Protein Family IF03200
Metagenome
Isolate
131
Members
68
Samples
103
Scaffolds
189.39
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10215561|Ga0123353_102155613
- Length
- 223 aa
- Sequence
- MKQKKCLWLTCSLAKWYSHSENNNRHKQNLLIQINKIAIFASGNGSNFEAIARACAENRLNTEVAVLVCDNPKAFVIQRAEKFNIPIFEFQPKDYTSKADYETEIVQLLKKHDVDLICLAGYMRLVSDVLLDEYQGRIINIHPSLLPDFKGLNAIQRAFESGAKITGVTTHFVDKTIDGGKIIDQVEVPIGNCTLEELETRIHTAEHELYIKTIAKVLTLQK*
Sample Types
Isolate
21.4%
Metagenome
78.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
36.8%
Unclassified
22.1%
Apidae
14.7%
Kalotermitidae
5.9%
Tenebrionidae
4.4%
Formicidae
2.9%
Rhinotermitidae
2.9%
Drosophilidae
2.9%
Passalidae
1.5%
Curculionidae
1.5%
Armadillidiidae
1.5%
Vespidae
1.5%
Bombycidae
1.5%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 3 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 4 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 5 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 6 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 7 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 8 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 9 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 10 | 2820513949 | Unclassified Firmicutes Lab288P1bin39 | Isolate | Unclassified |
| 11 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 12 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 13 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 14 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 15 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 16 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 17 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 3300003973 | Ips typographus gut microbial communities from Hannover, Germany - first DNA extraction october 2014, adult beetle | Metagenome | Curculionidae |
| 23 | 2820785563 | Unclassified Bacteroidetes Emb289P1bin74 | Isolate | Unclassified |
| 24 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 25 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 26 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 27 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 28 | 3300002932 | Cephalotes varians larva microbial communities from Drexel University, Philadelphia, USA - Larval gut metagenome for colony PL010 | Metagenome | Formicidae |
| 29 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 30 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 31 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 32 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 33 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 34 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 35 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 36 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 37 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 38 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 39 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 42 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 45 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 46 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 47 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 48 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 49 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 50 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 51 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 52 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 53 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 54 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 55 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 56 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 57 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 58 | 2820788205 | Unclassified Bacteroidetes Emb289P1bin57 | Isolate | Unclassified |
| 59 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 60 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 61 | 2905310146 | Ligilactobacillus salivarius A3iob | Isolate | Apidae |
| 62 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 63 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 64 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 65 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 66 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 67 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 68 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_157355 | 3300042611 | Bacteria | 1531 |
| 2 | Ga0562379_1431 | 3300056790 | Bacteria | 27299 |
| 3 | Ga0123355_10000052 | 3300009826 | Bacteria | 119479 |
| 4 | Ga0123355_10006209 | 3300009826 | Bacteria | 17650 |
| 5 | Ga0123355_10008958 | 3300009826 | Bacteria | 15160 |
| 6 | Ga0123356_10083420 | 3300010049 | Bacteria | 3028 |
| 7 | Ga0123353_10000528 | 3300010167 | Bacteria | 47327 |
| 8 | Ga0123353_10251007 | 3300010167 | Bacteria | 2740 |
| 9 | Ga0123353_10276019 | 3300010167 | Bacteria | 2585 |
| 10 | Ga0123353_10521214 | 3300010167 | Bacteria | 1724 |
| 11 | Ga0123354_10080446 | 3300010882 | Bacteria | 4612 |
| 12 | Ga0466707_102059 | 3300042601 | Bacteria | 69996 |
| 13 | Ga0466692_033158 | 3300042591 | Bacteria | 1330 |
| 14 | Ga0466693_050325 | 3300042592 | Bacteria | 1206 |
| 15 | Ga0466694_089331 | 3300042594 | Bacteria | 2497 |
| 16 | Ga0466697_076414 | 3300042611 | Bacteria | 5917 |
| 17 | Ga0466697_269208 | 3300042611 | Bacteria | 1496 |
| 18 | Ga0466705_360594 | 3300042612 | Bacteria | 4316 |
| 19 | Ga0562375_0201 | 3300056856 | Bacteria | 169177 |
| 20 | Ga0466710_062425 | 3300042613 | Bacteria | 7001 |
| 21 | Ga0466710_114795 | 3300042613 | Bacteria | 1619 |
| 22 | Ga0123355_10007358 | 3300009826 | Bacteria | 16491 |
| 23 | Ga0123355_10189341 | 3300009826 | Bacteria | 3034 |
| 24 | Ga0466707_304110 | 3300042601 | Bacteria | 1309 |
| 25 | Ga0466714_115163 | 3300042603 | Bacteria | 7605 |
| 26 | Ga0466729_204790 | 3300042621 | Bacteria | 38023 |
| 27 | Ga0466704_119946 | 3300042643 | Bacteria | 27786 |
| 28 | Ga0466709_351693 | 3300042648 | Unclassified | 159683 |
| 29 | 2227080766 | 2225789004 | Bacteria | 378528 |
| 30 | JGI24696J40584_12880254 | 3300002834 | Bacteria | 1082 |
| 31 | Ga0063521_1001622 | 3300003973 | Bacteria | 5887 |
| 32 | Ga0068305_10048238 | 3300005083 | Unclassified | 1491 |
| 33 | Ga0466695_268109 | 3300042595 | Bacteria | 1446 |
| 34 | Ga0466697_270482 | 3300042611 | Bacteria | 2206 |
| 35 | Ga0123355_10173616 | 3300009826 | Bacteria | 3215 |
| 36 | Ga0123356_11910737 | 3300010049 | Unclassified | 739 |
| 37 | Ga0123353_10001427 | 3300010167 | Bacteria | 29228 |
| 38 | Ga0123353_10192887 | 3300010167 | Unclassified | 3214 |
| 39 | Ga0123353_11354286 | 3300010167 | Unclassified | 919 |
| 40 | Ga0466701_024946 | 3300042598 | Bacteria | 1473 |
| 41 | Ga0466657_186990 | 3300042582 | Bacteria | 3618 |
| 42 | Ga0466693_373460 | 3300042592 | Bacteria | 2493 |
| 43 | Ga0466701_005833 | 3300042598 | Bacteria | 28890 |
| 44 | Ga0123355_10000377 | 3300009826 | Bacteria | 57341 |
| 45 | Ga0123356_10053416 | 3300010049 | Bacteria | 3760 |
| 46 | Ga0123356_10329539 | 3300010049 | Bacteria | 1643 |
| 47 | Ga0123353_10001064 | 3300010167 | Bacteria | 33541 |
| 48 | Ga0123353_10016075 | 3300010167 | Bacteria | 10916 |
| 49 | Ga0123353_10019125 | 3300010167 | Bacteria | 10163 |
| 50 | Ga0123353_10651684 | 3300010167 | Bacteria | 1491 |
| 51 | Ga0466707_187936 | 3300042601 | Bacteria | 4525 |
| 52 | Ga0466697_051729 | 3300042611 | Bacteria | 3068 |
| 53 | Ga0466731_038103 | 3300042622 | Bacteria | 6005 |
| 54 | JGI24696J40584_12960987 | 3300002834 | Bacteria | 9842 |
| 55 | CVPL010L_1002372 | 3300002932 | Bacteria | 4558 |
| 56 | Ga0466697_083092 | 3300042611 | Bacteria | 1472 |
| 57 | Ga0466710_072970 | 3300042613 | Bacteria | 1780 |
| 58 | Ga0123353_10019273 | 3300010167 | Bacteria | 10127 |
| 59 | JGI24695J34938_10117445 | 3300002450 | Bacteria | 1083 |
| 60 | JGI24702J35022_10255558 | 3300002462 | Unclassified | 1021 |
| 61 | JGI24696J40584_12860687 | 3300002834 | Unclassified | 1011 |
| 62 | Ga0068305_10026415 | 3300005083 | Bacteria | 4169 |
| 63 | Ga0072940_1349139 | 3300005200 | Bacteria | 2341 |
| 64 | Ga0160443_101164 | 3300012848 | Bacteria | 10256 |
| 65 | Ga0562377_0767 | 3300056842 | Bacteria | 44402 |
| 66 | Ga0466710_425159 | 3300042613 | Bacteria | 1437 |
| 67 | Ga0123356_10512107 | 3300010049 | Unclassified | 1357 |
| 68 | Ga0466717_155656 | 3300042604 | Bacteria | 3681 |
| 69 | Ga0466698_385525 | 3300042610 | Bacteria | 4026 |
| 70 | Ga0466703_393151 | 3300042636 | Bacteria | 1691 |
| 71 | JGI24695J34938_10257938 | 3300002450 | Bacteria | 742 |
| 72 | CVPL010L_1004452 | 3300002932 | Unclassified | 1496 |
| 73 | Ga0415639_006949 | 3300038395 | Bacteria | 2170 |
| 74 | Ga0415639_088082 | 3300038395 | Bacteria | 1575 |
| 75 | Ga0466693_113594 | 3300042592 | Bacteria | 1500 |
| 76 | Ga0466693_267583 | 3300042592 | Bacteria | 2000 |
| 77 | Ga0466694_072609 | 3300042594 | Bacteria | 1068 |
| 78 | Ga0466697_141335 | 3300042611 | Bacteria | 3120 |
| 79 | Ga0466710_211123 | 3300042613 | Bacteria | 1459 |
| 80 | Ga0123355_10369246 | 3300009826 | Bacteria | 1881 |
| 81 | Ga0123356_10399008 | 3300010049 | Unclassified | 1512 |
| 82 | Ga0123353_10083421 | 3300010167 | Bacteria | 5142 |
| 83 | Ga0123353_10215561 | 3300010167 | Bacteria | 3007 |
| 84 | Ga0123353_11118096 | 3300010167 | Bacteria | 1044 |
| 85 | Ga0466713_006380 | 3300042602 | Bacteria | 123817 |
| 86 | Ga0466720_216669 | 3300042607 | Bacteria | 2646 |
| 87 | Ga0466731_230941 | 3300042622 | Bacteria | 2467 |
| 88 | Ga0466731_426232 | 3300042622 | Bacteria | 61123 |
| 89 | JGI24695J34938_10041366 | 3300002450 | Bacteria | 2069 |
| 90 | JGI24702J35022_10003970 | 3300002462 | Bacteria | 8876 |
| 91 | JGI24702J35022_10553483 | 3300002462 | Bacteria | 709 |
| 92 | JGI24705J35276_12176422 | 3300002504 | Unclassified | 1331 |
| 93 | JGI24696J40584_12959690 | 3300002834 | Bacteria | 5478 |
| 94 | Ga0466656_039841 | 3300042550 | Bacteria | 1705 |
| 95 | Ga0466694_139429 | 3300042594 | Bacteria | 8975 |
| 96 | Ga0466701_009591 | 3300042598 | Bacteria | 8503 |
| 97 | Ga0466732_378127 | 3300042656 | Bacteria | 2819 |
| 98 | Ga0466733_099345 | 3300042659 | Bacteria | 14611 |
| 99 | Ga0123353_10365981 | 3300010167 | Unclassified | 2164 |
| 100 | Ga0466717_200857 | 3300042604 | Bacteria | 1780 |
| 101 | JGI24702J35022_10001978 | 3300002462 | Bacteria | 12645 |
| 102 | JGI24702J35022_10119807 | 3300002462 | Bacteria | 1453 |
| 103 | JGI24705J35276_11976598 | 3300002504 | Unclassified | 821 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | iso_pr_bacteria | 2820783511 | 2820784010 | 159 |
| 2 | 3300010167 | Ga0123353_10192887 | Ga0123353_101928872 | 170 |
| 3 | 3300010882 | Ga0123354_10080446 | Ga0123354_100804465 | 170 |
| 4 | 3300042591 | Ga0466692_033158 | Ga0466692_033158_157_699 | 180 |
| 5 | 3300042656 | Ga0466732_378127 | Ga0466732_378127_145_705 | 180 |
| 6 | 3300010049 | Ga0123356_10399008 | Ga0123356_103990082 | 181 |
| 7 | 3300010049 | Ga0123356_10512107 | Ga0123356_105121072 | 181 |
| 8 | iso_pr_bacteria | 2878857142 | 2878858013 | 181 |
| 9 | 2225789004 | 2227080766 | 2227449401 | 182 |
| 10 | 3300038395 | Ga0415639_006949 | Ga0415639_006949_966_1535 | 182 |
| 11 | 3300042602 | Ga0466713_006380 | Ga0466713_006380_17103_17651 | 182 |
| 12 | 3300042648 | Ga0466709_351693 | Ga0466709_351693_134765_135313 | 182 |
| 13 | 3300056842 | Ga0562377_0767 | Ga0562377_0767_16860_17408 | 182 |
| 14 | 3300002932 | CVPL010L_1004452 | CVPL010L_10044522 | 183 |
| 15 | 3300003973 | Ga0063521_1001622 | Ga0063521_10016224 | 183 |
| 16 | 3300042603 | Ga0466714_115163 | Ga0466714_115163_1344_1895 | 183 |
| 17 | iso_pr_bacteria | 2820513949 | 2820516000 | 183 |
| 18 | 3300005200 | Ga0072940_1349139 | Ga0072940_13491393 | 184 |
| 19 | 3300042592 | Ga0466693_267583 | Ga0466693_267583_615_1172 | 185 |
| 20 | 3300042592 | Ga0466693_373460 | Ga0466693_373460_68_625 | 185 |
| 21 | 3300042582 | Ga0466657_186990 | Ga0466657_186990_2531_3091 | 186 |
| 22 | 3300042594 | Ga0466694_072609 | Ga0466694_072609_256_816 | 186 |
| 23 | 3300042594 | Ga0466694_089331 | Ga0466694_089331_123_683 | 186 |
| 24 | 3300042594 | Ga0466694_139429 | Ga0466694_139429_483_1043 | 186 |
| 25 | 3300042595 | Ga0466695_268109 | Ga0466695_268109_309_869 | 186 |
| 26 | 3300042604 | Ga0466717_155656 | Ga0466717_155656_2576_3136 | 186 |
| 27 | 3300042604 | Ga0466717_200857 | Ga0466717_200857_380_940 | 186 |
| 28 | 3300042607 | Ga0466720_216669 | Ga0466720_216669_1870_2430 | 186 |
| 29 | 3300042610 | Ga0466698_385525 | Ga0466698_385525_13_573 | 186 |
| 30 | 3300042611 | Ga0466697_083092 | Ga0466697_083092_589_1149 | 186 |
| 31 | 3300042611 | Ga0466697_270482 | Ga0466697_270482_517_1077 | 186 |
| 32 | 3300042613 | Ga0466710_062425 | Ga0466710_062425_888_1448 | 186 |
| 33 | 3300042613 | Ga0466710_072970 | Ga0466710_072970_1052_1612 | 186 |
| 34 | 3300042613 | Ga0466710_114795 | Ga0466710_114795_285_845 | 186 |
| 35 | 3300042613 | Ga0466710_211123 | Ga0466710_211123_189_749 | 186 |
| 36 | 3300042613 | Ga0466710_425159 | Ga0466710_425159_825_1385 | 186 |
| 37 | 3300042622 | Ga0466731_038103 | Ga0466731_038103_4903_5463 | 186 |
| 38 | 3300042622 | Ga0466731_230941 | Ga0466731_230941_1364_1924 | 186 |
| 39 | iso_pr_bacteria | 2820746860 | 2820747230 | 186 |
| 40 | iso_pr_bacteria | 2820753519 | 2820754110 | 186 |
| 41 | iso_pr_bacteria | 2820755292 | 2820755674 | 186 |
| 42 | iso_pr_bacteria | 2820792843 | 2820794128 | 186 |
| 43 | iso_pr_bacteria | 2820795054 | 2820796156 | 186 |
| 44 | 3300002462 | JGI24702J35022_10001978 | JGI24702J35022_1000197814 | 187 |
| 45 | 3300002462 | JGI24702J35022_10003970 | JGI24702J35022_100039704 | 187 |
| 46 | 3300002462 | JGI24702J35022_10119807 | JGI24702J35022_101198072 | 187 |
| 47 | 3300002462 | JGI24702J35022_10255558 | JGI24702J35022_102555582 | 187 |
| 48 | 3300002504 | JGI24705J35276_11976598 | JGI24705J35276_119765982 | 187 |
| 49 | 3300002504 | JGI24705J35276_12176422 | JGI24705J35276_121764222 | 187 |
| 50 | 3300002834 | JGI24696J40584_12860687 | JGI24696J40584_128606872 | 187 |
| 51 | 3300002834 | JGI24696J40584_12880254 | JGI24696J40584_128802542 | 187 |
| 52 | 3300002834 | JGI24696J40584_12960987 | JGI24696J40584_129609873 | 187 |
| 53 | 3300009826 | Ga0123355_10369246 | Ga0123355_103692463 | 187 |
| 54 | 3300010049 | Ga0123356_10053416 | Ga0123356_100534163 | 187 |
| 55 | 3300010049 | Ga0123356_10083420 | Ga0123356_100834203 | 187 |
| 56 | 3300010049 | Ga0123356_10329539 | Ga0123356_103295391 | 187 |
| 57 | 3300010167 | Ga0123353_10000528 | Ga0123353_1000052819 | 187 |
| 58 | 3300010167 | Ga0123353_10019125 | Ga0123353_100191259 | 187 |
| 59 | 3300010167 | Ga0123353_10083421 | Ga0123353_100834212 | 187 |
| 60 | 3300010167 | Ga0123353_10521214 | Ga0123353_105212142 | 187 |
| 61 | 3300010167 | Ga0123353_11118096 | Ga0123353_111180962 | 187 |
| 62 | 3300038395 | Ga0415639_088082 | Ga0415639_088082_310_873 | 187 |
| 63 | 3300042598 | Ga0466701_024946 | Ga0466701_024946_93_656 | 187 |
| 64 | 3300042601 | Ga0466707_187936 | Ga0466707_187936_1654_2217 | 187 |
| 65 | 3300042601 | Ga0466707_304110 | Ga0466707_304110_290_853 | 187 |
| 66 | 3300042611 | Ga0466697_076414 | Ga0466697_076414_4566_5129 | 187 |
| 67 | 3300042622 | Ga0466731_426232 | Ga0466731_426232_30117_30680 | 187 |
| 68 | 3300005083 | Ga0068305_10048238 | Ga0068305_100482382 | 188 |
| 69 | 3300009826 | Ga0123355_10007358 | Ga0123355_1000735814 | 188 |
| 70 | 3300009826 | Ga0123355_10173616 | Ga0123355_101736163 | 188 |
| 71 | 3300010167 | Ga0123353_10001064 | Ga0123353_1000106429 | 188 |
| 72 | 3300010167 | Ga0123353_10019273 | Ga0123353_1001927310 | 188 |
| 73 | 3300010167 | Ga0123353_11354286 | Ga0123353_113542862 | 188 |
| 74 | 3300042621 | Ga0466729_204790 | Ga0466729_204790_17988_18554 | 188 |
| 75 | 3300002450 | JGI24695J34938_10041366 | JGI24695J34938_100413663 | 189 |
| 76 | 3300002450 | JGI24695J34938_10117445 | JGI24695J34938_101174452 | 189 |
| 77 | 3300002450 | JGI24695J34938_10257938 | JGI24695J34938_102579381 | 189 |
| 78 | 3300002462 | JGI24702J35022_10553483 | JGI24702J35022_105534832 | 189 |
| 79 | 3300002834 | JGI24696J40584_12959690 | JGI24696J40584_129596902 | 189 |
| 80 | 3300042592 | Ga0466693_050325 | Ga0466693_050325_569_1138 | 189 |
| 81 | 3300042598 | Ga0466701_009591 | Ga0466701_009591_5451_6020 | 189 |
| 82 | 3300042611 | Ga0466697_141335 | Ga0466697_141335_1905_2474 | 189 |
| 83 | 3300042611 | Ga0466697_157355 | Ga0466697_157355_948_1517 | 189 |
| 84 | 3300042611 | Ga0466697_269208 | Ga0466697_269208_113_682 | 189 |
| 85 | iso_pr_bacteria | 2820788205 | 2820788835 | 189 |
| 86 | 3300009826 | Ga0123355_10000377 | Ga0123355_1000037722 | 190 |
| 87 | 3300009826 | Ga0123355_10006209 | Ga0123355_1000620910 | 190 |
| 88 | 3300010049 | Ga0123356_11910737 | Ga0123356_119107372 | 190 |
| 89 | 3300010167 | Ga0123353_10016075 | Ga0123353_1001607510 | 190 |
| 90 | 3300010167 | Ga0123353_10651684 | Ga0123353_106516842 | 190 |
| 91 | 3300042550 | Ga0466656_039841 | Ga0466656_039841_539_1111 | 190 |
| 92 | 3300042598 | Ga0466701_005833 | Ga0466701_005833_25334_25906 | 190 |
| 93 | 3300042611 | Ga0466697_051729 | Ga0466697_051729_807_1379 | 190 |
| 94 | 3300042659 | Ga0466733_099345 | Ga0466733_099345_9696_10268 | 190 |
| 95 | 3300056790 | Ga0562379_1431 | Ga0562379_1431_9567_10139 | 190 |
| 96 | 3300056856 | Ga0562375_0201 | Ga0562375_0201_72702_73274 | 190 |
| 97 | iso_pr_bacteria | 2740892556 | 2743947577 | 190 |
| 98 | iso_pr_bacteria | 2820785563 | 2820786810 | 190 |
| 99 | iso_pr_bacteria | 8077780672 | 8077782240 | 190 |
| 100 | 3300002932 | CVPL010L_1002372 | CVPL010L_10023722 | 191 |
| 101 | 3300009826 | Ga0123355_10008958 | Ga0123355_1000895816 | 191 |
| 102 | 3300042592 | Ga0466693_113594 | Ga0466693_113594_299_874 | 191 |
| 103 | 3300009826 | Ga0123355_10189341 | Ga0123355_101893412 | 192 |
| 104 | 3300042601 | Ga0466707_102059 | Ga0466707_102059_27123_27701 | 192 |
| 105 | iso_pr_bacteria | 8038268975 | 8038270269 | 192 |
| 106 | 3300042612 | Ga0466705_360594 | Ga0466705_360594_2050_2631 | 193 |
| 107 | 3300042636 | Ga0466703_393151 | Ga0466703_393151_1064_1645 | 193 |
| 108 | 3300042643 | Ga0466704_119946 | Ga0466704_119946_17352_17933 | 193 |
| 109 | iso_pr_bacteria | 2820785563 | 2820785702 | 193 |
| 110 | 3300009826 | Ga0123355_10000052 | Ga0123355_1000005253 | 194 |
| 111 | 3300010167 | Ga0123353_10251007 | Ga0123353_102510072 | 194 |
| 112 | iso_pr_bacteria | 2881902429 | 2881903244 | 194 |
| 113 | iso_pr_bacteria | 2905310146 | 2905311245 | 195 |
| 114 | 3300010167 | Ga0123353_10001427 | Ga0123353_1000142723 | 196 |
| 115 | iso_pr_bacteria | 2825804107 | 2825806240 | 196 |
| 116 | 3300010167 | Ga0123353_10276019 | Ga0123353_102760192 | 198 |
| 117 | 3300010167 | Ga0123353_10365981 | Ga0123353_103659812 | 201 |
| 118 | 3300012848 | Ga0160443_101164 | Ga0160443_1011642 | 202 |
| 119 | iso_pr_bacteria | 2881375749 | 2881378132 | 202 |
| 120 | iso_pr_bacteria | 2595698190 | 2596206250 | 206 |
| 121 | iso_pr_bacteria | 2595698193 | 2596211661 | 206 |
| 122 | iso_pr_bacteria | 2595698194 | 2596213383 | 206 |
| 123 | iso_pr_bacteria | 2595698195 | 2596215430 | 206 |
| 124 | iso_pr_bacteria | 2595698196 | 2596217163 | 206 |
| 125 | iso_pr_bacteria | 2595698197 | 2596219000 | 206 |
| 126 | iso_pr_bacteria | 2595698198 | 2596220832 | 206 |
| 127 | iso_pr_bacteria | 2595698199 | 2596222636 | 206 |
| 128 | iso_pr_bacteria | 2627853628 | 2628280963 | 206 |
| 129 | iso_pr_bacteria | 650716050 | 650845567 | 206 |
| 130 | 3300005083 | Ga0068305_10026415 | Ga0068305_100264152 | 215 |
| 131 | 3300010167 | Ga0123353_10215561 | Ga0123353_102155613 | 223 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00551 | Formyl_trans_N | Formyl transferase | 36 | 214 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00551 | GO:0009058 | biosynthetic process | BP |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.84 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.