Protein Family IF03117

Metagenome Isolate
118 Members
50 Samples
108 Scaffolds
211.13 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10081161|Ga0123353_100811614
Length
258 aa
Sequence
MTNKITNTVKEKTENIAYGYVFSARHFTNSNKMEHSMKLHTNKQDFNEPIRLDDYILNHIDEEPLLLANLYRDAHVRLLRPRMLSGHLQGRILKMLTRLHRPQRILEIGTYTGYATLCLAEALPENGEIHTIEKDDEMESFIREQFAASNLKDKIRLHIGDALEIIPQLEGNFDMVFIDADKRLYCEYYDLVFDKVNSGGVILADNTLWSEKVLETPLPSDKQTLGVLRFNEKIKQDKRIEKVILPLRDGLTIAFKL*

📊 Sample Types

Isolate 8.5%
Metagenome 91.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 29.2%
Termitidae 25.0%
Blattidae 14.6%
Unclassified 12.5%
Rhinotermitidae 8.3%
Termopsidae 4.2%
Passalidae 4.2%
Hodotermitidae 2.1%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
6 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
7 2940346213 Parabacteroides sp. PFB2-12 Isolate Blattidae
8 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
9 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2940195863 Parabacteroides sp. PF5-6 Isolate Blattidae
15 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
16 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
17 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
18 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
19 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
20 2940216256 Dysgonomonadaceae bacterium PH5-43 Isolate Blattidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2820759988 Unclassified Bacteroidetes Mp193P4bin4 Isolate Unclassified
24 2923982719 Parabacteroides sp. 52 Isolate Blattidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
29 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
30 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
31 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
32 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
33 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
34 2940199050 Parabacteroides sp. PM6-13 Isolate Blattidae
35 2940371297 Parabacteroides sp. PM5-20 Isolate Blattidae
36 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
40 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
41 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
42 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
43 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
44 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
45 643348524 Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 Isolate Unclassified
46 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
47 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
48 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 JGI24702J35022_10121337 3300002462 Bacteria 1444
2 Ga0072941_1208934 3300005201 Bacteria 1385
3 Ga0466735_168414 3300042624 Bacteria 5825
4 Ga0466735_207809 3300042624 Bacteria 1680
5 Ga0466703_085952 3300042636 Bacteria 2659
6 Ga0123353_10081161 3300010167 Bacteria 5215
7 Ga0123354_10053793 3300010882 Bacteria 6050
8 Ga0466706_221770 3300042599 Bacteria 1636
9 Ga0466713_054900 3300042602 Bacteria 8815
10 Ga0466716_240490 3300042605 Bacteria 4881
11 Ga0466719_110199 3300042606 Bacteria 1444
12 Ga0466690_169422 3300042590 Bacteria 39612
13 Ga0466692_188827 3300042591 Bacteria 9696
14 JGI24702J35022_10013454 3300002462 Bacteria 4533
15 Ga0466735_092198 3300042624 Bacteria 1606
16 Ga0466703_313230 3300042636 Bacteria 4151
17 Ga0123356_10013360 3300010049 Bacteria 7930
18 Ga0466719_043916 3300042606 Bacteria 13096
19 Ga0466722_236000 3300042609 Bacteria 13600
20 Ga0466711_010122 3300042615 Bacteria 10089
21 Ga0466711_020407 3300042615 Bacteria 13395
22 Ga0466715_065085 3300042616 Bacteria 11433
23 Ga0466715_368883 3300042616 Bacteria 6573
24 Ga0466729_005098 3300042621 Bacteria 4217
25 Ga0466733_165078 3300042659 Bacteria 1767
26 JGI24699J35502_11134178 3300002509 Bacteria 45574
27 JGI24696J40584_12912167 3300002834 Bacteria 1265
28 Ga0466735_017882 3300042624 Bacteria 3589
29 Ga0466735_102106 3300042624 Unclassified 3365
30 Ga0466704_215539 3300042643 Bacteria 27907
31 Ga0123354_10193996 3300010882 Bacteria 2262
32 Ga0466711_394252 3300042615 Bacteria 3597
33 Ga0466691_004536 3300042593 Bacteria 19096
34 2227546847 2225789004 Bacteria 15276
35 JGI24702J35022_10002868 3300002462 Bacteria 10441
36 JGI24702J35022_10011304 3300002462 Bacteria 4977
37 JGI24696J40584_12877553 3300002834 Bacteria 1071
38 JGI24696J40584_12946009 3300002834 Bacteria 1878
39 Ga0466735_001596 3300042624 Unclassified 2622
40 Ga0466703_142432 3300042636 Bacteria 5786
41 Ga0466709_368385 3300042648 Bacteria 5187
42 Ga0123354_10020086 3300010882 Bacteria 10502
43 Ga0466700_025319 3300042600 Bacteria 13456
44 Ga0466707_085817 3300042601 Bacteria 16403
45 Ga0466722_236076 3300042609 Bacteria 1948
46 Ga0466705_398599 3300042612 Bacteria 3625
47 Ga0466711_143723 3300042615 Bacteria 4753
48 Ga0466726_301342 3300042619 Bacteria 1863
49 Ga0466729_102152 3300042621 Bacteria 10671
50 Ga0466690_088162 3300042590 Bacteria 14458
51 Ga0466692_043899 3300042591 Bacteria 67267
52 Ga0466696_019536 3300042596 Bacteria 48880
53 2227498523 2225789004 Bacteria 3867
54 IMNBL1DRAFT_c0000189 3300000062 Bacteria 53989
55 IMNBL1DRAFT_c0001983 3300000062 Bacteria 14730
56 IMNBL1DRAFT_c0060448 3300000062 Bacteria 1141
57 JGI24696J40584_12941266 3300002834 Bacteria 1702
58 Ga0123357_10000231 3300009784 Bacteria 52963
59 Ga0466735_090702 3300042624 Bacteria 4512
60 Ga0466704_470753 3300042643 Bacteria 5076
61 Ga0123357_10006058 3300009784 Bacteria 14636
62 Ga0123354_10066490 3300010882 Bacteria 5263
63 Ga0466711_024937 3300042615 Bacteria 5121
64 Ga0466726_207128 3300042619 Bacteria 21053
65 Ga0466726_229999 3300042619 Bacteria 3044
66 Ga0466728_002139 3300042620 Bacteria 6111
67 IMNBL1DRAFT_c0005136 3300000062 Bacteria 7606
68 Ga0123357_10000751 3300009784 Bacteria 32682
69 Ga0466735_227714 3300042624 Bacteria 4837
70 Ga0466708_050717 3300042652 Bacteria 7469
71 Ga0123354_10001074 3300010882 Bacteria 31531
72 Ga0123354_10002668 3300010882 Bacteria 23860
73 Ga0466700_358297 3300042600 Bacteria 3451
74 Ga0466713_151148 3300042602 Bacteria 25657
75 Ga0466719_126433 3300042606 Bacteria 4736
76 Ga0466705_500678 3300042612 Bacteria 2444
77 Ga0466710_153644 3300042613 Bacteria 1592
78 Ga0466690_089085 3300042590 Bacteria 7131
79 Ga0466692_003304 3300042591 Bacteria 12683
80 Ga0466693_347512 3300042592 Bacteria 1370
81 JGI24699J35502_11133947 3300002509 Bacteria 20626
82 Ga0466729_223571 3300042621 Bacteria 1487
83 Ga0466735_011344 3300042624 Bacteria 2319
84 Ga0466704_294751 3300042643 Bacteria 11001
85 Ga0123357_10004577 3300009784 Bacteria 16283
86 Ga0123353_10683884 3300010167 Bacteria 1444
87 Ga0123354_10029953 3300010882 Bacteria 8553
88 Ga0123354_10090896 3300010882 Bacteria 4222
89 Ga0466700_126894 3300042600 Bacteria 6628
90 Ga0466707_026050 3300042601 Bacteria 15408
91 Ga0466707_097852 3300042601 Bacteria 26513
92 Ga0466722_122991 3300042609 Bacteria 9610
93 Ga0466715_210093 3300042616 Bacteria 20816
94 Ga0466715_390283 3300042616 Bacteria 9098
95 Ga0466723_227994 3300042618 Bacteria 16314
96 Ga0456237_0000027 3300041968 Bacteria 23204
97 IMNBL1DRAFT_c0005676 3300000062 Bacteria 7046
98 Ga0068305_10048001 3300005083 Unclassified 1428
99 Ga0068305_10106617 3300005083 Bacteria 7814
100 Ga0072941_1147571 3300005201 Bacteria 3799
101 Ga0466729_220003 3300042621 Bacteria 6346
102 Ga0466703_148257 3300042636 Bacteria 24506
103 Ga0123357_10114425 3300009784 Bacteria 3425
104 Ga0466713_101013 3300042602 Bacteria 25395
105 Ga0466723_088640 3300042618 Bacteria 27215
106 Ga0466726_014156 3300042619 Bacteria 4085
107 Ga0265387_1019154 3300024582 Bacteria 1008
108 Ga0466656_002889 3300042550 Bacteria 1181

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002509 JGI24699J35502_11134178 JGI24699J35502_1113417823 207
2 3300005083 Ga0068305_10106617 Ga0068305_101066178 207
3 3300009784 Ga0123357_10114425 Ga0123357_101144254 207
4 3300024582 Ga0265387_1019154 Ga0265387_10191542 208
5 3300042550 Ga0466656_002889 Ga0466656_002889_525_1151 208
6 3300042590 Ga0466690_088162 Ga0466690_088162_7724_8350 208
7 3300042590 Ga0466690_169422 Ga0466690_169422_27605_28231 208
8 3300042591 Ga0466692_003304 Ga0466692_003304_7676_8302 208
9 3300042591 Ga0466692_188827 Ga0466692_188827_7138_7764 208
10 3300042592 Ga0466693_347512 Ga0466693_347512_723_1349 208
11 3300042600 Ga0466700_025319 Ga0466700_025319_4217_4843 208
12 3300042600 Ga0466700_126894 Ga0466700_126894_1549_2175 208
13 3300042600 Ga0466700_358297 Ga0466700_358297_2180_2806 208
14 3300042601 Ga0466707_026050 Ga0466707_026050_4338_4964 208
15 3300042601 Ga0466707_085817 Ga0466707_085817_2379_3005 208
16 3300042602 Ga0466713_054900 Ga0466713_054900_7906_8532 208
17 3300042606 Ga0466719_043916 Ga0466719_043916_10918_11544 208
18 3300042606 Ga0466719_110199 Ga0466719_110199_385_1011 208
19 3300042606 Ga0466719_126433 Ga0466719_126433_2379_3005 208
20 3300042609 Ga0466722_122991 Ga0466722_122991_7622_8248 208
21 3300042609 Ga0466722_236000 Ga0466722_236000_3495_4121 208
22 3300042613 Ga0466710_153644 Ga0466710_153644_228_854 208
23 3300042615 Ga0466711_024937 Ga0466711_024937_3875_4501 208
24 3300042615 Ga0466711_394252 Ga0466711_394252_1446_2072 208
25 3300042616 Ga0466715_065085 Ga0466715_065085_1478_2104 208
26 3300042616 Ga0466715_210093 Ga0466715_210093_11234_11860 208
27 3300042616 Ga0466715_368883 Ga0466715_368883_1172_1798 208
28 3300042619 Ga0466726_229999 Ga0466726_229999_1469_2095 208
29 3300042620 Ga0466728_002139 Ga0466728_002139_382_1008 208
30 3300042621 Ga0466729_005098 Ga0466729_005098_579_1205 208
31 3300042621 Ga0466729_220003 Ga0466729_220003_3004_3630 208
32 3300042621 Ga0466729_223571 Ga0466729_223571_563_1189 208
33 3300042624 Ga0466735_011344 Ga0466735_011344_1079_1705 208
34 3300042624 Ga0466735_168414 Ga0466735_168414_499_1125 208
35 3300042636 Ga0466703_085952 Ga0466703_085952_978_1604 208
36 3300042636 Ga0466703_142432 Ga0466703_142432_3177_3803 208
37 3300042636 Ga0466703_313230 Ga0466703_313230_642_1268 208
38 3300042643 Ga0466704_215539 Ga0466704_215539_20845_21471 208
39 3300042643 Ga0466704_470753 Ga0466704_470753_587_1213 208
40 3300042648 Ga0466709_368385 Ga0466709_368385_2532_3158 208
41 3300042652 Ga0466708_050717 Ga0466708_050717_5283_5909 208
42 iso_pr_bacteria 2820759988 2820760466 208
43 iso_pr_bacteria 2923982719 2923983875 208
44 iso_pr_bacteria 2940195863 2940198389 208
45 iso_pr_bacteria 2940199050 2940201301 208
46 iso_pr_bacteria 2940209341 2940212033 208
47 iso_pr_bacteria 2940346213 2940347568 208
48 iso_pr_bacteria 2940371297 2940373527 208
49 3300000062 IMNBL1DRAFT_c0000189 IMNBL1DRAFT_000018945 209
50 3300002462 JGI24702J35022_10011304 JGI24702J35022_100113045 209
51 3300002462 JGI24702J35022_10013454 JGI24702J35022_100134543 209
52 3300002509 JGI24699J35502_11133947 JGI24699J35502_111339473 209
53 3300002834 JGI24696J40584_12877553 JGI24696J40584_128775531 209
54 3300002834 JGI24696J40584_12912167 JGI24696J40584_129121672 209
55 3300002834 JGI24696J40584_12941266 JGI24696J40584_129412661 209
56 3300005201 Ga0072941_1147571 Ga0072941_11475713 209
57 3300005201 Ga0072941_1208934 Ga0072941_12089342 209
58 3300009784 Ga0123357_10000751 Ga0123357_1000075114 209
59 3300010167 Ga0123353_10683884 Ga0123353_106838842 209
60 3300010882 Ga0123354_10001074 Ga0123354_1000107416 209
61 3300010882 Ga0123354_10002668 Ga0123354_100026683 209
62 3300010882 Ga0123354_10053793 Ga0123354_100537933 209
63 3300010882 Ga0123354_10090896 Ga0123354_100908963 209
64 3300010882 Ga0123354_10193996 Ga0123354_101939963 209
65 3300041968 Ga0456237_0000027 Ga0456237_0000027_8888_9517 209
66 3300042599 Ga0466706_221770 Ga0466706_221770_368_997 209
67 3300042602 Ga0466713_101013 Ga0466713_101013_21620_22249 209
68 3300042615 Ga0466711_143723 Ga0466711_143723_2245_2874 209
69 iso_pr_bacteria 643348524 643422970 209
70 3300009784 Ga0123357_10006058 Ga0123357_100060586 210
71 3300010882 Ga0123354_10020086 Ga0123354_1002008610 210
72 3300010882 Ga0123354_10029953 Ga0123354_100299534 210
73 3300010882 Ga0123354_10066490 Ga0123354_100664903 210
74 3300042602 Ga0466713_151148 Ga0466713_151148_5307_5939 210
75 3300042605 Ga0466716_240490 Ga0466716_240490_1592_2224 210
76 3300042612 Ga0466705_500678 Ga0466705_500678_131_763 210
77 3300042619 Ga0466726_207128 Ga0466726_207128_5299_5931 210
78 3300042624 Ga0466735_207809 Ga0466735_207809_753_1385 210
79 3300042636 Ga0466703_148257 Ga0466703_148257_18204_18836 210
80 3300042643 Ga0466704_294751 Ga0466704_294751_2782_3414 210
81 3300000062 IMNBL1DRAFT_c0060448 IMNBL1DRAFT_00604481 211
82 3300005083 Ga0068305_10048001 Ga0068305_100480012 211
83 3300042591 Ga0466692_043899 Ga0466692_043899_63684_64319 211
84 3300042615 Ga0466711_010122 Ga0466711_010122_4912_5547 211
85 3300042621 Ga0466729_102152 Ga0466729_102152_2183_2818 211
86 3300042659 Ga0466733_165078 Ga0466733_165078_1087_1722 211
87 3300000062 IMNBL1DRAFT_c0005676 IMNBL1DRAFT_00056763 212
88 3300042593 Ga0466691_004536 Ga0466691_004536_14429_15067 212
89 3300042596 Ga0466696_019536 Ga0466696_019536_9029_9667 212
90 3300042616 Ga0466715_390283 Ga0466715_390283_3903_4541 212
91 3300042619 Ga0466726_014156 Ga0466726_014156_3226_3864 212
92 3300042619 Ga0466726_301342 Ga0466726_301342_337_975 212
93 3300042624 Ga0466735_092198 Ga0466735_092198_673_1311 212
94 iso_pr_bacteria 2940216256 2940217727 212
95 3300042590 Ga0466690_089085 Ga0466690_089085_1965_2606 213
96 3300042601 Ga0466707_097852 Ga0466707_097852_8647_9288 213
97 2225789004 2227498523 2227978509 214
98 2225789004 2227546847 2228073060 214
99 3300000062 IMNBL1DRAFT_c0001983 IMNBL1DRAFT_00019839 214
100 3300002462 JGI24702J35022_10002868 JGI24702J35022_100028686 214
101 3300042612 Ga0466705_398599 Ga0466705_398599_1157_1801 214
102 3300042624 Ga0466735_090702 Ga0466735_090702_1916_2560 214
103 3300042624 Ga0466735_227714 Ga0466735_227714_1248_1892 214
104 iso_pr_bacteria 2967483437 2967484991 214
105 3300000062 IMNBL1DRAFT_c0005136 IMNBL1DRAFT_00051367 215
106 3300002834 JGI24696J40584_12946009 JGI24696J40584_129460092 215
107 3300042609 Ga0466722_236076 Ga0466722_236076_506_1156 216
108 3300042624 Ga0466735_017882 Ga0466735_017882_204_854 216
109 3300042624 Ga0466735_102106 Ga0466735_102106_1169_1819 216
110 3300042618 Ga0466723_227994 Ga0466723_227994_10253_10906 217
111 3300042618 Ga0466723_088640 Ga0466723_088640_4006_4662 218
112 3300009784 Ga0123357_10000231 Ga0123357_1000023129 222
113 3300010049 Ga0123356_10013360 Ga0123356_100133608 223
114 3300042615 Ga0466711_020407 Ga0466711_020407_2455_3135 226
115 3300002462 JGI24702J35022_10121337 JGI24702J35022_101213371 230
116 3300042624 Ga0466735_001596 Ga0466735_001596_1285_1977 230
117 3300009784 Ga0123357_10004577 Ga0123357_1000457712 231
118 3300010167 Ga0123353_10081161 Ga0123353_100811614 258

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13578 Methyltransf_24 Methyltransferase domain 106 206 0.93
PF13649 Methyltransf_25 Methyltransferase domain 105 178 0.93
PF01596 Methyltransf_3 O-methyltransferase 62 256 0.92
PF13847 Methyltransf_31 Methyltransferase domain 103 206 0.84
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 85 168 0.83

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01596 GO:0008171 O-methyltransferase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.86 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.