Protein Family IF03182
Metagenome
Isolate
159
Members
67
Samples
142
Scaffolds
300.47
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10184685|Ga0123353_101846857
- Length
- 347 aa
- Sequence
- MQLGFIGLMLISVILPHGRKFSTFQTETVKPFFYLYLTLFSDIIPSMNQEQYLKPEVIQTIKRLDLRAQFIVKGFMSGLHSSPLHGFSVEFSEHRKYTQGDDPNDIDWLVFAKTEKYYIRKYEAETSMNGYLVVDSSRSMGYTQRQTMTKFDYAICLSAALAYLMIHQQDPVGLFTFNEKVQRSIAPSSKRAQLGTLLSVLSNLRPDGQTNIAGSLKQLAAMLKRQSIVMIFSDLLAENIESIGEIMSGLHTLRHRGHDIIVFHILDEAEVKFPFHGAVELFDPESEERIRGNAEMLKRNYLEALEEYRAGFRRECSRSKIDYVELDTGMQFDKALAEYLTRRIGR*
Sample Types
Isolate
10.7%
Metagenome
89.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.4%
Unclassified
27.3%
Kalotermitidae
21.2%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
1.5%
Armadillidiidae
1.5%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
40
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820171952 | Unclassified Planctomycetes Th196P3bin88 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 4 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 7 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 8 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 9 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 12 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2820185449 | Unclassified Planctomycetes Lab288P3bin146 | Isolate | Unclassified |
| 15 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 16 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 17 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 29 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 30 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 31 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 32 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 33 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 34 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 41 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 44 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 45 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2820180635 | Unclassified Planctomycetes Lab288P3bin24 | Isolate | Unclassified |
| 48 | 2820189034 | Unclassified Planctomycetes Emb289P4bin17 | Isolate | Unclassified |
| 49 | 2820196379 | Unclassified Planctomycetes Emb289P3bin158 | Isolate | Unclassified |
| 50 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 51 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 52 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 53 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 54 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 55 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 56 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 57 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 58 | 2820193510 | Unclassified Planctomycetes Emb289P3bin83 | Isolate | Unclassified |
| 59 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
| 60 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 61 | 2820183396 | Unclassified Planctomycetes Lab288P3bin214 | Isolate | Unclassified |
| 62 | 2820201435 | Unclassified Planctomycetes Cu122P5bin25 | Isolate | Unclassified |
| 63 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 64 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 65 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 66 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 67 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466718_063025 | 3300042617 | Bacteria | 5473 |
| 2 | Ga0466693_304703 | 3300042592 | Unclassified | 1321 |
| 3 | Ga0466694_083520 | 3300042594 | Bacteria | 1240 |
| 4 | Ga0466695_369763 | 3300042595 | Bacteria | 1123 |
| 5 | Ga0123353_10000528 | 3300010167 | Bacteria | 47327 |
| 6 | Ga0123353_10001057 | 3300010167 | Unclassified | 33733 |
| 7 | Ga0123353_10002470 | 3300010167 | Bacteria | 22996 |
| 8 | Ga0123353_10004073 | 3300010167 | Bacteria | 18729 |
| 9 | Ga0123353_10034021 | 3300010167 | Unclassified | 7946 |
| 10 | Ga0123353_10184685 | 3300010167 | Bacteria | 3298 |
| 11 | Ga0123353_10236783 | 3300010167 | Bacteria | 2841 |
| 12 | Ga0123353_10592249 | 3300010167 | Bacteria | 1588 |
| 13 | Ga0466729_246935 | 3300042621 | Bacteria | 1495 |
| 14 | Ga0466731_207164 | 3300042622 | Bacteria | 4322 |
| 15 | Ga0466704_218931 | 3300042643 | Unclassified | 4129 |
| 16 | Ga0466704_257909 | 3300042643 | Bacteria | 2104 |
| 17 | Ga0072941_1212893 | 3300005201 | Bacteria | 3545 |
| 18 | Ga0466690_154679 | 3300042590 | Unclassified | 13586 |
| 19 | Ga0466691_175677 | 3300042593 | Bacteria | 4665 |
| 20 | Ga0466695_288896 | 3300042595 | Bacteria | 1096 |
| 21 | Ga0123356_10002537 | 3300010049 | Unclassified | 19524 |
| 22 | Ga0123356_10006301 | 3300010049 | Bacteria | 11983 |
| 23 | Ga0123356_10014060 | 3300010049 | Bacteria | 7698 |
| 24 | Ga0123353_10001063 | 3300010167 | Bacteria | 33586 |
| 25 | Ga0123353_10001578 | 3300010167 | Bacteria | 28002 |
| 26 | Ga0123353_10195484 | 3300010167 | Bacteria | 3189 |
| 27 | Ga0466703_079306 | 3300042636 | Unclassified | 3287 |
| 28 | Ga0466703_265048 | 3300042636 | Bacteria | 5345 |
| 29 | Ga0466704_537011 | 3300042643 | Bacteria | 42748 |
| 30 | Ga0466724_60958 | 3300042649 | Bacteria | 1202 |
| 31 | Ga0466727_018499 | 3300042655 | Bacteria | 8092 |
| 32 | Ga0466707_176162 | 3300042601 | Bacteria | 62223 |
| 33 | JGI24702J35022_10003986 | 3300002462 | Bacteria | 8860 |
| 34 | Ga0466710_366882 | 3300042613 | Bacteria | 1022 |
| 35 | Ga0466728_217653 | 3300042620 | Bacteria | 6503 |
| 36 | Ga0160467_100009 | 3300012829 | Bacteria | 588364 |
| 37 | Ga0466657_074138 | 3300042582 | Bacteria | 2970 |
| 38 | Ga0466696_016976 | 3300042596 | Bacteria | 5434 |
| 39 | Ga0123355_10654167 | 3300009826 | Bacteria | 1225 |
| 40 | Ga0123353_10001225 | 3300010167 | Bacteria | 31431 |
| 41 | Ga0123353_10079432 | 3300010167 | Bacteria | 5274 |
| 42 | Ga0123353_10489865 | 3300010167 | Unclassified | 1795 |
| 43 | Ga0466731_011688 | 3300042622 | Unclassified | 4076 |
| 44 | Ga0466731_208258 | 3300042622 | Bacteria | 1366 |
| 45 | Ga0466704_283676 | 3300042643 | Bacteria | 21721 |
| 46 | Ga0466708_064170 | 3300042652 | Bacteria | 4007 |
| 47 | Ga0466701_086038 | 3300042598 | Bacteria | 7637 |
| 48 | Ga0466700_187945 | 3300042600 | Unclassified | 4691 |
| 49 | Ga0466716_095353 | 3300042605 | Bacteria | 11533 |
| 50 | Ga0466697_011700 | 3300042611 | Unclassified | 2053 |
| 51 | IMNBGM34_c001898 | 3300000036 | Bacteria | 3252 |
| 52 | Ga0068305_10051920 | 3300005083 | Bacteria | 15549 |
| 53 | Ga0072941_1141717 | 3300005201 | Bacteria | 2699 |
| 54 | Ga0466711_163842 | 3300042615 | Unclassified | 25990 |
| 55 | Ga0466729_180837 | 3300042621 | Unclassified | 1812 |
| 56 | Ga0466729_194014 | 3300042621 | Bacteria | 10436 |
| 57 | Ga0466695_082464 | 3300042595 | Unclassified | 1580 |
| 58 | Ga0466696_296990 | 3300042596 | Bacteria | 8818 |
| 59 | Ga0123356_10860573 | 3300010049 | Bacteria | 1078 |
| 60 | Ga0123353_10003465 | 3300010167 | Bacteria | 19949 |
| 61 | Ga0123353_10986154 | 3300010167 | Bacteria | 1134 |
| 62 | Ga0466729_251294 | 3300042621 | Unclassified | 2479 |
| 63 | Ga0466734_116116 | 3300042623 | Bacteria | 1365 |
| 64 | Ga0466704_252756 | 3300042643 | Bacteria | 30859 |
| 65 | Ga0466701_028616 | 3300042598 | Unclassified | 6067 |
| 66 | Ga0466707_022499 | 3300042601 | Bacteria | 2356 |
| 67 | Ga0466717_096370 | 3300042604 | Bacteria | 1052 |
| 68 | Ga0466698_461719 | 3300042610 | Unclassified | 1007 |
| 69 | Ga0466697_065032 | 3300042611 | Unclassified | 2583 |
| 70 | Ga0466705_284043 | 3300042612 | Unclassified | 7450 |
| 71 | Ga0466710_102558 | 3300042613 | Unclassified | 3095 |
| 72 | Ga0466710_299649 | 3300042613 | Bacteria | 1368 |
| 73 | Ga0466712_085821 | 3300042614 | Bacteria | 1945 |
| 74 | Ga0466715_040454 | 3300042616 | Bacteria | 1793 |
| 75 | Ga0466718_113583 | 3300042617 | Bacteria | 5259 |
| 76 | Ga0466723_130567 | 3300042618 | Bacteria | 18107 |
| 77 | Ga0466726_239056 | 3300042619 | Bacteria | 21787 |
| 78 | Ga0466693_402616 | 3300042592 | Bacteria | 3153 |
| 79 | Ga0466699_120795 | 3300042597 | Bacteria | 2047 |
| 80 | Ga0123356_10218801 | 3300010049 | Unclassified | 1959 |
| 81 | Ga0123353_10037508 | 3300010167 | Bacteria | 7604 |
| 82 | Ga0123353_10117500 | 3300010167 | Bacteria | 4278 |
| 83 | Ga0466735_138616 | 3300042624 | Bacteria | 7928 |
| 84 | Ga0466708_235373 | 3300042652 | Bacteria | 9618 |
| 85 | Ga0466727_305031 | 3300042655 | Bacteria | 1380 |
| 86 | Ga0466716_139312 | 3300042605 | Unclassified | 1632 |
| 87 | Ga0466719_208254 | 3300042606 | Bacteria | 2667 |
| 88 | Ga0466705_003155 | 3300042612 | Bacteria | 3271 |
| 89 | Ga0466710_140531 | 3300042613 | Bacteria | 1488 |
| 90 | Ga0466715_521773 | 3300042616 | Bacteria | 2151 |
| 91 | Ga0466693_393304 | 3300042592 | Bacteria | 1615 |
| 92 | Ga0466695_402121 | 3300042595 | Unclassified | 6556 |
| 93 | Ga0123353_10145407 | 3300010167 | Unclassified | 3791 |
| 94 | Ga0466731_358898 | 3300042622 | Bacteria | 87251 |
| 95 | Ga0466734_103919 | 3300042623 | Bacteria | 1486 |
| 96 | Ga0466703_138222 | 3300042636 | Bacteria | 19596 |
| 97 | Ga0466701_031675 | 3300042598 | Bacteria | 3096 |
| 98 | Ga0466714_024764 | 3300042603 | Bacteria | 1612 |
| 99 | Ga0466717_134686 | 3300042604 | Bacteria | 3054 |
| 100 | JGI24702J35022_10006098 | 3300002462 | Bacteria | 6999 |
| 101 | Ga0466732_430226 | 3300042656 | Bacteria | 3089 |
| 102 | Ga0466710_091408 | 3300042613 | Bacteria | 1178 |
| 103 | Ga0466710_161364 | 3300042613 | Unclassified | 1628 |
| 104 | Ga0466711_010350 | 3300042615 | Unclassified | 1855 |
| 105 | Ga0466723_030796 | 3300042618 | Unclassified | 10342 |
| 106 | Ga0466693_060268 | 3300042592 | Unclassified | 1906 |
| 107 | Ga0466696_119935 | 3300042596 | Unclassified | 11438 |
| 108 | Ga0123353_10000126 | 3300010167 | Bacteria | 92081 |
| 109 | Ga0123353_10057017 | 3300010167 | Bacteria | 6255 |
| 110 | Ga0466729_255106 | 3300042621 | Bacteria | 3648 |
| 111 | Ga0466703_314379 | 3300042636 | Unclassified | 4977 |
| 112 | Ga0466716_086810 | 3300042605 | Bacteria | 5331 |
| 113 | Ga0466719_129152 | 3300042606 | Unclassified | 12772 |
| 114 | Ga0466698_009373 | 3300042610 | Bacteria | 3026 |
| 115 | Ga0466698_362972 | 3300042610 | Unclassified | 4271 |
| 116 | JGI24695J34938_10048937 | 3300002450 | Unclassified | 1860 |
| 117 | JGI24705J35276_12207046 | 3300002504 | Unclassified | 1735 |
| 118 | Ga0466711_287569 | 3300042615 | Bacteria | 2872 |
| 119 | Ga0466715_279907 | 3300042616 | Bacteria | 14280 |
| 120 | Ga0456237_0014230 | 3300041968 | Bacteria | 1134 |
| 121 | Ga0466692_112129 | 3300042591 | Bacteria | 106802 |
| 122 | Ga0466694_030584 | 3300042594 | Bacteria | 71743 |
| 123 | Ga0466695_123578 | 3300042595 | Bacteria | 2371 |
| 124 | Ga0123357_10079719 | 3300009784 | Bacteria | 4310 |
| 125 | Ga0123356_10038250 | 3300010049 | Unclassified | 4471 |
| 126 | Ga0123356_10460329 | 3300010049 | Bacteria | 1422 |
| 127 | Ga0123353_10008101 | 3300010167 | Bacteria | 14307 |
| 128 | Ga0123353_10336283 | 3300010167 | Unclassified | 2283 |
| 129 | Ga0123353_10409777 | 3300010167 | Unclassified | 2013 |
| 130 | Ga0123354_10169257 | 3300010882 | Bacteria | 2552 |
| 131 | Ga0466729_246071 | 3300042621 | Bacteria | 1373 |
| 132 | Ga0466734_170059 | 3300042623 | Bacteria | 1632 |
| 133 | Ga0466735_043500 | 3300042624 | Bacteria | 3166 |
| 134 | Ga0466703_353309 | 3300042636 | Bacteria | 5292 |
| 135 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 136 | Ga0466724_66829 | 3300042649 | Unclassified | 11500 |
| 137 | Ga0466727_216682 | 3300042655 | Unclassified | 1358 |
| 138 | Ga0466707_243479 | 3300042601 | Unclassified | 4369 |
| 139 | Ga0466717_208458 | 3300042604 | Bacteria | 1157 |
| 140 | Ga0466717_267232 | 3300042604 | Bacteria | 1468 |
| 141 | JGI24702J35022_10002643 | 3300002462 | Bacteria | 10873 |
| 142 | JGI24702J35022_10022303 | 3300002462 | Bacteria | 3428 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002462 | JGI24702J35022_10003986 | JGI24702J35022_100039865 | 269 |
| 2 | 3300042623 | Ga0466734_170059 | Ga0466734_170059_236_1126 | 271 |
| 3 | 3300042613 | Ga0466710_102558 | Ga0466710_102558_533_1354 | 273 |
| 4 | 3300010049 | Ga0123356_10006301 | Ga0123356_100063018 | 274 |
| 5 | 3300042614 | Ga0466712_085821 | Ga0466712_085821_26_919 | 276 |
| 6 | 3300042604 | Ga0466717_267232 | Ga0466717_267232_483_1382 | 278 |
| 7 | 3300042616 | Ga0466715_521773 | Ga0466715_521773_1026_1919 | 278 |
| 8 | 3300042597 | Ga0466699_120795 | Ga0466699_120795_856_1755 | 279 |
| 9 | 3300010167 | Ga0123353_10592249 | Ga0123353_105922491 | 280 |
| 10 | 3300042613 | Ga0466710_140531 | Ga0466710_140531_41_922 | 280 |
| 11 | 3300010167 | Ga0123353_10986154 | Ga0123353_109861541 | 281 |
| 12 | 3300042601 | Ga0466707_243479 | Ga0466707_243479_484_1395 | 283 |
| 13 | 3300042611 | Ga0466697_011700 | Ga0466697_011700_206_1135 | 284 |
| 14 | 3300042601 | Ga0466707_176162 | Ga0466707_176162_17130_18023 | 286 |
| 15 | 3300009826 | Ga0123355_10654167 | Ga0123355_106541671 | 288 |
| 16 | 3300010167 | Ga0123353_10336283 | Ga0123353_103362831 | 289 |
| 17 | 3300042652 | Ga0466708_064170 | Ga0466708_064170_3048_3941 | 292 |
| 18 | 3300042621 | Ga0466729_255106 | Ga0466729_255106_2470_3381 | 293 |
| 19 | 3300042615 | Ga0466711_163842 | Ga0466711_163842_8886_9776 | 296 |
| 20 | 3300042621 | Ga0466729_180837 | Ga0466729_180837_528_1418 | 296 |
| 21 | iso_pr_bacteria | 2820196379 | 2820196497 | 296 |
| 22 | iso_pr_bacteria | 2820201435 | 2820202176 | 296 |
| 23 | 3300010049 | Ga0123356_10860573 | Ga0123356_108605731 | 297 |
| 24 | 3300010167 | Ga0123353_10008101 | Ga0123353_1000810112 | 297 |
| 25 | 3300010167 | Ga0123353_10037508 | Ga0123353_100375083 | 297 |
| 26 | 3300010167 | Ga0123353_10079432 | Ga0123353_100794326 | 297 |
| 27 | 3300010167 | Ga0123353_10489865 | Ga0123353_104898652 | 297 |
| 28 | 3300041968 | Ga0456237_0014230 | Ga0456237_0014230_88_981 | 297 |
| 29 | 3300042592 | Ga0466693_304703 | Ga0466693_304703_241_1134 | 297 |
| 30 | 3300042595 | Ga0466695_082464 | Ga0466695_082464_456_1349 | 297 |
| 31 | 3300042595 | Ga0466695_288896 | Ga0466695_288896_98_991 | 297 |
| 32 | 3300042595 | Ga0466695_369763 | Ga0466695_369763_115_1008 | 297 |
| 33 | 3300042595 | Ga0466695_402121 | Ga0466695_402121_2300_3193 | 297 |
| 34 | 3300042596 | Ga0466696_016976 | Ga0466696_016976_1459_2352 | 297 |
| 35 | 3300042596 | Ga0466696_296990 | Ga0466696_296990_7514_8407 | 297 |
| 36 | 3300042598 | Ga0466701_031675 | Ga0466701_031675_2171_3064 | 297 |
| 37 | 3300042600 | Ga0466700_187945 | Ga0466700_187945_1541_2434 | 297 |
| 38 | 3300042601 | Ga0466707_022499 | Ga0466707_022499_1214_2107 | 297 |
| 39 | 3300042604 | Ga0466717_096370 | Ga0466717_096370_97_990 | 297 |
| 40 | 3300042604 | Ga0466717_208458 | Ga0466717_208458_118_1011 | 297 |
| 41 | 3300042605 | Ga0466716_086810 | Ga0466716_086810_3655_4548 | 297 |
| 42 | 3300042605 | Ga0466716_139312 | Ga0466716_139312_637_1530 | 297 |
| 43 | 3300042606 | Ga0466719_208254 | Ga0466719_208254_1697_2590 | 297 |
| 44 | 3300042610 | Ga0466698_461719 | Ga0466698_461719_75_968 | 297 |
| 45 | 3300042612 | Ga0466705_003155 | Ga0466705_003155_1078_1971 | 297 |
| 46 | 3300042615 | Ga0466711_010350 | Ga0466711_010350_663_1556 | 297 |
| 47 | 3300042615 | Ga0466711_287569 | Ga0466711_287569_1296_2189 | 297 |
| 48 | 3300042617 | Ga0466718_113583 | Ga0466718_113583_943_1836 | 297 |
| 49 | 3300042618 | Ga0466723_030796 | Ga0466723_030796_8824_9717 | 297 |
| 50 | 3300042618 | Ga0466723_130567 | Ga0466723_130567_14622_15515 | 297 |
| 51 | 3300042619 | Ga0466726_239056 | Ga0466726_239056_14569_15462 | 297 |
| 52 | 3300042621 | Ga0466729_194014 | Ga0466729_194014_9477_10370 | 297 |
| 53 | 3300042621 | Ga0466729_246071 | Ga0466729_246071_422_1315 | 297 |
| 54 | 3300042621 | Ga0466729_251294 | Ga0466729_251294_1460_2353 | 297 |
| 55 | 3300042623 | Ga0466734_103919 | Ga0466734_103919_518_1411 | 297 |
| 56 | 3300042636 | Ga0466703_079306 | Ga0466703_079306_2100_2993 | 297 |
| 57 | 3300042643 | Ga0466704_218931 | Ga0466704_218931_199_1092 | 297 |
| 58 | 3300042643 | Ga0466704_252756 | Ga0466704_252756_13105_13998 | 297 |
| 59 | 3300042655 | Ga0466727_216682 | Ga0466727_216682_244_1137 | 297 |
| 60 | 3300042655 | Ga0466727_305031 | Ga0466727_305031_168_1061 | 297 |
| 61 | iso_pr_bacteria | 2820178484 | 2820179207 | 297 |
| 62 | iso_pr_bacteria | 2820180635 | 2820182317 | 297 |
| 63 | iso_pr_bacteria | 2820205024 | 2820206646 | 297 |
| 64 | iso_pr_bacteria | 2820205024 | 2820206656 | 297 |
| 65 | 3300002450 | JGI24695J34938_10048937 | JGI24695J34938_100489372 | 298 |
| 66 | 3300002462 | JGI24702J35022_10022303 | JGI24702J35022_100223031 | 298 |
| 67 | 3300005201 | Ga0072941_1141717 | Ga0072941_11417171 | 298 |
| 68 | 3300005201 | Ga0072941_1212893 | Ga0072941_12128932 | 298 |
| 69 | 3300010049 | Ga0123356_10038250 | Ga0123356_100382502 | 298 |
| 70 | 3300010167 | Ga0123353_10001057 | Ga0123353_100010573 | 298 |
| 71 | 3300010167 | Ga0123353_10001578 | Ga0123353_1000157814 | 298 |
| 72 | 3300010167 | Ga0123353_10004073 | Ga0123353_100040735 | 298 |
| 73 | 3300010167 | Ga0123353_10034021 | Ga0123353_100340215 | 298 |
| 74 | 3300010167 | Ga0123353_10057017 | Ga0123353_100570173 | 298 |
| 75 | 3300010167 | Ga0123353_10409777 | Ga0123353_104097772 | 298 |
| 76 | 3300042590 | Ga0466690_154679 | Ga0466690_154679_12474_13370 | 298 |
| 77 | 3300042592 | Ga0466693_393304 | Ga0466693_393304_53_949 | 298 |
| 78 | 3300042593 | Ga0466691_175677 | Ga0466691_175677_3553_4449 | 298 |
| 79 | 3300042605 | Ga0466716_095353 | Ga0466716_095353_548_1444 | 298 |
| 80 | 3300042612 | Ga0466705_284043 | Ga0466705_284043_1687_2583 | 298 |
| 81 | 3300042613 | Ga0466710_299649 | Ga0466710_299649_288_1184 | 298 |
| 82 | 3300042616 | Ga0466715_279907 | Ga0466715_279907_4820_5716 | 298 |
| 83 | 3300042617 | Ga0466718_063025 | Ga0466718_063025_2287_3183 | 298 |
| 84 | 3300042620 | Ga0466728_217653 | Ga0466728_217653_2121_3017 | 298 |
| 85 | 3300042621 | Ga0466729_246935 | Ga0466729_246935_374_1270 | 298 |
| 86 | 3300042636 | Ga0466703_138222 | Ga0466703_138222_6498_7394 | 298 |
| 87 | 3300042643 | Ga0466704_257909 | Ga0466704_257909_305_1201 | 298 |
| 88 | 3300042652 | Ga0466708_235373 | Ga0466708_235373_5913_6809 | 298 |
| 89 | iso_pr_bacteria | 2820219087 | 2820219981 | 298 |
| 90 | iso_pr_bacteria | 2820183396 | 2820183969 | 299 |
| 91 | iso_pr_bacteria | 2820189034 | 2820193276 | 299 |
| 92 | iso_pr_bacteria | 2820193510 | 2820194057 | 299 |
| 93 | 3300010049 | Ga0123356_10014060 | Ga0123356_100140602 | 300 |
| 94 | 3300010167 | Ga0123353_10000126 | Ga0123353_1000012657 | 300 |
| 95 | 3300010167 | Ga0123353_10001063 | Ga0123353_1000106318 | 300 |
| 96 | 3300010167 | Ga0123353_10002470 | Ga0123353_100024709 | 300 |
| 97 | 3300010167 | Ga0123353_10236783 | Ga0123353_102367832 | 300 |
| 98 | 3300042594 | Ga0466694_083520 | Ga0466694_083520_198_1130 | 300 |
| 99 | 3300042624 | Ga0466735_043500 | Ga0466735_043500_927_1862 | 300 |
| 100 | 3300000036 | IMNBGM34_c001898 | IMNBGM34_0018983 | 301 |
| 101 | 3300012829 | Ga0160467_100009 | Ga0160467_100009112 | 301 |
| 102 | 3300042604 | Ga0466717_134686 | Ga0466717_134686_42_947 | 301 |
| 103 | 3300042595 | Ga0466695_123578 | Ga0466695_123578_60_971 | 303 |
| 104 | 3300042622 | Ga0466731_208258 | Ga0466731_208258_89_1000 | 303 |
| 105 | 3300042636 | Ga0466703_353309 | Ga0466703_353309_3757_4692 | 303 |
| 106 | 3300042643 | Ga0466704_537011 | Ga0466704_537011_169_1104 | 303 |
| 107 | 3300042655 | Ga0466727_018499 | Ga0466727_018499_2926_3837 | 303 |
| 108 | 3300042596 | Ga0466696_119935 | Ga0466696_119935_4082_4996 | 304 |
| 109 | 3300009784 | Ga0123357_10079719 | Ga0123357_100797193 | 306 |
| 110 | 3300042643 | Ga0466704_283676 | Ga0466704_283676_14908_15828 | 306 |
| 111 | 3300042606 | Ga0466719_129152 | Ga0466719_129152_10011_10937 | 308 |
| 112 | 3300042636 | Ga0466703_314379 | Ga0466703_314379_2931_3857 | 308 |
| 113 | 3300042648 | Ga0466709_221860 | Ga0466709_221860_96254_97180 | 308 |
| 114 | 3300002462 | JGI24702J35022_10006098 | JGI24702J35022_100060985 | 309 |
| 115 | 3300010167 | Ga0123353_10001225 | Ga0123353_1000122525 | 309 |
| 116 | 3300010882 | Ga0123354_10169257 | Ga0123354_101692573 | 309 |
| 117 | 3300042582 | Ga0466657_074138 | Ga0466657_074138_1805_2734 | 309 |
| 118 | 3300042591 | Ga0466692_112129 | Ga0466692_112129_92691_93620 | 309 |
| 119 | 3300042592 | Ga0466693_060268 | Ga0466693_060268_134_1063 | 309 |
| 120 | 3300042592 | Ga0466693_402616 | Ga0466693_402616_983_1912 | 309 |
| 121 | 3300042594 | Ga0466694_030584 | Ga0466694_030584_40033_40962 | 309 |
| 122 | 3300042598 | Ga0466701_028616 | Ga0466701_028616_753_1682 | 309 |
| 123 | 3300042610 | Ga0466698_362972 | Ga0466698_362972_1479_2408 | 309 |
| 124 | 3300042611 | Ga0466697_065032 | Ga0466697_065032_471_1400 | 309 |
| 125 | 3300042613 | Ga0466710_091408 | Ga0466710_091408_23_952 | 309 |
| 126 | 3300042613 | Ga0466710_161364 | Ga0466710_161364_207_1136 | 309 |
| 127 | 3300042613 | Ga0466710_366882 | Ga0466710_366882_69_998 | 309 |
| 128 | 3300042616 | Ga0466715_040454 | Ga0466715_040454_10_939 | 309 |
| 129 | 3300042622 | Ga0466731_011688 | Ga0466731_011688_1477_2406 | 309 |
| 130 | 3300042622 | Ga0466731_207164 | Ga0466731_207164_1284_2213 | 309 |
| 131 | 3300042622 | Ga0466731_358898 | Ga0466731_358898_36373_37302 | 309 |
| 132 | 3300042623 | Ga0466734_116116 | Ga0466734_116116_108_1037 | 309 |
| 133 | 3300042649 | Ga0466724_60958 | Ga0466724_60958_30_959 | 309 |
| 134 | 3300042649 | Ga0466724_66829 | Ga0466724_66829_5954_6883 | 309 |
| 135 | 3300042656 | Ga0466732_430226 | Ga0466732_430226_1380_2309 | 309 |
| 136 | iso_pr_bacteria | 2820753519 | 2820754646 | 309 |
| 137 | iso_pr_bacteria | 2820755292 | 2820756838 | 309 |
| 138 | iso_pr_bacteria | 2820792843 | 2820794374 | 309 |
| 139 | iso_pr_bacteria | 2820795054 | 2820795490 | 309 |
| 140 | 3300002462 | JGI24702J35022_10002643 | JGI24702J35022_100026437 | 310 |
| 141 | 3300002504 | JGI24705J35276_12207046 | JGI24705J35276_122070462 | 310 |
| 142 | 3300010049 | Ga0123356_10002537 | Ga0123356_100025374 | 310 |
| 143 | 3300010167 | Ga0123353_10000528 | Ga0123353_1000052829 | 310 |
| 144 | 3300010167 | Ga0123353_10003465 | Ga0123353_100034654 | 310 |
| 145 | 3300042598 | Ga0466701_086038 | Ga0466701_086038_6190_7122 | 310 |
| 146 | iso_pr_bacteria | 2820215626 | 2820215657 | 310 |
| 147 | 3300005083 | Ga0068305_10051920 | Ga0068305_1005192012 | 311 |
| 148 | 3300010049 | Ga0123356_10218801 | Ga0123356_102188012 | 311 |
| 149 | 3300042603 | Ga0466714_024764 | Ga0466714_024764_307_1242 | 311 |
| 150 | 3300042624 | Ga0466735_138616 | Ga0466735_138616_4133_5071 | 312 |
| 151 | 3300042610 | Ga0466698_009373 | Ga0466698_009373_121_1068 | 315 |
| 152 | 3300010167 | Ga0123353_10145407 | Ga0123353_101454072 | 316 |
| 153 | iso_pr_bacteria | 2820171952 | 2820172509 | 316 |
| 154 | iso_pr_bacteria | 2820185449 | 2820188774 | 318 |
| 155 | 3300042636 | Ga0466703_265048 | Ga0466703_265048_3533_4495 | 320 |
| 156 | 3300010167 | Ga0123353_10117500 | Ga0123353_101175002 | 321 |
| 157 | 3300010049 | Ga0123356_10460329 | Ga0123356_104603292 | 325 |
| 158 | 3300010167 | Ga0123353_10195484 | Ga0123353_101954845 | 330 |
| 159 | 3300010167 | Ga0123353_10184685 | Ga0123353_101846857 | 347 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.73 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.