3300002462 Archaea 1348
53 Ga0466705_024637 3300042612 Bacteria 5373
54 Ga0123356_10000446 3300010049 Bacteria 46577
55 Ga0123356_10095149 3300010049 Bacteria 2847
56 Ga0123353_10039244 3300010167 Bacteria 7451
57 Ga0123353_10123418 3300010167 Bacteria 4163
58 Ga0123353_10142185 3300010167 Bacteria 3842
59 Ga0123353_10312223 3300010167 Bacteria 2392
60 Ga0466708_011557 3300042652 Bacteria 5280
61 Ga0466727_168624 3300042655 Bacteria 1515
62 Ga0466727_255649 3300042655 Bacteria 2882
63 Ga0466693_045574 3300042592 Bacteria 1447
64 Ga0466694_289933 3300042594 Bacteria 1527
65 Ga0466707_351541 3300042601 Bacteria 1722
66 Ga0466713_022763 3300042602 Unclassified 37805
67 Ga0466716_130577 3300042605 Bacteria 11425
68 IMNBL1DRAFT_c0000036 3300000062 Bacteria 120012
69 IMNBL1DRAFT_c0057123 3300000062 Bacteria 1193
70 Ga0466715_392342 3300042616 Bacteria 63693
71 Ga0123357_10147022 3300009784 Bacteria 2874
72 Ga0123355_10447564 3300009826 Bacteria 1630
73 Ga0123356_10066737 3300010049 Bacteria 3369
74 Ga0123353_10004835 3300010167 Bacteria 17501
75 Ga0123353_10042245 3300010167 Bacteria 7209
76 Ga0123354_10510722 3300010882 Bacteria 930
77 Ga0466731_013391 3300042622 Bacteria 2378
78 Ga0466714_015876 3300042603 Bacteria 11383
79 Ga0466719_301822 3300042606 Bacteria 3142
80 Ga0466719_377776 3300042606 Bacteria 16760
81 JGI24695J34938_10000052 3300002450 Bacteria 90676
82 JGI24702J35022_10000752 3300002462 Bacteria 20000
83 Ga0123355_10563417 3300009826 Bacteria 1371
84 Ga0123356_10121807 3300010049 Bacteria 2539
85 Ga0123356_10296758 3300010049 Bacteria 1719
86 Ga0123356_10604013 3300010049 Bacteria 1262
87 Ga0123356_10624149 3300010049 Bacteria 1244
88 Ga0123356_10888994 3300010049 Bacteria 1062
89 Ga0123356_11055649 3300010049 Bacteria 982
90 Ga0123353_10790830 3300010167 Unclassified 1312
91 Ga0123353_11473310 3300010167 Bacteria 869
92 Ga0123354_10158156 3300010882 Bacteria 2706
93 Ga0466731_053130 3300042622 Bacteria 1631
94 Ga0466704_430858 3300042643 Bacteria 10507
95 Ga0466709_393885 3300042648 Bacteria 33752
96 Ga0466708_025400 3300042652 Bacteria 5709
97 Ga0466691_080917 3300042593 Bacteria 2854
98 Ga0466707_060099 3300042601 Bacteria 5624
99 Ga0072940_1001700 3300005200 Bacteria 7033
100 Ga0466705_161205 3300042612 Bacteria 3651
101 Ga0466711_488710 3300042615 Bacteria 35901
102 Ga0466723_224703 3300042618 Bacteria 2786
103 Ga0466726_048894 3300042619 Bacteria 1806
104 Ga0466728_482621 3300042620 Bacteria 1462
105 Ga0123356_10005085 3300010049 Bacteria 13485
106 Ga0123356_10040257 3300010049 Bacteria 4354
107 Ga0123356_10328640 3300010049 Bacteria 1645
108 Ga0123356_10424510 3300010049 Bacteria 1472
109 Ga0123353_10037774 3300010167 Bacteria 7578
110 Ga0123353_10044644 3300010167 Bacteria 7027
111 Ga0123353_11171826 3300010167 Unclassified 1012
112 Ga0123354_10586449 3300010882 Archaea 823
113 Ga0466709_373148 3300042648 Bacteria 39663
114 Ga0466727_287695 3300042655 Bacteria 1823
115 Ga0466727_288569 3300042655 Bacteria 1237
116 Ga0466693_073550 3300042592 Bacteria 1128
117 Ga0466706_028086 3300042599 Bacteria 4190
118 Ga0466713_145384 3300042602 Bacteria 1202
119 Ga0466722_134871 3300042609 Bacteria 4855
120 IMNBGM34_c000132 3300000036 Bacteria 21574

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042593 Ga0466691_049270 Ga0466691_049270_2729_3385 199
2 3300010049 Ga0123356_10424510 Ga0123356_104245102 207
3 3300042593 Ga0466691_080917 Ga0466691_080917_2217_2843 208
4 3300002462 JGI24702J35022_10140321 JGI24702J35022_101403213 213
5 3300042615 Ga0466711_488710 Ga0466711_488710_26591_27235 214
6 iso_pr_bacteria 2820257794 2820258538 214
7 3300042606 Ga0466719_301822 Ga0466719_301822_2176_2823 215
8 3300042606 Ga0466719_326392 Ga0466719_326392_463_1110 215
9 3300042609 Ga0466722_134871 Ga0466722_134871_526_1173 215
10 3300042620 Ga0466728_460206 Ga0466728_460206_3536_4183 215
11 3300042655 Ga0466727_168624 Ga0466727_168624_240_887 215
12 3300009784 Ga0123357_10147022 Ga0123357_101470222 216
13 3300010049 Ga0123356_10128621 Ga0123356_101286212 216
14 3300042596 Ga0466696_271359 Ga0466696_271359_123_773 216
15 3300042602 Ga0466713_145384 Ga0466713_145384_87_737 216
16 3300042603 Ga0466714_015876 Ga0466714_015876_8077_8727 216
17 3300042619 Ga0466726_211052 Ga0466726_211052_4589_5239 216
18 3300042655 Ga0466727_288569 Ga0466727_288569_157_807 216
19 iso_pr_bacteria 2820223845 2820225235 216
20 3300002462 JGI24702J35022_10000752 JGI24702J35022_1000075220 217
21 3300005200 Ga0072940_1001700 Ga0072940_10017007 217
22 3300042606 Ga0466719_377776 Ga0466719_377776_5277_5930 217
23 3300042618 Ga0466723_224703 Ga0466723_224703_693_1346 217
24 3300042620 Ga0466728_416519 Ga0466728_416519_1117_1770 217
25 3300042620 Ga0466728_482621 Ga0466728_482621_223_876 217
26 3300042648 Ga0466709_373148 Ga0466709_373148_26783_27436 217
27 3300042652 Ga0466708_011557 Ga0466708_011557_3164_3817 217
28 3300042605 Ga0466716_130577 Ga0466716_130577_2866_3522 218
29 3300042652 Ga0466708_025400 Ga0466708_025400_799_1455 218
30 3300038395 Ga0415639_073210 Ga0415639_073210_1470_2132 220
31 3300042592 Ga0466693_045574 Ga0466693_045574_739_1401 220
32 3300042592 Ga0466693_073550 Ga0466693_073550_250_912 220
33 3300042594 Ga0466694_022674 Ga0466694_022674_10_672 220
34 3300042594 Ga0466694_289933 Ga0466694_289933_213_875 220
35 3300042594 Ga0466694_355848 Ga0466694_355848_2083_2745 220
36 3300042596 Ga0466696_050727 Ga0466696_050727_5227_5889 220
37 3300042612 Ga0466705_024637 Ga0466705_024637_387_1049 220
38 3300042612 Ga0466705_161205 Ga0466705_161205_671_1333 220
39 3300042612 Ga0466705_309406 Ga0466705_309406_496_1158 220
40 3300042622 Ga0466731_013391 Ga0466731_013391_90_752 220
41 3300042622 Ga0466731_053130 Ga0466731_053130_861_1523 220
42 3300042643 Ga0466704_034743 Ga0466704_034743_4917_5579 220
43 3300042643 Ga0466704_104976 Ga0466704_104976_1868_2530 220
44 3300042643 Ga0466704_430858 Ga0466704_430858_7431_8093 220
45 3300042652 Ga0466708_379448 Ga0466708_379448_8928_9590 220
46 iso_pr_bacteria 2781125646 2781300682 220
47 iso_pr_bacteria 2820220859 2820220993 220
48 iso_pr_bacteria 2820318056 2820318624 220
49 2225789004 2227646847 2228240270 221
50 3300002450 JGI24695J34938_10000052 JGI24695J34938_100000525 221
51 3300002462 JGI24702J35022_10000013 JGI24702J35022_1000001311 221
52 3300002462 JGI24702J35022_10223069 JGI24702J35022_102230691 221
53 3300009826 Ga0123355_10274789 Ga0123355_102747893 221
54 3300009826 Ga0123355_10447564 Ga0123355_104475643 221
55 3300010049 Ga0123356_10029869 Ga0123356_100298696 221
56 3300010049 Ga0123356_10037608 Ga0123356_100376085 221
57 3300010049 Ga0123356_10040257 Ga0123356_100402573 221
58 3300010049 Ga0123356_10121807 Ga0123356_101218074 221
59 3300010049 Ga0123356_10129091 Ga0123356_101290912 221
60 3300010049 Ga0123356_10166814 Ga0123356_101668142 221
61 3300010049 Ga0123356_10328640 Ga0123356_103286403 221
62 3300010049 Ga0123356_10427609 Ga0123356_104276092 221
63 3300010049 Ga0123356_10478288 Ga0123356_104782883 221
64 3300010049 Ga0123356_10604013 Ga0123356_106040132 221
65 3300010049 Ga0123356_10624149 Ga0123356_106241491 221
66 3300010049 Ga0123356_10631888 Ga0123356_106318882 221
67 3300010049 Ga0123356_11055649 Ga0123356_110556491 221
68 3300010167 Ga0123353_10004835 Ga0123353_100048358 221
69 3300010167 Ga0123353_10037774 Ga0123353_100377744 221
70 3300010167 Ga0123353_10039244 Ga0123353_100392445 221
71 3300010167 Ga0123353_10042245 Ga0123353_100422452 221
72 3300010167 Ga0123353_10044644 Ga0123353_100446441 221
73 3300010167 Ga0123353_10092511 Ga0123353_100925114 221
74 3300010167 Ga0123353_10145715 Ga0123353_101457154 221
75 3300010167 Ga0123353_10183434 Ga0123353_101834342 221
76 3300010167 Ga0123353_10312223 Ga0123353_103122232 221
77 3300010167 Ga0123353_10541097 Ga0123353_105410971 221
78 3300010167 Ga0123353_10621821 Ga0123353_106218211 221
79 3300010167 Ga0123353_10790830 Ga0123353_107908301 221
80 3300010167 Ga0123353_10923331 Ga0123353_109233311 221
81 3300010167 Ga0123353_11082362 Ga0123353_110823622 221
82 3300010167 Ga0123353_11171826 Ga0123353_111718261 221
83 3300010167 Ga0123353_11219013 Ga0123353_112190131 221
84 3300010167 Ga0123353_11473310 Ga0123353_114733101 221
85 3300010882 Ga0123354_10158156 Ga0123354_101581563 221
86 3300010882 Ga0123354_10160957 Ga0123354_101609572 221
87 3300010882 Ga0123354_10331035 Ga0123354_103310351 221
88 3300010882 Ga0123354_10447715 Ga0123354_104477151 221
89 3300010882 Ga0123354_10510722 Ga0123354_105107222 221
90 3300010882 Ga0123354_10586449 Ga0123354_105864491 221
91 3300042602 Ga0466713_146406 Ga0466713_146406_186_851 221
92 3300042625 Ga0466730_015918 Ga0466730_015918_422_1087 221
93 3300042659 Ga0466733_209352 Ga0466733_209352_5650_6315 221
94 iso_pr_bacteria 2820512088 2820512364 221
95 3300000062 IMNBL1DRAFT_c0000036 IMNBL1DRAFT_000003685 222
96 3300000062 IMNBL1DRAFT_c0057123 IMNBL1DRAFT_00571232 222
97 3300010049 Ga0123356_10000446 Ga0123356_1000044614 222
98 3300010167 Ga0123353_10123418 Ga0123353_101234182 222
99 3300010167 Ga0123353_10142185 Ga0123353_101421854 222
100 3300010167 Ga0123353_10210806 Ga0123353_102108063 222
101 3300012824 Ga0160469_101976 Ga0160469_1019765 222
102 3300042601 Ga0466707_060099 Ga0466707_060099_1723_2391 222
103 3300042601 Ga0466707_351541 Ga0466707_351541_261_929 222
104 3300042602 Ga0466713_022763 Ga0466713_022763_17571_18239 222
105 3300042616 Ga0466715_392342 Ga0466715_392342_50628_51296 222
106 3300042619 Ga0466726_048894 Ga0466726_048894_881_1549 222
107 3300042621 Ga0466729_226048 Ga0466729_226048_724_1392 222
108 3300042648 Ga0466709_393885 Ga0466709_393885_20624_21292 222
109 3300005083 Ga0068305_10000975 Ga0068305_1000097564 223
110 3300042590 Ga0466690_172364 Ga0466690_172364_739_1413 224
111 3300042655 Ga0466727_255649 Ga0466727_255649_2039_2713 224
112 3300010049 Ga0123356_10005085 Ga0123356_100050857 225
113 3300010049 Ga0123356_10076338 Ga0123356_100763383 225
114 3300010049 Ga0123356_10095149 Ga0123356_100951493 225
115 3300010049 Ga0123356_10296758 Ga0123356_102967581 226
116 3300010049 Ga0123356_10888994 Ga0123356_108889942 229
117 3300010167 Ga0123353_10606143 Ga0123353_106061432 229
118 3300042599 Ga0466706_028086 Ga0466706_028086_1931_2620 229
119 3300010167 Ga0123353_10219590 Ga0123353_102195902 230
120 3300042608 Ga0466721_072332 Ga0466721_072332_5445_6140 231
121 3300042655 Ga0466727_287695 Ga0466727_287695_771_1466 231
122 3300042593 Ga0466691_150732 Ga0466691_150732_1324_2022 232
123 3300009826 Ga0123355_10563417 Ga0123355_105634173 238
124 3300010049 Ga0123356_10066737 Ga0123356_100667375 238
125 3300000036 IMNBGM34_c000132 IMNBGM34_00013220 242
126 3300010167 Ga0123353_10227438 Ga0123353_102274383 244

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01791 DeoC DeoC/LacD family aldolase 33 220 0.89

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01791 GO:0016829 lyase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.88 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.