Protein Family IF03140

Metagenome Isolate
188 Members
50 Samples
183 Scaffolds
97.16 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10109964|Ga0123353_101099644
Length
117 aa
Sequence
MPYICSPKNKYIIHLNYFIVMTKADIVNAIARNTGIDRASALACVEGFMEEVMNSMNQGENVYLRGFGSFVVKKRAAKAARHIKNETTLMIPERFVPTFKPSQYFVENLRNSLDQK*

📊 Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.0%
Kalotermitidae 28.0%
Unclassified 14.0%
Rhinotermitidae 6.0%
Termopsidae 6.0%
Passalidae 4.0%
Hodotermitidae 2.0%
Blattidae 2.0%

🌳 Taxonomy

Archaea 0
Bacteria 165
Eukaryota 0
Viruses 0
Unclassified 23

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
19 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
20 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
21 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
22 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
23 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
24 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
25 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
26 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
29 2820762746 Unclassified Bacteroidetes Mp193P4bin3 Isolate Unclassified
30 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
34 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
35 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
38 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
39 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
40 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
43 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
44 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
45 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
46 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
47 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
48 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
49 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
50 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_217332 3300042611 Bacteria 1687
2 Ga0466711_221387 3300042615 Bacteria 14251
3 Ga0466726_088483 3300042619 Bacteria 2057
4 Ga0466706_218899 3300042599 Bacteria 4292
5 Ga0466700_054481 3300042600 Bacteria 7148
6 Ga0466707_013976 3300042601 Bacteria 1633
7 Ga0466707_278974 3300042601 Bacteria 3029
8 Ga0466719_211662 3300042606 Unclassified 1381
9 Ga0123354_10134603 3300010882 Bacteria 3099
10 Ga0123354_10728467 3300010882 Bacteria 685
11 IMNBL1DRAFT_c0078174 3300000062 Bacteria 934
12 JGI24702J35022_10005850 3300002462 Bacteria 7153
13 Ga0466729_268762 3300042621 Bacteria 2321
14 Ga0466735_113157 3300042624 Bacteria 5196
15 Ga0466703_085557 3300042636 Bacteria 2047
16 Ga0466703_155626 3300042636 Unclassified 1620
17 Ga0466704_007516 3300042643 Bacteria 24581
18 Ga0466709_096114 3300042648 Bacteria 7314
19 Ga0466692_026125 3300042591 Bacteria 30408
20 Ga0466694_292983 3300042594 Bacteria 3349
21 Ga0466705_522885 3300042612 Bacteria 2842
22 Ga0466710_127284 3300042613 Bacteria 1711
23 Ga0466715_054289 3300042616 Bacteria 15475
24 Ga0466715_459299 3300042616 Bacteria 15738
25 Ga0466723_190362 3300042618 Bacteria 3402
26 Ga0466726_046595 3300042619 Bacteria 30556
27 Ga0466729_107829 3300042621 Bacteria 2876
28 Ga0466701_036031 3300042598 Bacteria 1687
29 Ga0466707_338142 3300042601 Bacteria 23698
30 Ga0466716_144281 3300042605 Bacteria 9917
31 Ga0466719_004777 3300042606 Bacteria 29050
32 Ga0466719_423267 3300042606 Bacteria 11355
33 Ga0466722_243730 3300042609 Bacteria 4046
34 Ga0123357_10088628 3300009784 Bacteria 4043
35 Ga0123354_10000201 3300010882 Bacteria 51540
36 Ga0123354_10102465 3300010882 Unclassified 3858
37 JGI24702J35022_10153821 3300002462 Bacteria 1292
38 JGI24705J35276_12229766 3300002504 Bacteria 3461
39 JGI24696J40584_12905166 3300002834 Unclassified 1212
40 JGI24696J40584_12959802 3300002834 Bacteria 5682
41 Ga0466735_022443 3300042624 Bacteria 2962
42 Ga0466735_120532 3300042624 Bacteria 2563
43 Ga0466735_169333 3300042624 Unclassified 1232
44 Ga0466704_075296 3300042643 Bacteria 42602
45 Ga0466704_621886 3300042643 Bacteria 31412
46 Ga0466727_085133 3300042655 Bacteria 23683
47 Ga0466727_308046 3300042655 Bacteria 6145
48 Ga0466696_466996 3300042596 Bacteria 1582
49 Ga0466715_105177 3300042616 Bacteria 12080
50 Ga0466715_489251 3300042616 Bacteria 3306
51 Ga0466706_055305 3300042599 Bacteria 1190
52 Ga0466707_189059 3300042601 Bacteria 7875
53 Ga0466707_420065 3300042601 Bacteria 1951
54 Ga0466713_007766 3300042602 Bacteria 67445
55 Ga0466716_162458 3300042605 Bacteria 2608
56 Ga0123357_10010185 3300009784 Unclassified 11936
57 Ga0123356_11405079 3300010049 Unclassified 858
58 Ga0123354_10004885 3300010882 Bacteria 19219
59 IMNBL1DRAFT_c0078592 3300000062 Bacteria 930
60 IMNBL1DRAFT_c0133489 3300000062 Bacteria 645
61 Ga0123357_10002416 3300009784 Bacteria 20828
62 Ga0466735_023200 3300042624 Bacteria 3895
63 Ga0466703_281365 3300042636 Bacteria 9089
64 Ga0466704_286775 3300042643 Bacteria 3414
65 Ga0466704_456552 3300042643 Bacteria 3120
66 Ga0466704_586799 3300042643 Bacteria 9380
67 Ga0466708_139920 3300042652 Bacteria 25293
68 Ga0466727_179474 3300042655 Bacteria 2903
69 Ga0466690_276223 3300042590 Bacteria 213056
70 Ga0466692_008016 3300042591 Bacteria 17376
71 Ga0466692_085363 3300042591 Bacteria 2340
72 Ga0466692_178028 3300042591 Bacteria 52823
73 Ga0466705_413942 3300042612 Bacteria 1089
74 Ga0466715_159912 3300042616 Bacteria 1757
75 Ga0466726_080380 3300042619 Bacteria 8611
76 Ga0466701_017652 3300042598 Bacteria 77230
77 Ga0466707_146418 3300042601 Bacteria 49406
78 Ga0466713_077457 3300042602 Bacteria 1903
79 Ga0466719_076842 3300042606 Bacteria 3108
80 Ga0466719_572882 3300042606 Bacteria 1223
81 Ga0123357_10017697 3300009784 Bacteria 9442
82 Ga0123357_10225876 3300009784 Bacteria 2065
83 Ga0123357_10284138 3300009784 Unclassified 1703
84 Ga0123357_10783839 3300009784 Bacteria 651
85 Ga0123354_10613296 3300010882 Bacteria 792
86 2227350224 2225789004 Bacteria 6181
87 IMNBL1DRAFT_c0002915 3300000062 Bacteria 11445
88 IMNBL1DRAFT_c0004165 3300000062 Bacteria 8795
89 IMNBL1DRAFT_c0009166 3300000062 Bacteria 4929
90 IMNBL1DRAFT_c0019820 3300000062 Bacteria 2743
91 Ga0068305_10350063 3300005083 Bacteria 5393
92 Ga0466729_228912 3300042621 Bacteria 1127
93 Ga0466690_026988 3300042590 Bacteria 18621
94 Ga0466690_176257 3300042590 Bacteria 7605
95 Ga0466692_058282 3300042591 Bacteria 1279
96 Ga0466691_067196 3300042593 Bacteria 21479
97 Ga0466701_088409 3300042598 Bacteria 49099
98 Ga0466713_088520 3300042602 Bacteria 50636
99 Ga0466717_195832 3300042604 Bacteria 1465
100 Ga0466722_036237 3300042609 Bacteria 8342
101 Ga0466698_400083 3300042610 Unclassified 1057
102 Ga0123357_10038580 3300009784 Bacteria 6504
103 Ga0123354_10002288 3300010882 Bacteria 25043
104 Ga0123354_10108383 3300010882 Bacteria 3689
105 IMNBL1DRAFT_c0000966 3300000062 Bacteria 22205
106 JGI24702J35022_10005841 3300002462 Bacteria 7157
107 JGI24705J35276_11502209 3300002504 Unclassified 558
108 JGI24705J35276_11743043 3300002504 Unclassified 653
109 JGI24699J35502_11133651 3300002509 Bacteria 12945
110 Ga0466735_100553 3300042624 Bacteria 1269
111 Ga0466735_133735 3300042624 Bacteria 22495
112 Ga0466735_158546 3300042624 Bacteria 1975
113 Ga0466735_213875 3300042624 Bacteria 6087
114 Ga0466703_176373 3300042636 Bacteria 12107
115 Ga0466703_254927 3300042636 Bacteria 1983
116 Ga0466704_454748 3300042643 Bacteria 12640
117 Ga0466727_290402 3300042655 Bacteria 1429
118 Ga0466656_019025 3300042550 Bacteria 3271
119 Ga0466691_100249 3300042593 Bacteria 5152
120 Ga0466696_328182 3300042596 Bacteria 1375
121 Ga0466705_058615 3300042612 Bacteria 10341
122 Ga0466711_198868 3300042615 Bacteria 6592
123 Ga0466723_042046 3300042618 Bacteria 9471
124 Ga0466728_183471 3300042620 Bacteria 7847
125 Ga0466728_392041 3300042620 Unclassified 1348
126 Ga0466729_106378 3300042621 Bacteria 2410
127 Ga0466707_149826 3300042601 Bacteria 3724
128 Ga0466707_317775 3300042601 Bacteria 5908
129 Ga0466716_378206 3300042605 Bacteria 16459
130 Ga0123357_10293511 3300009784 Bacteria 1656
131 Ga0123355_11785929 3300009826 Unclassified 581
132 Ga0123354_10351499 3300010882 Bacteria 1313
133 2227467693 2225789004 Bacteria 5059
134 JGI24702J35022_10338667 3300002462 Bacteria 896
135 JGI24699J35502_11134120 3300002509 Bacteria 33569
136 Ga0466729_282254 3300042621 Bacteria 1384
137 Ga0466735_086274 3300042624 Bacteria 9916
138 Ga0466735_155495 3300042624 Unclassified 1419
139 Ga0466703_152172 3300042636 Bacteria 1930
140 Ga0466703_170698 3300042636 Unclassified 1257
141 Ga0466704_430910 3300042643 Bacteria 1647
142 Ga0466708_262256 3300042652 Bacteria 8216
143 Ga0466727_124960 3300042655 Bacteria 13419
144 Ga0466692_149299 3300042591 Bacteria 2004
145 Ga0466695_148905 3300042595 Bacteria 1122
146 Ga0466705_076961 3300042612 Bacteria 4515
147 Ga0466726_052804 3300042619 Bacteria 9565
148 Ga0466719_005683 3300042606 Bacteria 1278
149 Ga0466719_517098 3300042606 Bacteria 2194
150 Ga0466698_305203 3300042610 Bacteria 4643
151 Ga0123357_10565058 3300009784 Unclassified 897
152 Ga0123354_10023484 3300010882 Bacteria 9726
153 Ga0123354_10075983 3300010882 Bacteria 4800
154 2227609068 2225789004 Unclassified 2275
155 JGI24705J35276_12144089 3300002504 Unclassified 1153
156 JGI24696J40584_12805258 3300002834 Unclassified 877
157 Ga0123357_10000445 3300009784 Bacteria 39844
158 Ga0466725_452838 3300042654 Unclassified 1169
159 Ga0466690_076723 3300042590 Bacteria 4233
160 Ga0466692_004086 3300042591 Bacteria 2193
161 Ga0466696_116206 3300042596 Bacteria 18134
162 Ga0466711_338813 3300042615 Bacteria 6690
163 Ga0466715_638688 3300042616 Bacteria 40279
164 Ga0466726_420825 3300042619 Bacteria 2827
165 Ga0466701_083415 3300042598 Bacteria 1563
166 Ga0466700_074515 3300042600 Bacteria 4295
167 Ga0466700_198900 3300042600 Bacteria 10295
168 Ga0466707_112997 3300042601 Bacteria 12374
169 Ga0466722_203823 3300042609 Bacteria 26562
170 Ga0123357_10285371 3300009784 Bacteria 1697
171 Ga0123356_12337418 3300010049 Bacteria 669
172 Ga0123353_10109964 3300010167 Bacteria 4440
173 Ga0123353_10500910 3300010167 Bacteria 1770
174 JGI24699J35502_11134014 3300002509 Bacteria 24334
175 Ga0068305_11097550 3300005083 Unclassified 646
176 Ga0123357_10000970 3300009784 Bacteria 29214
177 Ga0466735_038856 3300042624 Bacteria 1704
178 Ga0466735_065196 3300042624 Bacteria 1429
179 Ga0466703_073309 3300042636 Bacteria 8476
180 Ga0466703_236632 3300042636 Bacteria 1655
181 Ga0466727_142888 3300042655 Unclassified 3793
182 Ga0466691_161179 3300042593 Unclassified 1082
183 Ga0466696_455845 3300042596 Bacteria 2347

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042599 Ga0466706_218899 Ga0466706_218899_1871_2155 94
2 3300042636 Ga0466703_152172 Ga0466703_152172_1631_1915 94
3 3300042643 Ga0466704_286775 Ga0466704_286775_902_1186 94
4 3300042643 Ga0466704_621886 Ga0466704_621886_19520_19804 94
5 3300042652 Ga0466708_139920 Ga0466708_139920_22978_23262 94
6 3300000062 IMNBL1DRAFT_c0133489 IMNBL1DRAFT_01334891 95
7 3300002834 JGI24696J40584_12959802 JGI24696J40584_129598022 95
8 3300042591 Ga0466692_149299 Ga0466692_149299_1553_1840 95
9 3300042601 Ga0466707_278974 Ga0466707_278974_888_1175 95
10 3300042606 Ga0466719_005683 Ga0466719_005683_391_678 95
11 3300042606 Ga0466719_572882 Ga0466719_572882_338_625 95
12 3300042616 Ga0466715_489251 Ga0466715_489251_2033_2320 95
13 3300042624 Ga0466735_100553 Ga0466735_100553_388_675 95
14 3300042624 Ga0466735_133735 Ga0466735_133735_8206_8493 95
15 3300042654 Ga0466725_452838 Ga0466725_452838_842_1129 95
16 iso_pr_bacteria 2967483437 2967486919 95
17 2225789004 2227350224 2227795810 96
18 2225789004 2227467693 2227908972 96
19 2225789004 2227609068 2228179811 96
20 3300000062 IMNBL1DRAFT_c0078174 IMNBL1DRAFT_00781742 96
21 3300042591 Ga0466692_026125 Ga0466692_026125_4825_5115 96
22 3300042591 Ga0466692_058282 Ga0466692_058282_105_395 96
23 3300042591 Ga0466692_085363 Ga0466692_085363_469_759 96
24 3300042593 Ga0466691_067196 Ga0466691_067196_4913_5203 96
25 3300042593 Ga0466691_161179 Ga0466691_161179_651_941 96
26 3300042599 Ga0466706_055305 Ga0466706_055305_309_599 96
27 3300042601 Ga0466707_013976 Ga0466707_013976_905_1195 96
28 3300042601 Ga0466707_112997 Ga0466707_112997_4130_4420 96
29 3300042601 Ga0466707_149826 Ga0466707_149826_245_535 96
30 3300042601 Ga0466707_420065 Ga0466707_420065_1024_1314 96
31 3300042602 Ga0466713_088520 Ga0466713_088520_22062_22352 96
32 3300042606 Ga0466719_004777 Ga0466719_004777_12151_12441 96
33 3300042606 Ga0466719_076842 Ga0466719_076842_1923_2213 96
34 3300042606 Ga0466719_211662 Ga0466719_211662_267_557 96
35 3300042609 Ga0466722_036237 Ga0466722_036237_3296_3586 96
36 3300042609 Ga0466722_203823 Ga0466722_203823_17432_17722 96
37 3300042610 Ga0466698_400083 Ga0466698_400083_559_849 96
38 3300042612 Ga0466705_058615 Ga0466705_058615_8687_8977 96
39 3300042612 Ga0466705_413942 Ga0466705_413942_254_544 96
40 3300042615 Ga0466711_198868 Ga0466711_198868_2512_2802 96
41 3300042616 Ga0466715_054289 Ga0466715_054289_8730_9020 96
42 3300042616 Ga0466715_159912 Ga0466715_159912_532_822 96
43 3300042618 Ga0466723_042046 Ga0466723_042046_43_333 96
44 3300042618 Ga0466723_190362 Ga0466723_190362_478_768 96
45 3300042619 Ga0466726_046595 Ga0466726_046595_3973_4263 96
46 3300042619 Ga0466726_052804 Ga0466726_052804_7452_7742 96
47 3300042620 Ga0466728_183471 Ga0466728_183471_1698_1988 96
48 3300042620 Ga0466728_392041 Ga0466728_392041_889_1179 96
49 3300042621 Ga0466729_107829 Ga0466729_107829_1373_1663 96
50 3300042621 Ga0466729_228912 Ga0466729_228912_233_523 96
51 3300042621 Ga0466729_268762 Ga0466729_268762_952_1242 96
52 3300042621 Ga0466729_282254 Ga0466729_282254_106_396 96
53 3300042624 Ga0466735_022443 Ga0466735_022443_2449_2739 96
54 3300042624 Ga0466735_038856 Ga0466735_038856_1391_1681 96
55 3300042624 Ga0466735_086274 Ga0466735_086274_5746_6036 96
56 3300042624 Ga0466735_155495 Ga0466735_155495_944_1234 96
57 3300042636 Ga0466703_073309 Ga0466703_073309_6373_6663 96
58 3300042636 Ga0466703_085557 Ga0466703_085557_297_587 96
59 3300042636 Ga0466703_170698 Ga0466703_170698_97_387 96
60 3300042636 Ga0466703_176373 Ga0466703_176373_7411_7701 96
61 3300042636 Ga0466703_254927 Ga0466703_254927_297_587 96
62 3300042636 Ga0466703_281365 Ga0466703_281365_6657_6947 96
63 3300042643 Ga0466704_007516 Ga0466704_007516_10937_11227 96
64 3300042643 Ga0466704_075296 Ga0466704_075296_30879_31169 96
65 3300042643 Ga0466704_430910 Ga0466704_430910_525_815 96
66 3300042643 Ga0466704_456552 Ga0466704_456552_2201_2491 96
67 3300042643 Ga0466704_586799 Ga0466704_586799_7264_7554 96
68 3300042648 Ga0466709_096114 Ga0466709_096114_1162_1452 96
69 3300042652 Ga0466708_262256 Ga0466708_262256_5168_5458 96
70 3300042655 Ga0466727_085133 Ga0466727_085133_7415_7705 96
71 3300042655 Ga0466727_142888 Ga0466727_142888_2671_2961 96
72 3300042655 Ga0466727_179474 Ga0466727_179474_1113_1403 96
73 3300042655 Ga0466727_308046 Ga0466727_308046_3853_4143 96
74 iso_pr_bacteria 2940216256 2940216945 96
75 3300000062 IMNBL1DRAFT_c0000966 IMNBL1DRAFT_00009667 97
76 3300000062 IMNBL1DRAFT_c0004165 IMNBL1DRAFT_00041654 97
77 3300002462 JGI24702J35022_10005841 JGI24702J35022_100058415 97
78 3300005083 Ga0068305_11097550 Ga0068305_110975501 97
79 3300009784 Ga0123357_10002416 Ga0123357_100024164 97
80 3300010049 Ga0123356_12337418 Ga0123356_123374181 97
81 3300010882 Ga0123354_10102465 Ga0123354_101024654 97
82 3300010882 Ga0123354_10351499 Ga0123354_103514992 97
83 3300042550 Ga0466656_019025 Ga0466656_019025_395_688 97
84 3300042590 Ga0466690_026988 Ga0466690_026988_6361_6654 97
85 3300042590 Ga0466690_176257 Ga0466690_176257_4588_4881 97
86 3300042591 Ga0466692_008016 Ga0466692_008016_14247_14540 97
87 3300042593 Ga0466691_100249 Ga0466691_100249_1240_1533 97
88 3300042594 Ga0466694_292983 Ga0466694_292983_169_462 97
89 3300042596 Ga0466696_116206 Ga0466696_116206_15757_16050 97
90 3300042596 Ga0466696_328182 Ga0466696_328182_114_407 97
91 3300042596 Ga0466696_466996 Ga0466696_466996_257_550 97
92 3300042598 Ga0466701_036031 Ga0466701_036031_898_1191 97
93 3300042598 Ga0466701_083415 Ga0466701_083415_650_943 97
94 3300042598 Ga0466701_088409 Ga0466701_088409_23913_24206 97
95 3300042600 Ga0466700_054481 Ga0466700_054481_6523_6816 97
96 3300042600 Ga0466700_074515 Ga0466700_074515_1611_1904 97
97 3300042600 Ga0466700_198900 Ga0466700_198900_7437_7730 97
98 3300042601 Ga0466707_189059 Ga0466707_189059_1438_1731 97
99 3300042602 Ga0466713_077457 Ga0466713_077457_1116_1409 97
100 3300042604 Ga0466717_195832 Ga0466717_195832_935_1228 97
101 3300042605 Ga0466716_144281 Ga0466716_144281_6489_6782 97
102 3300042605 Ga0466716_162458 Ga0466716_162458_1177_1470 97
103 3300042605 Ga0466716_378206 Ga0466716_378206_1819_2112 97
104 3300042606 Ga0466719_517098 Ga0466719_517098_435_728 97
105 3300042609 Ga0466722_243730 Ga0466722_243730_3624_3917 97
106 3300042610 Ga0466698_305203 Ga0466698_305203_293_586 97
107 3300042612 Ga0466705_522885 Ga0466705_522885_510_803 97
108 3300042613 Ga0466710_127284 Ga0466710_127284_1284_1577 97
109 3300042615 Ga0466711_221387 Ga0466711_221387_2315_2608 97
110 3300042615 Ga0466711_338813 Ga0466711_338813_2060_2353 97
111 3300042616 Ga0466715_105177 Ga0466715_105177_4037_4330 97
112 3300042616 Ga0466715_459299 Ga0466715_459299_7048_7341 97
113 3300042619 Ga0466726_088483 Ga0466726_088483_1182_1475 97
114 3300042621 Ga0466729_106378 Ga0466729_106378_1202_1495 97
115 3300042624 Ga0466735_023200 Ga0466735_023200_1201_1494 97
116 3300042624 Ga0466735_120532 Ga0466735_120532_1497_1790 97
117 3300042624 Ga0466735_158546 Ga0466735_158546_698_991 97
118 3300042624 Ga0466735_169333 Ga0466735_169333_740_1033 97
119 3300042636 Ga0466703_236632 Ga0466703_236632_1320_1613 97
120 3300042643 Ga0466704_454748 Ga0466704_454748_3202_3495 97
121 iso_pr_bacteria 2820759988 2820760739 97
122 iso_pr_bacteria 2820762746 2820763778 97
123 3300000062 IMNBL1DRAFT_c0002915 IMNBL1DRAFT_000291510 98
124 3300000062 IMNBL1DRAFT_c0009166 IMNBL1DRAFT_00091662 98
125 3300002462 JGI24702J35022_10005850 JGI24702J35022_100058504 98
126 3300002462 JGI24702J35022_10153821 JGI24702J35022_101538211 98
127 3300002504 JGI24705J35276_11502209 JGI24705J35276_115022091 98
128 3300002504 JGI24705J35276_11743043 JGI24705J35276_117430431 98
129 3300002504 JGI24705J35276_12144089 JGI24705J35276_121440892 98
130 3300002504 JGI24705J35276_12229766 JGI24705J35276_122297665 98
131 3300002509 JGI24699J35502_11133651 JGI24699J35502_111336513 98
132 3300002509 JGI24699J35502_11134014 JGI24699J35502_111340145 98
133 3300002509 JGI24699J35502_11134120 JGI24699J35502_1113412013 98
134 3300002834 JGI24696J40584_12805258 JGI24696J40584_128052581 98
135 3300002834 JGI24696J40584_12905166 JGI24696J40584_129051662 98
136 3300005083 Ga0068305_10350063 Ga0068305_103500632 98
137 3300009784 Ga0123357_10000970 Ga0123357_1000097013 98
138 3300009784 Ga0123357_10010185 Ga0123357_1001018512 98
139 3300009784 Ga0123357_10017697 Ga0123357_100176978 98
140 3300009784 Ga0123357_10038580 Ga0123357_100385804 98
141 3300009784 Ga0123357_10088628 Ga0123357_100886284 98
142 3300009784 Ga0123357_10225876 Ga0123357_102258762 98
143 3300009784 Ga0123357_10284138 Ga0123357_102841383 98
144 3300009784 Ga0123357_10285371 Ga0123357_102853712 98
145 3300009784 Ga0123357_10293511 Ga0123357_102935112 98
146 3300009784 Ga0123357_10565058 Ga0123357_105650582 98
147 3300009826 Ga0123355_11785929 Ga0123355_117859291 98
148 3300010049 Ga0123356_11405079 Ga0123356_114050792 98
149 3300010167 Ga0123353_10500910 Ga0123353_105009102 98
150 3300010882 Ga0123354_10000201 Ga0123354_1000020112 98
151 3300010882 Ga0123354_10002288 Ga0123354_100022888 98
152 3300010882 Ga0123354_10004885 Ga0123354_100048858 98
153 3300010882 Ga0123354_10023484 Ga0123354_100234844 98
154 3300010882 Ga0123354_10075983 Ga0123354_100759834 98
155 3300010882 Ga0123354_10134603 Ga0123354_101346033 98
156 3300010882 Ga0123354_10728467 Ga0123354_107284672 98
157 3300042590 Ga0466690_076723 Ga0466690_076723_3820_4116 98
158 3300042591 Ga0466692_004086 Ga0466692_004086_1359_1655 98
159 3300042591 Ga0466692_178028 Ga0466692_178028_24934_25230 98
160 3300042596 Ga0466696_455845 Ga0466696_455845_319_615 98
161 3300042598 Ga0466701_017652 Ga0466701_017652_6900_7196 98
162 3300042601 Ga0466707_146418 Ga0466707_146418_25533_25829 98
163 3300042601 Ga0466707_317775 Ga0466707_317775_1516_1812 98
164 3300042601 Ga0466707_338142 Ga0466707_338142_15778_16074 98
165 3300042602 Ga0466713_007766 Ga0466713_007766_21365_21661 98
166 3300042606 Ga0466719_423267 Ga0466719_423267_7757_8053 98
167 3300042616 Ga0466715_638688 Ga0466715_638688_27711_28007 98
168 3300042619 Ga0466726_420825 Ga0466726_420825_2176_2472 98
169 3300042624 Ga0466735_113157 Ga0466735_113157_786_1082 98
170 3300042624 Ga0466735_213875 Ga0466735_213875_4492_4788 98
171 3300042636 Ga0466703_155626 Ga0466703_155626_221_517 98
172 3300042655 Ga0466727_124960 Ga0466727_124960_952_1248 98
173 3300042655 Ga0466727_290402 Ga0466727_290402_22_318 98
174 3300000062 IMNBL1DRAFT_c0019820 IMNBL1DRAFT_00198202 99
175 3300000062 IMNBL1DRAFT_c0078592 IMNBL1DRAFT_00785921 99
176 3300042595 Ga0466695_148905 Ga0466695_148905_251_550 99
177 3300042611 Ga0466697_217332 Ga0466697_217332_1034_1333 99
178 3300042612 Ga0466705_076961 Ga0466705_076961_940_1239 99
179 3300042619 Ga0466726_080380 Ga0466726_080380_3163_3462 99
180 3300002462 JGI24702J35022_10338667 JGI24702J35022_103386672 101
181 3300009784 Ga0123357_10783839 Ga0123357_107838392 101
182 3300010882 Ga0123354_10108383 Ga0123354_101083833 101
183 3300010882 Ga0123354_10613296 Ga0123354_106132962 101
184 iso_pr_bacteria 2820778767 2820779347 101
185 3300009784 Ga0123357_10000445 Ga0123357_1000044521 102
186 3300042624 Ga0466735_065196 Ga0466735_065196_257_574 105
187 3300042590 Ga0466690_276223 Ga0466690_276223_199233_199556 107
188 3300010167 Ga0123353_10109964 Ga0123353_101099644 117

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00216 Bac_DNA_binding Bacterial DNA-binding protein 21 108 0.98
PF18291 HU-HIG HU domain fused to wHTH, Ig, or Glycine-rich motif 9 111 0.86

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.41 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.