Protein Family IF03117
Metagenome
Isolate
118
Members
50
Samples
108
Scaffolds
211.13
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10081161|Ga0123353_100811614
- Length
- 258 aa
- Sequence
- MTNKITNTVKEKTENIAYGYVFSARHFTNSNKMEHSMKLHTNKQDFNEPIRLDDYILNHIDEEPLLLANLYRDAHVRLLRPRMLSGHLQGRILKMLTRLHRPQRILEIGTYTGYATLCLAEALPENGEIHTIEKDDEMESFIREQFAASNLKDKIRLHIGDALEIIPQLEGNFDMVFIDADKRLYCEYYDLVFDKVNSGGVILADNTLWSEKVLETPLPSDKQTLGVLRFNEKIKQDKRIEKVILPLRDGLTIAFKL*
Sample Types
Isolate
8.5%
Metagenome
91.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
29.2%
Termitidae
25.0%
Blattidae
14.6%
Unclassified
12.5%
Rhinotermitidae
8.3%
Termopsidae
4.2%
Passalidae
4.2%
Hodotermitidae
2.1%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 4 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 5 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 8 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 9 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 14 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 15 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 24 | 2923982719 | Parabacteroides sp. 52 | Isolate | Blattidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 29 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 30 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 34 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 35 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 36 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 37 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 40 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 41 | 3300024582 | Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 | Metagenome | |
| 42 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 43 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 44 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 45 | 643348524 | Candidatus Azobacteroides pseudotrichonymphae gv. CFP2 | Isolate | Unclassified |
| 46 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 47 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24702J35022_10121337 | 3300002462 | Bacteria | 1444 |
| 2 | Ga0072941_1208934 | 3300005201 | Bacteria | 1385 |
| 3 | Ga0466735_168414 | 3300042624 | Bacteria | 5825 |
| 4 | Ga0466735_207809 | 3300042624 | Bacteria | 1680 |
| 5 | Ga0466703_085952 | 3300042636 | Bacteria | 2659 |
| 6 | Ga0123353_10081161 | 3300010167 | Bacteria | 5215 |
| 7 | Ga0123354_10053793 | 3300010882 | Bacteria | 6050 |
| 8 | Ga0466706_221770 | 3300042599 | Bacteria | 1636 |
| 9 | Ga0466713_054900 | 3300042602 | Bacteria | 8815 |
| 10 | Ga0466716_240490 | 3300042605 | Bacteria | 4881 |
| 11 | Ga0466719_110199 | 3300042606 | Bacteria | 1444 |
| 12 | Ga0466690_169422 | 3300042590 | Bacteria | 39612 |
| 13 | Ga0466692_188827 | 3300042591 | Bacteria | 9696 |
| 14 | JGI24702J35022_10013454 | 3300002462 | Bacteria | 4533 |
| 15 | Ga0466735_092198 | 3300042624 | Bacteria | 1606 |
| 16 | Ga0466703_313230 | 3300042636 | Bacteria | 4151 |
| 17 | Ga0123356_10013360 | 3300010049 | Bacteria | 7930 |
| 18 | Ga0466719_043916 | 3300042606 | Bacteria | 13096 |
| 19 | Ga0466722_236000 | 3300042609 | Bacteria | 13600 |
| 20 | Ga0466711_010122 | 3300042615 | Bacteria | 10089 |
| 21 | Ga0466711_020407 | 3300042615 | Bacteria | 13395 |
| 22 | Ga0466715_065085 | 3300042616 | Bacteria | 11433 |
| 23 | Ga0466715_368883 | 3300042616 | Bacteria | 6573 |
| 24 | Ga0466729_005098 | 3300042621 | Bacteria | 4217 |
| 25 | Ga0466733_165078 | 3300042659 | Bacteria | 1767 |
| 26 | JGI24699J35502_11134178 | 3300002509 | Bacteria | 45574 |
| 27 | JGI24696J40584_12912167 | 3300002834 | Bacteria | 1265 |
| 28 | Ga0466735_017882 | 3300042624 | Bacteria | 3589 |
| 29 | Ga0466735_102106 | 3300042624 | Unclassified | 3365 |
| 30 | Ga0466704_215539 | 3300042643 | Bacteria | 27907 |
| 31 | Ga0123354_10193996 | 3300010882 | Bacteria | 2262 |
| 32 | Ga0466711_394252 | 3300042615 | Bacteria | 3597 |
| 33 | Ga0466691_004536 | 3300042593 | Bacteria | 19096 |
| 34 | 2227546847 | 2225789004 | Bacteria | 15276 |
| 35 | JGI24702J35022_10002868 | 3300002462 | Bacteria | 10441 |
| 36 | JGI24702J35022_10011304 | 3300002462 | Bacteria | 4977 |
| 37 | JGI24696J40584_12877553 | 3300002834 | Bacteria | 1071 |
| 38 | JGI24696J40584_12946009 | 3300002834 | Bacteria | 1878 |
| 39 | Ga0466735_001596 | 3300042624 | Unclassified | 2622 |
| 40 | Ga0466703_142432 | 3300042636 | Bacteria | 5786 |
| 41 | Ga0466709_368385 | 3300042648 | Bacteria | 5187 |
| 42 | Ga0123354_10020086 | 3300010882 | Bacteria | 10502 |
| 43 | Ga0466700_025319 | 3300042600 | Bacteria | 13456 |
| 44 | Ga0466707_085817 | 3300042601 | Bacteria | 16403 |
| 45 | Ga0466722_236076 | 3300042609 | Bacteria | 1948 |
| 46 | Ga0466705_398599 | 3300042612 | Bacteria | 3625 |
| 47 | Ga0466711_143723 | 3300042615 | Bacteria | 4753 |
| 48 | Ga0466726_301342 | 3300042619 | Bacteria | 1863 |
| 49 | Ga0466729_102152 | 3300042621 | Bacteria | 10671 |
| 50 | Ga0466690_088162 | 3300042590 | Bacteria | 14458 |
| 51 | Ga0466692_043899 | 3300042591 | Bacteria | 67267 |
| 52 | Ga0466696_019536 | 3300042596 | Bacteria | 48880 |
| 53 | 2227498523 | 2225789004 | Bacteria | 3867 |
| 54 | IMNBL1DRAFT_c0000189 | 3300000062 | Bacteria | 53989 |
| 55 | IMNBL1DRAFT_c0001983 | 3300000062 | Bacteria | 14730 |
| 56 | IMNBL1DRAFT_c0060448 | 3300000062 | Bacteria | 1141 |
| 57 | JGI24696J40584_12941266 | 3300002834 | Bacteria | 1702 |
| 58 | Ga0123357_10000231 | 3300009784 | Bacteria | 52963 |
| 59 | Ga0466735_090702 | 3300042624 | Bacteria | 4512 |
| 60 | Ga0466704_470753 | 3300042643 | Bacteria | 5076 |
| 61 | Ga0123357_10006058 | 3300009784 | Bacteria | 14636 |
| 62 | Ga0123354_10066490 | 3300010882 | Bacteria | 5263 |
| 63 | Ga0466711_024937 | 3300042615 | Bacteria | 5121 |
| 64 | Ga0466726_207128 | 3300042619 | Bacteria | 21053 |
| 65 | Ga0466726_229999 | 3300042619 | Bacteria | 3044 |
| 66 | Ga0466728_002139 | 3300042620 | Bacteria | 6111 |
| 67 | IMNBL1DRAFT_c0005136 | 3300000062 | Bacteria | 7606 |
| 68 | Ga0123357_10000751 | 3300009784 | Bacteria | 32682 |
| 69 | Ga0466735_227714 | 3300042624 | Bacteria | 4837 |
| 70 | Ga0466708_050717 | 3300042652 | Bacteria | 7469 |
| 71 | Ga0123354_10001074 | 3300010882 | Bacteria | 31531 |
| 72 | Ga0123354_10002668 | 3300010882 | Bacteria | 23860 |
| 73 | Ga0466700_358297 | 3300042600 | Bacteria | 3451 |
| 74 | Ga0466713_151148 | 3300042602 | Bacteria | 25657 |
| 75 | Ga0466719_126433 | 3300042606 | Bacteria | 4736 |
| 76 | Ga0466705_500678 | 3300042612 | Bacteria | 2444 |
| 77 | Ga0466710_153644 | 3300042613 | Bacteria | 1592 |
| 78 | Ga0466690_089085 | 3300042590 | Bacteria | 7131 |
| 79 | Ga0466692_003304 | 3300042591 | Bacteria | 12683 |
| 80 | Ga0466693_347512 | 3300042592 | Bacteria | 1370 |
| 81 | JGI24699J35502_11133947 | 3300002509 | Bacteria | 20626 |
| 82 | Ga0466729_223571 | 3300042621 | Bacteria | 1487 |
| 83 | Ga0466735_011344 | 3300042624 | Bacteria | 2319 |
| 84 | Ga0466704_294751 | 3300042643 | Bacteria | 11001 |
| 85 | Ga0123357_10004577 | 3300009784 | Bacteria | 16283 |
| 86 | Ga0123353_10683884 | 3300010167 | Bacteria | 1444 |
| 87 | Ga0123354_10029953 | 3300010882 | Bacteria | 8553 |
| 88 | Ga0123354_10090896 | 3300010882 | Bacteria | 4222 |
| 89 | Ga0466700_126894 | 3300042600 | Bacteria | 6628 |
| 90 | Ga0466707_026050 | 3300042601 | Bacteria | 15408 |
| 91 | Ga0466707_097852 | 3300042601 | Bacteria | 26513 |
| 92 | Ga0466722_122991 | 3300042609 | Bacteria | 9610 |
| 93 | Ga0466715_210093 | 3300042616 | Bacteria | 20816 |
| 94 | Ga0466715_390283 | 3300042616 | Bacteria | 9098 |
| 95 | Ga0466723_227994 | 3300042618 | Bacteria | 16314 |
| 96 | Ga0456237_0000027 | 3300041968 | Bacteria | 23204 |
| 97 | IMNBL1DRAFT_c0005676 | 3300000062 | Bacteria | 7046 |
| 98 | Ga0068305_10048001 | 3300005083 | Unclassified | 1428 |
| 99 | Ga0068305_10106617 | 3300005083 | Bacteria | 7814 |
| 100 | Ga0072941_1147571 | 3300005201 | Bacteria | 3799 |
| 101 | Ga0466729_220003 | 3300042621 | Bacteria | 6346 |
| 102 | Ga0466703_148257 | 3300042636 | Bacteria | 24506 |
| 103 | Ga0123357_10114425 | 3300009784 | Bacteria | 3425 |
| 104 | Ga0466713_101013 | 3300042602 | Bacteria | 25395 |
| 105 | Ga0466723_088640 | 3300042618 | Bacteria | 27215 |
| 106 | Ga0466726_014156 | 3300042619 | Bacteria | 4085 |
| 107 | Ga0265387_1019154 | 3300024582 | Bacteria | 1008 |
| 108 | Ga0466656_002889 | 3300042550 | Bacteria | 1181 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002509 | JGI24699J35502_11134178 | JGI24699J35502_1113417823 | 207 |
| 2 | 3300005083 | Ga0068305_10106617 | Ga0068305_101066178 | 207 |
| 3 | 3300009784 | Ga0123357_10114425 | Ga0123357_101144254 | 207 |
| 4 | 3300024582 | Ga0265387_1019154 | Ga0265387_10191542 | 208 |
| 5 | 3300042550 | Ga0466656_002889 | Ga0466656_002889_525_1151 | 208 |
| 6 | 3300042590 | Ga0466690_088162 | Ga0466690_088162_7724_8350 | 208 |
| 7 | 3300042590 | Ga0466690_169422 | Ga0466690_169422_27605_28231 | 208 |
| 8 | 3300042591 | Ga0466692_003304 | Ga0466692_003304_7676_8302 | 208 |
| 9 | 3300042591 | Ga0466692_188827 | Ga0466692_188827_7138_7764 | 208 |
| 10 | 3300042592 | Ga0466693_347512 | Ga0466693_347512_723_1349 | 208 |
| 11 | 3300042600 | Ga0466700_025319 | Ga0466700_025319_4217_4843 | 208 |
| 12 | 3300042600 | Ga0466700_126894 | Ga0466700_126894_1549_2175 | 208 |
| 13 | 3300042600 | Ga0466700_358297 | Ga0466700_358297_2180_2806 | 208 |
| 14 | 3300042601 | Ga0466707_026050 | Ga0466707_026050_4338_4964 | 208 |
| 15 | 3300042601 | Ga0466707_085817 | Ga0466707_085817_2379_3005 | 208 |
| 16 | 3300042602 | Ga0466713_054900 | Ga0466713_054900_7906_8532 | 208 |
| 17 | 3300042606 | Ga0466719_043916 | Ga0466719_043916_10918_11544 | 208 |
| 18 | 3300042606 | Ga0466719_110199 | Ga0466719_110199_385_1011 | 208 |
| 19 | 3300042606 | Ga0466719_126433 | Ga0466719_126433_2379_3005 | 208 |
| 20 | 3300042609 | Ga0466722_122991 | Ga0466722_122991_7622_8248 | 208 |
| 21 | 3300042609 | Ga0466722_236000 | Ga0466722_236000_3495_4121 | 208 |
| 22 | 3300042613 | Ga0466710_153644 | Ga0466710_153644_228_854 | 208 |
| 23 | 3300042615 | Ga0466711_024937 | Ga0466711_024937_3875_4501 | 208 |
| 24 | 3300042615 | Ga0466711_394252 | Ga0466711_394252_1446_2072 | 208 |
| 25 | 3300042616 | Ga0466715_065085 | Ga0466715_065085_1478_2104 | 208 |
| 26 | 3300042616 | Ga0466715_210093 | Ga0466715_210093_11234_11860 | 208 |
| 27 | 3300042616 | Ga0466715_368883 | Ga0466715_368883_1172_1798 | 208 |
| 28 | 3300042619 | Ga0466726_229999 | Ga0466726_229999_1469_2095 | 208 |
| 29 | 3300042620 | Ga0466728_002139 | Ga0466728_002139_382_1008 | 208 |
| 30 | 3300042621 | Ga0466729_005098 | Ga0466729_005098_579_1205 | 208 |
| 31 | 3300042621 | Ga0466729_220003 | Ga0466729_220003_3004_3630 | 208 |
| 32 | 3300042621 | Ga0466729_223571 | Ga0466729_223571_563_1189 | 208 |
| 33 | 3300042624 | Ga0466735_011344 | Ga0466735_011344_1079_1705 | 208 |
| 34 | 3300042624 | Ga0466735_168414 | Ga0466735_168414_499_1125 | 208 |
| 35 | 3300042636 | Ga0466703_085952 | Ga0466703_085952_978_1604 | 208 |
| 36 | 3300042636 | Ga0466703_142432 | Ga0466703_142432_3177_3803 | 208 |
| 37 | 3300042636 | Ga0466703_313230 | Ga0466703_313230_642_1268 | 208 |
| 38 | 3300042643 | Ga0466704_215539 | Ga0466704_215539_20845_21471 | 208 |
| 39 | 3300042643 | Ga0466704_470753 | Ga0466704_470753_587_1213 | 208 |
| 40 | 3300042648 | Ga0466709_368385 | Ga0466709_368385_2532_3158 | 208 |
| 41 | 3300042652 | Ga0466708_050717 | Ga0466708_050717_5283_5909 | 208 |
| 42 | iso_pr_bacteria | 2820759988 | 2820760466 | 208 |
| 43 | iso_pr_bacteria | 2923982719 | 2923983875 | 208 |
| 44 | iso_pr_bacteria | 2940195863 | 2940198389 | 208 |
| 45 | iso_pr_bacteria | 2940199050 | 2940201301 | 208 |
| 46 | iso_pr_bacteria | 2940209341 | 2940212033 | 208 |
| 47 | iso_pr_bacteria | 2940346213 | 2940347568 | 208 |
| 48 | iso_pr_bacteria | 2940371297 | 2940373527 | 208 |
| 49 | 3300000062 | IMNBL1DRAFT_c0000189 | IMNBL1DRAFT_000018945 | 209 |
| 50 | 3300002462 | JGI24702J35022_10011304 | JGI24702J35022_100113045 | 209 |
| 51 | 3300002462 | JGI24702J35022_10013454 | JGI24702J35022_100134543 | 209 |
| 52 | 3300002509 | JGI24699J35502_11133947 | JGI24699J35502_111339473 | 209 |
| 53 | 3300002834 | JGI24696J40584_12877553 | JGI24696J40584_128775531 | 209 |
| 54 | 3300002834 | JGI24696J40584_12912167 | JGI24696J40584_129121672 | 209 |
| 55 | 3300002834 | JGI24696J40584_12941266 | JGI24696J40584_129412661 | 209 |
| 56 | 3300005201 | Ga0072941_1147571 | Ga0072941_11475713 | 209 |
| 57 | 3300005201 | Ga0072941_1208934 | Ga0072941_12089342 | 209 |
| 58 | 3300009784 | Ga0123357_10000751 | Ga0123357_1000075114 | 209 |
| 59 | 3300010167 | Ga0123353_10683884 | Ga0123353_106838842 | 209 |
| 60 | 3300010882 | Ga0123354_10001074 | Ga0123354_1000107416 | 209 |
| 61 | 3300010882 | Ga0123354_10002668 | Ga0123354_100026683 | 209 |
| 62 | 3300010882 | Ga0123354_10053793 | Ga0123354_100537933 | 209 |
| 63 | 3300010882 | Ga0123354_10090896 | Ga0123354_100908963 | 209 |
| 64 | 3300010882 | Ga0123354_10193996 | Ga0123354_101939963 | 209 |
| 65 | 3300041968 | Ga0456237_0000027 | Ga0456237_0000027_8888_9517 | 209 |
| 66 | 3300042599 | Ga0466706_221770 | Ga0466706_221770_368_997 | 209 |
| 67 | 3300042602 | Ga0466713_101013 | Ga0466713_101013_21620_22249 | 209 |
| 68 | 3300042615 | Ga0466711_143723 | Ga0466711_143723_2245_2874 | 209 |
| 69 | iso_pr_bacteria | 643348524 | 643422970 | 209 |
| 70 | 3300009784 | Ga0123357_10006058 | Ga0123357_100060586 | 210 |
| 71 | 3300010882 | Ga0123354_10020086 | Ga0123354_1002008610 | 210 |
| 72 | 3300010882 | Ga0123354_10029953 | Ga0123354_100299534 | 210 |
| 73 | 3300010882 | Ga0123354_10066490 | Ga0123354_100664903 | 210 |
| 74 | 3300042602 | Ga0466713_151148 | Ga0466713_151148_5307_5939 | 210 |
| 75 | 3300042605 | Ga0466716_240490 | Ga0466716_240490_1592_2224 | 210 |
| 76 | 3300042612 | Ga0466705_500678 | Ga0466705_500678_131_763 | 210 |
| 77 | 3300042619 | Ga0466726_207128 | Ga0466726_207128_5299_5931 | 210 |
| 78 | 3300042624 | Ga0466735_207809 | Ga0466735_207809_753_1385 | 210 |
| 79 | 3300042636 | Ga0466703_148257 | Ga0466703_148257_18204_18836 | 210 |
| 80 | 3300042643 | Ga0466704_294751 | Ga0466704_294751_2782_3414 | 210 |
| 81 | 3300000062 | IMNBL1DRAFT_c0060448 | IMNBL1DRAFT_00604481 | 211 |
| 82 | 3300005083 | Ga0068305_10048001 | Ga0068305_100480012 | 211 |
| 83 | 3300042591 | Ga0466692_043899 | Ga0466692_043899_63684_64319 | 211 |
| 84 | 3300042615 | Ga0466711_010122 | Ga0466711_010122_4912_5547 | 211 |
| 85 | 3300042621 | Ga0466729_102152 | Ga0466729_102152_2183_2818 | 211 |
| 86 | 3300042659 | Ga0466733_165078 | Ga0466733_165078_1087_1722 | 211 |
| 87 | 3300000062 | IMNBL1DRAFT_c0005676 | IMNBL1DRAFT_00056763 | 212 |
| 88 | 3300042593 | Ga0466691_004536 | Ga0466691_004536_14429_15067 | 212 |
| 89 | 3300042596 | Ga0466696_019536 | Ga0466696_019536_9029_9667 | 212 |
| 90 | 3300042616 | Ga0466715_390283 | Ga0466715_390283_3903_4541 | 212 |
| 91 | 3300042619 | Ga0466726_014156 | Ga0466726_014156_3226_3864 | 212 |
| 92 | 3300042619 | Ga0466726_301342 | Ga0466726_301342_337_975 | 212 |
| 93 | 3300042624 | Ga0466735_092198 | Ga0466735_092198_673_1311 | 212 |
| 94 | iso_pr_bacteria | 2940216256 | 2940217727 | 212 |
| 95 | 3300042590 | Ga0466690_089085 | Ga0466690_089085_1965_2606 | 213 |
| 96 | 3300042601 | Ga0466707_097852 | Ga0466707_097852_8647_9288 | 213 |
| 97 | 2225789004 | 2227498523 | 2227978509 | 214 |
| 98 | 2225789004 | 2227546847 | 2228073060 | 214 |
| 99 | 3300000062 | IMNBL1DRAFT_c0001983 | IMNBL1DRAFT_00019839 | 214 |
| 100 | 3300002462 | JGI24702J35022_10002868 | JGI24702J35022_100028686 | 214 |
| 101 | 3300042612 | Ga0466705_398599 | Ga0466705_398599_1157_1801 | 214 |
| 102 | 3300042624 | Ga0466735_090702 | Ga0466735_090702_1916_2560 | 214 |
| 103 | 3300042624 | Ga0466735_227714 | Ga0466735_227714_1248_1892 | 214 |
| 104 | iso_pr_bacteria | 2967483437 | 2967484991 | 214 |
| 105 | 3300000062 | IMNBL1DRAFT_c0005136 | IMNBL1DRAFT_00051367 | 215 |
| 106 | 3300002834 | JGI24696J40584_12946009 | JGI24696J40584_129460092 | 215 |
| 107 | 3300042609 | Ga0466722_236076 | Ga0466722_236076_506_1156 | 216 |
| 108 | 3300042624 | Ga0466735_017882 | Ga0466735_017882_204_854 | 216 |
| 109 | 3300042624 | Ga0466735_102106 | Ga0466735_102106_1169_1819 | 216 |
| 110 | 3300042618 | Ga0466723_227994 | Ga0466723_227994_10253_10906 | 217 |
| 111 | 3300042618 | Ga0466723_088640 | Ga0466723_088640_4006_4662 | 218 |
| 112 | 3300009784 | Ga0123357_10000231 | Ga0123357_1000023129 | 222 |
| 113 | 3300010049 | Ga0123356_10013360 | Ga0123356_100133608 | 223 |
| 114 | 3300042615 | Ga0466711_020407 | Ga0466711_020407_2455_3135 | 226 |
| 115 | 3300002462 | JGI24702J35022_10121337 | JGI24702J35022_101213371 | 230 |
| 116 | 3300042624 | Ga0466735_001596 | Ga0466735_001596_1285_1977 | 230 |
| 117 | 3300009784 | Ga0123357_10004577 | Ga0123357_1000457712 | 231 |
| 118 | 3300010167 | Ga0123353_10081161 | Ga0123353_100811614 | 258 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13578 | Methyltransf_24 | Methyltransferase domain | 106 | 206 | 0.93 |
| PF13649 | Methyltransf_25 | Methyltransferase domain | 105 | 178 | 0.93 |
| PF01596 | Methyltransf_3 | O-methyltransferase | 62 | 256 | 0.92 |
| PF13847 | Methyltransf_31 | Methyltransferase domain | 103 | 206 | 0.84 |
| PF01135 | PCMT | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) | 85 | 168 | 0.83 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01596 | GO:0008171 | O-methyltransferase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.75 | 0.86 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.