Protein Family IF03181
Metagenome
Isolate
113
Members
37
Samples
99
Scaffolds
284.4
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10178887|Ga0123353_101788872
- Length
- 310 aa
- Sequence
- MTSEADRIPGNVSYKSIIRQGEISGALFNWKKMKKKDIPGIEDLLFSIEENYVSACGRFLARNDSKDIIWLLRNKNDICSLIINSRSTVIPVLAAKTPLLYSRNELINQLIRLKSFFKTKNIHSVQGLKEEVIIMEEAINHAGKKPVDTIDYDLMSLDKLPVSYTKFPNLVLKIPQLTDIDAIAPLQAAYEQEEVIPKGSVFSPAASRANISNIIANGRILAAQLDGRMIGKINVSAVSFTRYLVGGVYVHRDFRGLGIARRMASEFIASLINEGKAITLFVKKNNIAARRLYAGLGFTANADYRIIYY*
Sample Types
Isolate
12.4%
Metagenome
87.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
54.3%
Unclassified
40.0%
Rhinotermitidae
5.7%
Taxonomy
Archaea
2
Bacteria
108
Eukaryota
0
Viruses
1
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 5 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 6 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 7 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 8 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 11 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 16 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 17 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 21 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 24 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 25 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 26 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 27 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 33 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 34 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 35 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 36 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 37 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10084932 | 3300002449 | Bacteria | 1472 |
| 2 | JGI24695J34938_10000117 | 3300002450 | Bacteria | 71696 |
| 3 | Ga0072941_1006464 | 3300005201 | Bacteria | 5643 |
| 4 | Ga0466694_029811 | 3300042594 | Bacteria | 1315 |
| 5 | Ga0466699_070397 | 3300042597 | Bacteria | 6914 |
| 6 | Ga0466699_359082 | 3300042597 | Bacteria | 2233 |
| 7 | Ga0466712_095977 | 3300042614 | Bacteria | 1867 |
| 8 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 9 | JGI24695J34938_10000183 | 3300002450 | Bacteria | 58582 |
| 10 | JGI24695J34938_10025588 | 3300002450 | Bacteria | 2819 |
| 11 | Ga0072940_1020248 | 3300005200 | Bacteria | 3777 |
| 12 | Ga0123356_10000679 | 3300010049 | Bacteria | 37707 |
| 13 | Ga0123356_10000784 | 3300010049 | Bacteria | 35203 |
| 14 | Ga0466700_195698 | 3300042600 | Bacteria | 10787 |
| 15 | Ga0415639_002275 | 3300038395 | Unclassified | 9245 |
| 16 | Ga0415639_128714 | 3300038395 | Bacteria | 5111 |
| 17 | Ga0415639_210105 | 3300038395 | Bacteria | 2557 |
| 18 | Ga0466694_296354 | 3300042594 | Archaea | 3501 |
| 19 | Ga0466712_130080 | 3300042614 | Bacteria | 11647 |
| 20 | JGI24695J34938_10001009 | 3300002450 | Bacteria | 25530 |
| 21 | JGI24695J34938_10054507 | 3300002450 | Bacteria | 1733 |
| 22 | JGI24695J34938_10068442 | 3300002450 | Bacteria | 1491 |
| 23 | Ga0072941_1004833 | 3300005201 | Bacteria | 19559 |
| 24 | Ga0123356_10006238 | 3300010049 | Bacteria | 12045 |
| 25 | Ga0123356_10079776 | 3300010049 | Bacteria | 3093 |
| 26 | Ga0123356_10379613 | 3300010049 | Bacteria | 1545 |
| 27 | Ga0466720_121395 | 3300042607 | Bacteria | 24520 |
| 28 | Ga0466721_218731 | 3300042608 | Bacteria | 30688 |
| 29 | Ga0466702_240224 | 3300042635 | Bacteria | 13531 |
| 30 | Ga0466694_198818 | 3300042594 | Bacteria | 1312 |
| 31 | Ga0466699_249878 | 3300042597 | Bacteria | 9041 |
| 32 | Ga0466699_305109 | 3300042597 | Bacteria | 5974 |
| 33 | Ga0466699_397522 | 3300042597 | Viruses | 1680 |
| 34 | Ga0466718_064720 | 3300042617 | Bacteria | 3777 |
| 35 | Ga0466718_086901 | 3300042617 | Bacteria | 3168 |
| 36 | JGI24698J34947_10022891 | 3300002449 | Archaea | 3345 |
| 37 | JGI24695J34938_10000139 | 3300002450 | Bacteria | 65941 |
| 38 | JGI24695J34938_10000416 | 3300002450 | Bacteria | 41447 |
| 39 | JGI24695J34938_10000969 | 3300002450 | Bacteria | 26153 |
| 40 | JGI24695J34938_10007009 | 3300002450 | Bacteria | 6680 |
| 41 | JGI24695J34938_10022082 | 3300002450 | Bacteria | 3099 |
| 42 | Ga0074263_105945 | 3300005485 | Bacteria | 1509 |
| 43 | Ga0123356_10094180 | 3300010049 | Bacteria | 2859 |
| 44 | Ga0123353_10178887 | 3300010167 | Bacteria | 3360 |
| 45 | Ga0466731_051592 | 3300042622 | Bacteria | 14951 |
| 46 | Ga0466731_336562 | 3300042622 | Bacteria | 1296 |
| 47 | Ga0264413_141047 | 3300024493 | Bacteria | 2617 |
| 48 | Ga0466692_146209 | 3300042591 | Bacteria | 16288 |
| 49 | Ga0466699_144341 | 3300042597 | Bacteria | 12054 |
| 50 | Ga0466712_062453 | 3300042614 | Bacteria | 15282 |
| 51 | Ga0466718_065937 | 3300042617 | Bacteria | 1180 |
| 52 | Ga0466718_080690 | 3300042617 | Bacteria | 2861 |
| 53 | Ga0466718_156484 | 3300042617 | Bacteria | 3386 |
| 54 | AustNasuHG_c1001783 | 3300000089 | Bacteria | 7794 |
| 55 | JGI24695J34938_10005015 | 3300002450 | Bacteria | 8426 |
| 56 | JGI24695J34938_10068422 | 3300002450 | Bacteria | 1491 |
| 57 | Ga0072940_1085202 | 3300005200 | Bacteria | 2186 |
| 58 | Ga0072941_1078735 | 3300005201 | Bacteria | 8475 |
| 59 | Ga0123356_10000368 | 3300010049 | Bacteria | 51439 |
| 60 | Ga0415639_040130 | 3300038395 | Bacteria | 2390 |
| 61 | Ga0466694_010995 | 3300042594 | Bacteria | 2793 |
| 62 | Ga0466718_030442 | 3300042617 | Bacteria | 1208 |
| 63 | JGI24698J34947_10125826 | 3300002449 | Bacteria | 1104 |
| 64 | Ga0123356_10008563 | 3300010049 | Bacteria | 10151 |
| 65 | Ga0123356_10054946 | 3300010049 | Bacteria | 3708 |
| 66 | Ga0466702_444680 | 3300042635 | Bacteria | 1480 |
| 67 | Ga0264413_106634 | 3300024493 | Bacteria | 8570 |
| 68 | Ga0466693_292178 | 3300042592 | Bacteria | 6647 |
| 69 | Ga0466699_335643 | 3300042597 | Bacteria | 3843 |
| 70 | Ga0466712_049935 | 3300042614 | Bacteria | 22184 |
| 71 | Ga0466718_036308 | 3300042617 | Bacteria | 1225 |
| 72 | Ga0466718_157200 | 3300042617 | Bacteria | 4356 |
| 73 | Ga0466718_157935 | 3300042617 | Bacteria | 7797 |
| 74 | JGI24695J34938_10000010 | 3300002450 | Bacteria | 132147 |
| 75 | JGI24695J34938_10000143 | 3300002450 | Bacteria | 65111 |
| 76 | JGI24695J34938_10000174 | 3300002450 | Bacteria | 59663 |
| 77 | JGI24695J34938_10040771 | 3300002450 | Bacteria | 2089 |
| 78 | Ga0072940_1120704 | 3300005200 | Bacteria | 7406 |
| 79 | Ga0072941_1000768 | 3300005201 | Bacteria | 12841 |
| 80 | Ga0466732_263396 | 3300042656 | Bacteria | 1135 |
| 81 | Ga0123356_10008782 | 3300010049 | Bacteria | 10014 |
| 82 | Ga0123356_10036223 | 3300010049 | Bacteria | 4607 |
| 83 | Ga0466731_368474 | 3300042622 | Bacteria | 2749 |
| 84 | Ga0456237_0003665 | 3300041968 | Unclassified | 2479 |
| 85 | Ga0466692_136137 | 3300042591 | Bacteria | 29826 |
| 86 | Ga0466693_366681 | 3300042592 | Bacteria | 24175 |
| 87 | Ga0466718_023348 | 3300042617 | Bacteria | 1097 |
| 88 | AustNasuHG_c1000321 | 3300000089 | Bacteria | 16678 |
| 89 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 90 | JGI24695J34938_10000191 | 3300002450 | Bacteria | 57182 |
| 91 | JGI24695J34938_10082310 | 3300002450 | Bacteria | 1328 |
| 92 | Ga0072940_1072847 | 3300005200 | Bacteria | 7170 |
| 93 | Ga0466720_110889 | 3300042607 | Bacteria | 14555 |
| 94 | Ga0466731_394706 | 3300042622 | Bacteria | 2067 |
| 95 | Ga0466702_309615 | 3300042635 | Bacteria | 3079 |
| 96 | Ga0264413_107168 | 3300024493 | Bacteria | 47740 |
| 97 | Ga0466699_074060 | 3300042597 | Bacteria | 6931 |
| 98 | Ga0466712_136584 | 3300042614 | Bacteria | 18932 |
| 99 | Ga0466718_088627 | 3300042617 | Bacteria | 1515 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042635 | Ga0466702_444680 | Ga0466702_444680_787_1428 | 213 |
| 2 | 3300042617 | Ga0466718_157200 | Ga0466718_157200_1244_2089 | 251 |
| 3 | 3300042617 | Ga0466718_065937 | Ga0466718_065937_384_1154 | 256 |
| 4 | 3300042597 | Ga0466699_074060 | Ga0466699_074060_2315_3127 | 270 |
| 5 | 3300002450 | JGI24695J34938_10000139 | JGI24695J34938_1000013932 | 271 |
| 6 | iso_pr_bacteria | 2781125637 | 2781281461 | 271 |
| 7 | iso_pr_bacteria | 2781125649 | 2781306279 | 271 |
| 8 | 3300002450 | JGI24695J34938_10001009 | JGI24695J34938_1000100918 | 272 |
| 9 | 3300042614 | Ga0466712_095977 | Ga0466712_095977_924_1742 | 272 |
| 10 | 3300042614 | Ga0466712_130080 | Ga0466712_130080_7183_8001 | 272 |
| 11 | 3300010049 | Ga0123356_10094180 | Ga0123356_100941802 | 273 |
| 12 | 3300042614 | Ga0466712_049935 | Ga0466712_049935_2850_3671 | 273 |
| 13 | 3300042617 | Ga0466718_036308 | Ga0466718_036308_359_1180 | 273 |
| 14 | 3300042617 | Ga0466718_086901 | Ga0466718_086901_382_1203 | 273 |
| 15 | 3300042617 | Ga0466718_088627 | Ga0466718_088627_46_867 | 273 |
| 16 | iso_pr_bacteria | 2781125659 | 2781327906 | 273 |
| 17 | 3300005200 | Ga0072940_1020248 | Ga0072940_10202484 | 274 |
| 18 | 3300042622 | Ga0466731_051592 | Ga0466731_051592_3185_4015 | 276 |
| 19 | iso_pr_bacteria | 2781125646 | 2781300744 | 276 |
| 20 | 3300002450 | JGI24695J34938_10000052 | JGI24695J34938_1000005267 | 277 |
| 21 | 3300002450 | JGI24695J34938_10082310 | JGI24695J34938_100823101 | 278 |
| 22 | 3300042597 | Ga0466699_070397 | Ga0466699_070397_2315_3154 | 279 |
| 23 | 3300042597 | Ga0466699_144341 | Ga0466699_144341_9817_10656 | 279 |
| 24 | 3300042597 | Ga0466699_249878 | Ga0466699_249878_5020_5859 | 279 |
| 25 | 3300042597 | Ga0466699_305109 | Ga0466699_305109_2334_3173 | 279 |
| 26 | 3300042597 | Ga0466699_335643 | Ga0466699_335643_114_953 | 279 |
| 27 | 3300042597 | Ga0466699_359082 | Ga0466699_359082_685_1524 | 279 |
| 28 | 3300042597 | Ga0466699_397522 | Ga0466699_397522_555_1394 | 279 |
| 29 | 3300042635 | Ga0466702_240224 | Ga0466702_240224_7164_8003 | 279 |
| 30 | 3300024493 | Ga0264413_107168 | Ga0264413_10716816 | 280 |
| 31 | 3300038395 | Ga0415639_002275 | Ga0415639_002275_3951_4793 | 280 |
| 32 | 3300042617 | Ga0466718_064720 | Ga0466718_064720_453_1295 | 280 |
| 33 | 3300000089 | AustNasuHG_c1000321 | AustNasuHG_10003214 | 281 |
| 34 | 3300002449 | JGI24698J34947_10125826 | JGI24698J34947_101258261 | 281 |
| 35 | 3300005200 | Ga0072940_1072847 | Ga0072940_10728478 | 281 |
| 36 | 3300024493 | Ga0264413_106634 | Ga0264413_1066345 | 281 |
| 37 | 3300038395 | Ga0415639_040130 | Ga0415639_040130_631_1476 | 281 |
| 38 | 3300042594 | Ga0466694_010995 | Ga0466694_010995_299_1144 | 281 |
| 39 | 3300042614 | Ga0466712_062453 | Ga0466712_062453_11953_12798 | 281 |
| 40 | 3300002449 | JGI24698J34947_10022891 | JGI24698J34947_100228916 | 282 |
| 41 | 3300002449 | JGI24698J34947_10084932 | JGI24698J34947_100849322 | 282 |
| 42 | 3300002450 | JGI24695J34938_10000143 | JGI24695J34938_100001438 | 282 |
| 43 | 3300002450 | JGI24695J34938_10000183 | JGI24695J34938_100001835 | 282 |
| 44 | 3300005201 | Ga0072941_1004833 | Ga0072941_100483320 | 282 |
| 45 | 3300005201 | Ga0072941_1006464 | Ga0072941_10064644 | 282 |
| 46 | 3300042594 | Ga0466694_198818 | Ga0466694_198818_92_940 | 282 |
| 47 | 3300042594 | Ga0466694_296354 | Ga0466694_296354_188_1036 | 282 |
| 48 | 3300042614 | Ga0466712_136584 | Ga0466712_136584_12658_13506 | 282 |
| 49 | 3300042617 | Ga0466718_080690 | Ga0466718_080690_950_1798 | 282 |
| 50 | 3300042617 | Ga0466718_156484 | Ga0466718_156484_803_1651 | 282 |
| 51 | 3300042617 | Ga0466718_157935 | Ga0466718_157935_5923_6771 | 282 |
| 52 | iso_pr_bacteria | 2781125663 | 2781338885 | 282 |
| 53 | 3300002450 | JGI24695J34938_10000416 | JGI24695J34938_1000041627 | 283 |
| 54 | 3300002450 | JGI24695J34938_10068422 | JGI24695J34938_100684222 | 283 |
| 55 | 3300002450 | JGI24695J34938_10068442 | JGI24695J34938_100684421 | 283 |
| 56 | 3300005201 | Ga0072941_1000768 | Ga0072941_10007685 | 283 |
| 57 | 3300005201 | Ga0072941_1078735 | Ga0072941_10787355 | 283 |
| 58 | 3300010049 | Ga0123356_10006238 | Ga0123356_100062382 | 283 |
| 59 | 3300010049 | Ga0123356_10008782 | Ga0123356_100087824 | 283 |
| 60 | 3300010049 | Ga0123356_10036223 | Ga0123356_100362232 | 283 |
| 61 | 3300038395 | Ga0415639_210105 | Ga0415639_210105_1388_2239 | 283 |
| 62 | 3300042594 | Ga0466694_029811 | Ga0466694_029811_368_1219 | 283 |
| 63 | 3300042622 | Ga0466731_368474 | Ga0466731_368474_1337_2188 | 283 |
| 64 | 3300042635 | Ga0466702_309615 | Ga0466702_309615_1702_2553 | 283 |
| 65 | iso_pr_bacteria | 2781125665 | 2781342254 | 283 |
| 66 | 3300010049 | Ga0123356_10000784 | Ga0123356_1000078424 | 284 |
| 67 | 3300010049 | Ga0123356_10054946 | Ga0123356_100549462 | 284 |
| 68 | 3300041968 | Ga0456237_0003665 | Ga0456237_0003665_244_1098 | 284 |
| 69 | 3300042591 | Ga0466692_136137 | Ga0466692_136137_4210_5064 | 284 |
| 70 | iso_pr_bacteria | 2781125647 | 2781302705 | 284 |
| 71 | 3300005200 | Ga0072940_1120704 | Ga0072940_11207044 | 285 |
| 72 | 3300042592 | Ga0466693_292178 | Ga0466693_292178_3831_4694 | 287 |
| 73 | 3300042622 | Ga0466731_394706 | Ga0466731_394706_387_1250 | 287 |
| 74 | 3300042591 | Ga0466692_146209 | Ga0466692_146209_968_1834 | 288 |
| 75 | iso_pr_bacteria | 2781125664 | 2781340124 | 288 |
| 76 | 3300000089 | AustNasuHG_c1001783 | AustNasuHG_10017836 | 289 |
| 77 | 3300010049 | Ga0123356_10008563 | Ga0123356_100085638 | 289 |
| 78 | 3300038395 | Ga0415639_128714 | Ga0415639_128714_1992_2861 | 289 |
| 79 | 3300002450 | JGI24695J34938_10040771 | JGI24695J34938_100407712 | 290 |
| 80 | 3300010049 | Ga0123356_10079776 | Ga0123356_100797762 | 290 |
| 81 | 3300042608 | Ga0466721_218731 | Ga0466721_218731_24224_25099 | 291 |
| 82 | 3300042656 | Ga0466732_263396 | Ga0466732_263396_151_1026 | 291 |
| 83 | iso_pr_bacteria | 2781125661 | 2781332692 | 291 |
| 84 | 3300010049 | Ga0123356_10000368 | Ga0123356_1000036824 | 292 |
| 85 | 3300042607 | Ga0466720_110889 | Ga0466720_110889_6630_7508 | 292 |
| 86 | 3300042607 | Ga0466720_121395 | Ga0466720_121395_17601_18479 | 292 |
| 87 | 3300042617 | Ga0466718_023348 | Ga0466718_023348_98_976 | 292 |
| 88 | 3300042617 | Ga0466718_030442 | Ga0466718_030442_305_1183 | 292 |
| 89 | iso_pr_bacteria | 2781125644 | 2781295011 | 292 |
| 90 | 3300002450 | JGI24695J34938_10000010 | JGI24695J34938_10000010109 | 293 |
| 91 | 3300005200 | Ga0072940_1085202 | Ga0072940_10852022 | 293 |
| 92 | 3300002450 | JGI24695J34938_10000080 | JGI24695J34938_100000801 | 294 |
| 93 | 3300002450 | JGI24695J34938_10007009 | JGI24695J34938_100070094 | 294 |
| 94 | 3300010049 | Ga0123356_10000679 | Ga0123356_1000067918 | 294 |
| 95 | 3300024493 | Ga0264413_141047 | Ga0264413_1410475 | 294 |
| 96 | iso_pr_bacteria | 2819992462 | 2819994548 | 294 |
| 97 | iso_pr_bacteria | 2820020240 | 2820021817 | 294 |
| 98 | 3300002450 | JGI24695J34938_10022082 | JGI24695J34938_100220822 | 296 |
| 99 | 3300005485 | Ga0074263_105945 | Ga0074263_1059452 | 296 |
| 100 | 3300042600 | Ga0466700_195698 | Ga0466700_195698_3864_4754 | 296 |
| 101 | 3300002450 | JGI24695J34938_10000117 | JGI24695J34938_1000011754 | 298 |
| 102 | 3300042622 | Ga0466731_336562 | Ga0466731_336562_170_1075 | 301 |
| 103 | iso_pr_bacteria | 2781125648 | 2781305244 | 301 |
| 104 | 3300002450 | JGI24695J34938_10000969 | JGI24695J34938_100009695 | 302 |
| 105 | 3300042592 | Ga0466693_366681 | Ga0466693_366681_14841_15749 | 302 |
| 106 | 3300002450 | JGI24695J34938_10025588 | JGI24695J34938_100255882 | 304 |
| 107 | 3300002450 | JGI24695J34938_10054507 | JGI24695J34938_100545072 | 304 |
| 108 | 3300010049 | Ga0123356_10379613 | Ga0123356_103796132 | 304 |
| 109 | 3300002450 | JGI24695J34938_10005015 | JGI24695J34938_100050158 | 305 |
| 110 | 3300002450 | JGI24695J34938_10000191 | JGI24695J34938_1000019127 | 306 |
| 111 | iso_pr_bacteria | 2781125650 | 2781308134 | 306 |
| 112 | 3300002450 | JGI24695J34938_10000174 | JGI24695J34938_1000017435 | 307 |
| 113 | 3300010167 | Ga0123353_10178887 | Ga0123353_101788872 | 310 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF08445 | FR47 | FR47-like protein | 245 | 301 | 0.93 |
| PF13673 | Acetyltransf_10 | Acetyltransferase (GNAT) domain | 188 | 300 | 0.87 |
| PF00583 | Acetyltransf_1 | Acetyltransferase (GNAT) family | 216 | 298 | 0.87 |
| PF13302 | Acetyltransf_3 | Acetyltransferase (GNAT) domain | 170 | 299 | 0.85 |
| PF13508 | Acetyltransf_7 | Acetyltransferase (GNAT) domain | 217 | 299 | 0.76 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08445 | GO:0016747 | acyltransferase activity, transferring groups other than amino-acyl groups | MF |
Structural Annotation β Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8a9n-assembly1.cif.gz_B | Structure of DpA polyamine acetyltransferase in complex with 1,3-DAP | 0.878 | 169 | 302 |
| 8a9o-assembly1.cif.gz_B | Structure of the polyamine acetyltransferase DpA | 0.857 | 169 | 302 |
| 8a9o-assembly1.cif.gz_A | Structure of the polyamine acetyltransferase DpA | 0.855 | 166 | 299 |
| 1qsm-assembly1.cif.gz_D | Histone Acetyltransferase HPA2 from Saccharomyces Cerevisiae in Complex with Acetyl Coenzyme A | 0.829 | 169 | 300 |
| 4qvt-assembly5.cif.gz_H | Crystal structure of predicted N-acyltransferase (ypeA) in complex with acetyl-CoA from Escherichia coli | 0.821 | 171 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7EZI9_69_205_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9049 | 220 | 297 | 3.40.630.30 |
| af_E0CYC6_80_216_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.9041 | 220 | 299 | 3.40.630.30 |
| af_I1MRQ6_38_162_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8625 | 220 | 294 | 3.40.630.30 |
| af_Q7EYF5_51_166_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.8559 | 220 | 295 | 3.40.630.30 |
| af_I6XFI7_58_284_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.852 | 80 | 308 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-F5YGE0-F1-model_v4 | Uncharacterized/unreviewed | 0.9236 | 21 | 309 |
GO:0016747
|
| AF-A0A7X4YJQ7-F1-model_v4 | Uncharacterized/unreviewed | 0.8987 | 173 | 299 |
GO:0016747
|
| AF-A0A7V3A2H6-F1-model_v4 | Uncharacterized/unreviewed | 0.8943 | 29 | 309 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.85 | 0.9 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.