Protein Family IF03156
Metagenome
Isolate
202
Members
124
Samples
160
Scaffolds
447.17
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10131598|Ga0123353_101315984
- Length
- 514 aa
- Sequence
- MLKAEAIPTIAQPRGKHGEASEAPSTSVRTWSKSVLGEAQATSYRRPMSTSLAPSVSKTRELFGTDGIRGVANEAPMTPELAMRLGRAIAYVAGKGKSRRPRIVIGKDTRLSGYMLETAMASGICAMGGKVMLSGPIPTPAVAHLTVSMRADAGVVISASHNPYMDNGIKVFGPDGFKLPDEKEVEIERLMGSSDMDSSVPTGDRIGSAIRIEDAKGRYVVFAKQTFPKEYTLDGLRIVVDAAHGAAYAVAPSVFTELGAEVVEMGCDPNGKNINDQVGALHPEATQREVVRCGADIGIALDGDADRVIVVDEKGRMVDGDAIMALYGTEQLNAGKLPGETVVATVMSNLGLERAIEAAGGTLKRTAVGDRYVVEEMRRGGYTFGGEQSGHLIFLDHVSTGDGIVAALQVLLIMLRRGRRLSELAADCMVRVPQLLKNVSLSARKPIEAMPHLVRAIQSVEKELGRDGRVLVRWSGTEAKLRVMVEGPDDARIAMYVNDMIEQAKLDIPPRQS*
Sample Types
Isolate
20.8%
Metagenome
79.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
18.8%
Unclassified
17.9%
Formicidae
12.0%
Kalotermitidae
11.1%
Culicidae
6.8%
Sarcophagidae
6.0%
Armadillidiidae
6.0%
Curculionidae
3.4%
Termopsidae
2.6%
Apidae
1.7%
Elmidae
1.7%
Rhinotermitidae
1.7%
Ixodidae
1.7%
Stratiomyidae
0.9%
Hydrophilidae
0.9%
Passalidae
0.9%
Drosophilidae
0.9%
Hodotermitidae
0.9%
Crambidae
0.9%
Scarabaeidae
0.9%
Cixiidae
0.9%
Gryllidae
0.9%
Aphididae
0.9%
Taxonomy
Archaea
0
Bacteria
191
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2832037495 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 2 | 2035918003 | Mountain Pine Beetle microbial communities from McBride, British Columbia, Canada - Lodgepole pine | Metagenome | Curculionidae |
| 3 | 2582581321 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 4 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 5 | 3300012841 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG | Metagenome | Armadillidiidae |
| 6 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 7 | 3300012852 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG | Metagenome | |
| 8 | 8065340634 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 9 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2870361953 | Entomomonas moraniae QZS01 | Isolate | Apidae |
| 14 | 2791354930 | Wohlfahrtiimonas larvae kbl006 | Isolate | Stratiomyidae |
| 15 | 2820050117 | Unclassified Proteobacteria Th196P3bin129 | Isolate | Unclassified |
| 16 | 2820106212 | Unclassified Proteobacteria Emb289P4bin44 | Isolate | Unclassified |
| 17 | 2820161938 | Unclassified Proteobacteria Cu122P3bin14 | Isolate | Unclassified |
| 18 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300009478 | Microbial communities of aphids from honeysuckle in Ottawa, Ontario, CA - Hyadaphis tataricae CNC#HEM071793 seqcov | Metagenome | |
| 21 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 22 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 25 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 26 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 27 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 28 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 29 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 30 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 31 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 32 | 2517487021 | Wohlfahrtiimonas chitiniclastica DSM 18708 | Isolate | Sarcophagidae |
| 33 | 2820047982 | Unclassified Proteobacteria Th196P3bin67 | Isolate | Unclassified |
| 34 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 35 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 36 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 37 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 38 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 39 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 40 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 41 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 42 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 43 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 44 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 45 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 46 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 47 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 48 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 49 | 2834230000 | Pandoraea novymonadis E262 | Isolate | Unclassified |
| 50 | 2855798354 | Achromobacter insolitus AR476-2 | Isolate | Crambidae |
| 51 | 2513237114 | Ignatzschineria larvae DSM 13226 | Isolate | Sarcophagidae |
| 52 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 53 | 3300007067 | Ant gut microbial communities from Cephalotes spinosus, Peru | Metagenome | Formicidae |
| 54 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 55 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 56 | 3300007733 | Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean | Metagenome | |
| 57 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 58 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 59 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 60 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 61 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
| 62 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 63 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 64 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 65 | 2831380896 | Ignatzschineria ureiclastica KCTC 22644 | Isolate | Sarcophagidae |
| 66 | 2864761044 | Stenotrophomonas rhizophilia S00008 | Isolate | Elmidae |
| 67 | 2820065746 | Unclassified Proteobacteria Nt197P3bin56 | Isolate | Unclassified |
| 68 | 2820211246 | Unclassified Kiritimatiellaeota Nt197P3bin96 | Isolate | Unclassified |
| 69 | 3007473699 | Pseudomonas sp. S30 | Isolate | Curculionidae |
| 70 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 71 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 72 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 73 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 74 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 75 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 76 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 77 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 78 | 8001394582 | Limnobaculum allomyrinae BWR-B9 | Isolate | Scarabaeidae |
| 79 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 80 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 81 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 82 | 2864751016 | Pseudomonas oryzihabitans S00005 | Isolate | Elmidae |
| 83 | 2603880172 | Burkholderiales C | Isolate | Unclassified |
| 84 | 2617270844 | Dyella sp. HyOG | Isolate | Cixiidae |
| 85 | 2775506951 | Candidatus Coxiella mudrowiae CRS-CAT | Isolate | Unclassified |
| 86 | 2820089333 | Unclassified Proteobacteria Lab288P3bin88 | Isolate | Unclassified |
| 87 | 2820209022 | Unclassified Kiritimatiellaeota Th196P3bin76 | Isolate | Unclassified |
| 88 | 3000478755 | Entomomonas asaccharolytica F2A | Isolate | Gryllidae |
| 89 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 90 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 91 | 3300012815 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG | Metagenome | |
| 92 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 93 | 8035326735 | Pseudomonas prosekii A2-NA13 | Isolate | Curculionidae |
| 94 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 95 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 96 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 97 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 98 | 2833478085 | Oceanospirillum multiglobuliferum ATCC 33336 | Isolate | Unclassified |
| 99 | 2524614573 | Marinospirillum minutulum DSM 6287 | Isolate | Unclassified |
| 100 | 2548876789 | Xanthomonas sacchari NCPPB 4393 | Isolate | |
| 101 | 2718217749 | Coxiella mudrowiae CRt | Isolate | Ixodidae |
| 102 | 2820111668 | Unclassified Proteobacteria Emb289P4bin34 | Isolate | Unclassified |
| 103 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 104 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 105 | 3300009473 | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov | Metagenome | |
| 106 | 3300009479 | Microbial communities of aphids from Triticum aestivum in Marana, AZ, USA - Sitobion avenae seqcov | Metagenome | Aphididae |
| 107 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 108 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 109 | 8035321120 | Pseudomonas prosekii A2-NA12 | Isolate | Curculionidae |
| 110 | 2832039703 | Ignatzschineria cameli UAE-HKU59 | Isolate | Sarcophagidae |
| 111 | 2648501628 | Xanthomonas sp. Cag60 | Isolate | Unclassified |
| 112 | 2820164216 | Unclassified Proteobacteria Cu122P1bin22 | Isolate | Unclassified |
| 113 | 3002773460 | Coxiella endosymbiont of Amblyomma nuttalli Craf2019 | Isolate | Ixodidae |
| 114 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 115 | 3300007188 | Ant gut microbial communities from Cephalotes rohweri, Arizona, USA | Metagenome | Formicidae |
| 116 | 3300012824 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG | Metagenome | Armadillidiidae |
| 117 | 3300012835 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG | Metagenome | Culicidae |
| 118 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 119 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 120 | 3300012854 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG | Metagenome | Culicidae |
| 121 | 8065338428 | Ignatzschineria indica KCTC 22643 | Isolate | Sarcophagidae |
| 122 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 123 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 124 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466701_048276 | 3300042598 | Bacteria | 4226 |
| 2 | Ga0466701_065450 | 3300042598 | Bacteria | 12476 |
| 3 | Ga0466706_225632 | 3300042599 | Bacteria | 47845 |
| 4 | Ga0466713_012515 | 3300042602 | Bacteria | 16825 |
| 5 | Ga0160446_100003 | 3300012835 | Bacteria | 464592 |
| 6 | Ga0160444_100279 | 3300012841 | Bacteria | 38044 |
| 7 | Ga0160444_101258 | 3300012841 | Unclassified | 5365 |
| 8 | Ga0160445_100021 | 3300012847 | Bacteria | 204981 |
| 9 | Ga0160435_1000087 | 3300012857 | Unclassified | 54325 |
| 10 | Ga0415639_248150 | 3300038395 | Bacteria | 3141 |
| 11 | Ga0466695_140543 | 3300042595 | Bacteria | 10055 |
| 12 | Ga0466696_499429 | 3300042596 | Bacteria | 3935 |
| 13 | Ga0466723_084812 | 3300042618 | Bacteria | 35121 |
| 14 | Ga0466723_244742 | 3300042618 | Bacteria | 10949 |
| 15 | Ga0466726_251360 | 3300042619 | Bacteria | 10611 |
| 16 | Ga0466734_105236 | 3300042623 | Bacteria | 4457 |
| 17 | Ga0466730_030188 | 3300042625 | Bacteria | 32749 |
| 18 | Ga0466702_253995 | 3300042635 | Bacteria | 2830 |
| 19 | IMNBGM34_c000752 | 3300000036 | Bacteria | 7631 |
| 20 | Ga0102736_1000051 | 3300007052 | Bacteria | 111370 |
| 21 | Ga0103265_1002472 | 3300007068 | Bacteria | 2846 |
| 22 | Ga0102734_1003674 | 3300007129 | Bacteria | 3471 |
| 23 | Ga0102734_1038542 | 3300007129 | Bacteria | 2385 |
| 24 | Ga0103268_1000854 | 3300007192 | Bacteria | 8454 |
| 25 | Ga0105524_101046 | 3300007733 | Bacteria | 19538 |
| 26 | Ga0123357_10010886 | 3300009784 | Bacteria | 11608 |
| 27 | Ga0123355_10040138 | 3300009826 | Bacteria | 7619 |
| 28 | Ga0123356_10000135 | 3300010049 | Bacteria | 82454 |
| 29 | Ga0466697_227821 | 3300042611 | Unclassified | 1600 |
| 30 | Ga0466705_000531 | 3300042612 | Bacteria | 24250 |
| 31 | Ga0466705_320344 | 3300042612 | Bacteria | 14237 |
| 32 | Ga0466701_018917 | 3300042598 | Bacteria | 69268 |
| 33 | Ga0466719_109586 | 3300042606 | Bacteria | 2446 |
| 34 | Ga0160456_100091 | 3300012820 | Bacteria | 110976 |
| 35 | Ga0160456_101245 | 3300012820 | Unclassified | 6302 |
| 36 | Ga0160467_101360 | 3300012829 | Bacteria | 10074 |
| 37 | Ga0160460_101974 | 3300012845 | Bacteria | 5516 |
| 38 | Ga0160436_1001087 | 3300012861 | Bacteria | 7963 |
| 39 | Ga0466728_187950 | 3300042620 | Bacteria | 1824 |
| 40 | Ga0466728_205591 | 3300042620 | Bacteria | 48931 |
| 41 | Ga0466729_079970 | 3300042621 | Bacteria | 13216 |
| 42 | Ga0466729_155478 | 3300042621 | Bacteria | 12407 |
| 43 | Ga0466731_287613 | 3300042622 | Bacteria | 2686 |
| 44 | Ga0466704_015849 | 3300042643 | Bacteria | 6844 |
| 45 | Ga0466704_275633 | 3300042643 | Bacteria | 6157 |
| 46 | Ga0466704_306920 | 3300042643 | Bacteria | 25370 |
| 47 | DPOL_contig07789 | 2035918003 | Bacteria | 4323 |
| 48 | Ga0102739_1001214 | 3300007095 | Bacteria | 4355 |
| 49 | Ga0102734_1004384 | 3300007129 | Bacteria | 3172 |
| 50 | Ga0123356_10059215 | 3300010049 | Unclassified | 3573 |
| 51 | Ga0123353_10131598 | 3300010167 | Bacteria | 4013 |
| 52 | Ga0123354_10210351 | 3300010882 | Bacteria | 2104 |
| 53 | Ga0466701_019515 | 3300042598 | Bacteria | 190398 |
| 54 | Ga0160440_100002 | 3300012815 | Bacteria | 1234951 |
| 55 | Ga0160443_100318 | 3300012848 | Bacteria | 45289 |
| 56 | Ga0160448_100141 | 3300012854 | Bacteria | 34463 |
| 57 | Ga0160436_1000520 | 3300012861 | Bacteria | 14318 |
| 58 | Ga0160436_1000560 | 3300012861 | Bacteria | 13532 |
| 59 | Ga0466657_378010 | 3300042582 | Bacteria | 1762 |
| 60 | Ga0466715_342506 | 3300042616 | Bacteria | 110263 |
| 61 | Ga0466728_147545 | 3300042620 | Bacteria | 3249 |
| 62 | Ga0466729_168285 | 3300042621 | Bacteria | 38833 |
| 63 | Ga0466735_183111 | 3300042624 | Bacteria | 17201 |
| 64 | Ga0466703_009541 | 3300042636 | Bacteria | 1357 |
| 65 | Ga0466724_43013 | 3300042649 | Bacteria | 36848 |
| 66 | Ga0103263_100266 | 3300007042 | Bacteria | 8755 |
| 67 | Ga0102740_1000016 | 3300007140 | Bacteria | 44745 |
| 68 | Ga0102740_1000569 | 3300007140 | Unclassified | 17861 |
| 69 | Ga0103268_1000111 | 3300007192 | Bacteria | 26331 |
| 70 | Ga0105524_101855 | 3300007733 | Bacteria | 1663 |
| 71 | Ga0127529_1000015 | 3300009479 | Bacteria | 636679 |
| 72 | Ga0123357_10000348 | 3300009784 | Bacteria | 43684 |
| 73 | Ga0466697_061814 | 3300042611 | Bacteria | 7952 |
| 74 | Ga0466732_288918 | 3300042656 | Bacteria | 9888 |
| 75 | Ga0466707_226302 | 3300042601 | Bacteria | 1735 |
| 76 | Ga0466716_456821 | 3300042605 | Bacteria | 4690 |
| 77 | Ga0466697_017606 | 3300042611 | Unclassified | 3199 |
| 78 | Ga0160447_101847 | 3300012849 | Bacteria | 7860 |
| 79 | Ga0160434_101219 | 3300012850 | Bacteria | 5024 |
| 80 | Ga0466690_010930 | 3300042590 | Bacteria | 2477 |
| 81 | Ga0466690_394871 | 3300042590 | Bacteria | 5097 |
| 82 | Ga0466710_380954 | 3300042613 | Bacteria | 1755 |
| 83 | Ga0466726_065603 | 3300042619 | Bacteria | 30579 |
| 84 | Ga0466728_285478 | 3300042620 | Bacteria | 58553 |
| 85 | Ga0466729_070210 | 3300042621 | Bacteria | 6221 |
| 86 | Ga0466734_097842 | 3300042623 | Bacteria | 2826 |
| 87 | Ga0466724_55061 | 3300042649 | Bacteria | 3949 |
| 88 | Ga0466725_217245 | 3300042654 | Bacteria | 116780 |
| 89 | Ga0466727_149660 | 3300042655 | Bacteria | 6512 |
| 90 | CVPL010W_10004218 | 3300002931 | Bacteria | 16081 |
| 91 | Ga0103261_1001496 | 3300007083 | Bacteria | 5516 |
| 92 | Ga0102739_1000060 | 3300007095 | Bacteria | 70864 |
| 93 | Ga0103260_1000037 | 3300007139 | Unclassified | 44687 |
| 94 | Ga0103264_1043998 | 3300007188 | Bacteria | 1849 |
| 95 | Ga0103268_1000666 | 3300007192 | Bacteria | 9885 |
| 96 | Ga0127524_100015 | 3300009478 | Bacteria | 633867 |
| 97 | Ga0466697_072487 | 3300042611 | Bacteria | 1674 |
| 98 | Ga0466706_083041 | 3300042599 | Bacteria | 14401 |
| 99 | Ga0466707_180691 | 3300042601 | Bacteria | 3622 |
| 100 | Ga0160469_100002 | 3300012824 | Bacteria | 1020748 |
| 101 | Ga0160472_102134 | 3300012839 | Bacteria | 4754 |
| 102 | Ga0160430_100141 | 3300012852 | Bacteria | 55429 |
| 103 | Ga0466693_345491 | 3300042592 | Bacteria | 3045 |
| 104 | Ga0466691_186443 | 3300042593 | Bacteria | 1948 |
| 105 | Ga0466691_228473 | 3300042593 | Bacteria | 29828 |
| 106 | Ga0466715_570356 | 3300042616 | Bacteria | 5580 |
| 107 | Ga0466726_089364 | 3300042619 | Bacteria | 15321 |
| 108 | JGI24703J35330_11700967 | 3300002501 | Bacteria | 2026 |
| 109 | Ga0102738_1000030 | 3300007141 | Bacteria | 97776 |
| 110 | Ga0123357_10000012 | 3300009784 | Bacteria | 162689 |
| 111 | Ga0123353_10001041 | 3300010167 | Bacteria | 33987 |
| 112 | Ga0123353_10192069 | 3300010167 | Bacteria | 3222 |
| 113 | Ga0466706_162700 | 3300042599 | Bacteria | 1836 |
| 114 | Ga0160472_100289 | 3300012839 | Bacteria | 53316 |
| 115 | Ga0160457_1000095 | 3300012858 | Bacteria | 117461 |
| 116 | Ga0466657_322786 | 3300042582 | Bacteria | 5504 |
| 117 | Ga0466715_205233 | 3300042616 | Bacteria | 15798 |
| 118 | Ga0466715_462587 | 3300042616 | Bacteria | 8104 |
| 119 | Ga0466726_179599 | 3300042619 | Bacteria | 28859 |
| 120 | Ga0466734_125400 | 3300042623 | Bacteria | 5213 |
| 121 | Ga0466727_176831 | 3300042655 | Bacteria | 25402 |
| 122 | IMNBGM34_c000023 | 3300000036 | Bacteria | 40778 |
| 123 | Ga0103263_100826 | 3300007042 | Bacteria | 4134 |
| 124 | Ga0123353_10305030 | 3300010167 | Bacteria | 2427 |
| 125 | Ga0466697_228216 | 3300042611 | Bacteria | 4605 |
| 126 | Ga0466705_218871 | 3300042612 | Bacteria | 32705 |
| 127 | Ga0466713_149940 | 3300042602 | Bacteria | 71244 |
| 128 | Ga0160443_102229 | 3300012848 | Unclassified | 4594 |
| 129 | Ga0160435_1000083 | 3300012857 | Bacteria | 57275 |
| 130 | Ga0466657_292134 | 3300042582 | Bacteria | 26838 |
| 131 | Ga0466691_008480 | 3300042593 | Bacteria | 8923 |
| 132 | Ga0466691_055841 | 3300042593 | Bacteria | 7993 |
| 133 | Ga0466723_001919 | 3300042618 | Bacteria | 9640 |
| 134 | Ga0466726_217236 | 3300042619 | Bacteria | 220873 |
| 135 | Ga0466730_094540 | 3300042625 | Bacteria | 1898 |
| 136 | Ga0466703_273054 | 3300042636 | Bacteria | 15065 |
| 137 | Ga0466709_321076 | 3300042648 | Bacteria | 10566 |
| 138 | Ga0466725_176106 | 3300042654 | Bacteria | 50141 |
| 139 | JGI24702J35022_10001515 | 3300002462 | Bacteria | 14430 |
| 140 | JGI24702J35022_10020319 | 3300002462 | Bacteria | 3606 |
| 141 | Ga0103266_1000182 | 3300007067 | Bacteria | 46657 |
| 142 | Ga0102734_1000032 | 3300007129 | Bacteria | 46644 |
| 143 | Ga0104050_1005651 | 3300007153 | Bacteria | 5932 |
| 144 | Ga0123356_10002713 | 3300010049 | Bacteria | 18811 |
| 145 | Ga0466722_112192 | 3300042609 | Bacteria | 1507 |
| 146 | Ga0160441_100053 | 3300012825 | Unclassified | 154313 |
| 147 | Ga0160472_100257 | 3300012839 | Bacteria | 60906 |
| 148 | Ga0160444_100169 | 3300012841 | Bacteria | 63082 |
| 149 | Ga0466691_066022 | 3300042593 | Unclassified | 1609 |
| 150 | Ga0466695_218234 | 3300042595 | Bacteria | 21608 |
| 151 | Ga0466718_158838 | 3300042617 | Bacteria | 3467 |
| 152 | HBC_ctgsDRAFT_1000474 | 3300000333 | Bacteria | 9080 |
| 153 | CVPL010W_10000004 | 3300002931 | Bacteria | 116030 |
| 154 | Ga0102736_1000138 | 3300007052 | Bacteria | 19909 |
| 155 | Ga0102735_1002321 | 3300007080 | Bacteria | 2928 |
| 156 | Ga0103261_1000024 | 3300007083 | Bacteria | 66582 |
| 157 | Ga0103260_1001062 | 3300007139 | Bacteria | 5026 |
| 158 | Ga0103264_1000005 | 3300007188 | Bacteria | 151532 |
| 159 | Ga0127520_1000008 | 3300009473 | Bacteria | 642906 |
| 160 | Ga0123355_10013445 | 3300009826 | Bacteria | 12740 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02878 | PGM_PMM_I | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I | 61 | 193 | 0.97 |
| PF02880 | PGM_PMM_III | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III | 319 | 429 | 0.97 |
| PF00408 | PGM_PMM_IV | Phosphoglucomutase/phosphomannomutase, C-terminal domain | 436 | 502 | 0.93 |
| PF02879 | PGM_PMM_II | Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II | 219 | 315 | 0.83 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02879 | GO:0005975 | carbohydrate metabolic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.