Protein Family IF03102
Metagenome
Isolate
126
Members
58
Samples
115
Scaffolds
458
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10057420|Ga0123353_100574203
- Length
- 492 aa
- Sequence
- MFPRSFRAGEFLFLSKLFRTFGLIKKPFMFTKDIYVQRRKALCAQLQSGLLLFLGNKEAPYNYLDNTYRFRQDSSFLYFFGLDEANLAVTIDLETGAETLFGDDIGIDSIVWMGPKPSMREKADRVGIAHVRPMADLANTVKKAAASGRMVHYLPPYRYANKITLMDLLGIHPNEQKANASEAFIRAVVALRAVKQPEEVVELDKAANIGYMMHYTAMKMAKLGMLEQELVGVMEGIAVSNGTMPSFPIILSQNGETLHNHSHHQILTDGRLLLIDAGAETNSHYASDFTRTIPSGGKFTQQQKELYNLVLEATDHAISLCKPEVPFKEVYFAASRIITEGLKGMGIMKGNTDDAIANGAHAMFFPCGLGHNMGMDVHDMEDLGENFVGYDDTVTRSTQFGLKSLRMAKALKVGNVMTVEPGIYFIPALMDKWRAEKVNTDFLCFDEMDKFRSFGGIRIEECIIITQNGYRMLGSKRLPVTVEEIEGVMQE*
Sample Types
Isolate
8.7%
Metagenome
91.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.6%
Kalotermitidae
24.6%
Unclassified
22.8%
Termopsidae
5.3%
Rhinotermitidae
3.5%
Passalidae
3.5%
Hodotermitidae
1.8%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 2 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 13 | 2820736622 | Unclassified Bacteroidetes Th196P4bin26 | Isolate | Unclassified |
| 14 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 22 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 23 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 43 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 44 | 2820737921 | Unclassified Bacteroidetes Th196P4bin18 | Isolate | Unclassified |
| 45 | 2820740053 | Unclassified Bacteroidetes Th196P3bin81 | Isolate | Unclassified |
| 46 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 49 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 50 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 51 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 52 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 53 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 54 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 55 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 56 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 57 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 58 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_225212 | 3300042613 | Bacteria | 4583 |
| 2 | Ga0466711_248141 | 3300042615 | Bacteria | 4770 |
| 3 | Ga0466715_038006 | 3300042616 | Unclassified | 6395 |
| 4 | Ga0466728_482084 | 3300042620 | Bacteria | 5250 |
| 5 | Ga0123353_10458894 | 3300010167 | Bacteria | 1873 |
| 6 | Ga0466694_251036 | 3300042594 | Bacteria | 2666 |
| 7 | Ga0466701_042840 | 3300042598 | Bacteria | 60722 |
| 8 | Ga0466700_172636 | 3300042600 | Bacteria | 2535 |
| 9 | JGI24696J40584_12937490 | 3300002834 | Bacteria | 1604 |
| 10 | Ga0466732_143597 | 3300042656 | Bacteria | 3179 |
| 11 | Ga0466704_475354 | 3300042643 | Bacteria | 6516 |
| 12 | Ga0466708_101521 | 3300042652 | Bacteria | 25266 |
| 13 | Ga0466710_335384 | 3300042613 | Bacteria | 2817 |
| 14 | Ga0466715_540931 | 3300042616 | Bacteria | 8372 |
| 15 | Ga0466723_162835 | 3300042618 | Bacteria | 17681 |
| 16 | Ga0123356_10010660 | 3300010049 | Bacteria | 8998 |
| 17 | Ga0123353_10000524 | 3300010167 | Bacteria | 47418 |
| 18 | Ga0123353_10009879 | 3300010167 | Bacteria | 13232 |
| 19 | Ga0123354_10309438 | 3300010882 | Bacteria | 1478 |
| 20 | Ga0466692_029952 | 3300042591 | Bacteria | 12294 |
| 21 | Ga0466691_128298 | 3300042593 | Bacteria | 15773 |
| 22 | Ga0466694_098013 | 3300042594 | Bacteria | 1752 |
| 23 | Ga0466696_172325 | 3300042596 | Bacteria | 37657 |
| 24 | Ga0466701_022200 | 3300042598 | Bacteria | 40475 |
| 25 | Ga0466713_065185 | 3300042602 | Bacteria | 22604 |
| 26 | Ga0466717_200839 | 3300042604 | Bacteria | 2945 |
| 27 | Ga0466722_239795 | 3300042609 | Bacteria | 3282 |
| 28 | JGI24702J35022_10021767 | 3300002462 | Bacteria | 3475 |
| 29 | Ga0466732_031869 | 3300042656 | Bacteria | 1543 |
| 30 | Ga0466709_404772 | 3300042648 | Bacteria | 4773 |
| 31 | Ga0466724_04033 | 3300042649 | Unclassified | 11133 |
| 32 | Ga0466724_44043 | 3300042649 | Bacteria | 4452 |
| 33 | Ga0466723_140932 | 3300042618 | Bacteria | 4934 |
| 34 | Ga0123356_10156757 | 3300010049 | Bacteria | 2268 |
| 35 | Ga0466697_002003 | 3300042611 | Bacteria | 5456 |
| 36 | JGI24702J35022_10005031 | 3300002462 | Bacteria | 7786 |
| 37 | JGI24696J40584_12938849 | 3300002834 | Bacteria | 1637 |
| 38 | Ga0466731_148646 | 3300042622 | Bacteria | 6425 |
| 39 | Ga0466731_294254 | 3300042622 | Unclassified | 2799 |
| 40 | Ga0466731_350611 | 3300042622 | Bacteria | 5536 |
| 41 | Ga0466704_035521 | 3300042643 | Bacteria | 2779 |
| 42 | Ga0466709_404640 | 3300042648 | Bacteria | 6899 |
| 43 | Ga0466708_069911 | 3300042652 | Bacteria | 13157 |
| 44 | Ga0466710_423418 | 3300042613 | Bacteria | 2419 |
| 45 | Ga0466715_458370 | 3300042616 | Bacteria | 11761 |
| 46 | Ga0466728_328142 | 3300042620 | Bacteria | 14016 |
| 47 | Ga0123356_10193843 | 3300010049 | Bacteria | 2065 |
| 48 | Ga0123353_10001245 | 3300010167 | Bacteria | 31217 |
| 49 | Ga0123353_10001720 | 3300010167 | Bacteria | 26897 |
| 50 | Ga0123353_10003643 | 3300010167 | Unclassified | 19535 |
| 51 | Ga0123354_10101108 | 3300010882 | Bacteria | 3896 |
| 52 | Ga0466690_289464 | 3300042590 | Bacteria | 5737 |
| 53 | Ga0466693_267952 | 3300042592 | Bacteria | 2302 |
| 54 | Ga0466691_032786 | 3300042593 | Bacteria | 7446 |
| 55 | Ga0466694_180729 | 3300042594 | Bacteria | 27161 |
| 56 | Ga0466716_014100 | 3300042605 | Bacteria | 4922 |
| 57 | JGI24705J35276_12211111 | 3300002504 | Bacteria | 1846 |
| 58 | Ga0466709_366043 | 3300042648 | Bacteria | 20315 |
| 59 | Ga0466708_061894 | 3300042652 | Bacteria | 6493 |
| 60 | Ga0466710_006597 | 3300042613 | Bacteria | 6458 |
| 61 | Ga0123353_10197041 | 3300010167 | Bacteria | 3174 |
| 62 | Ga0466657_165999 | 3300042582 | Bacteria | 18662 |
| 63 | Ga0466696_438532 | 3300042596 | Bacteria | 3976 |
| 64 | Ga0466714_053209 | 3300042603 | Bacteria | 3207 |
| 65 | IMNBL1DRAFT_c0000765 | 3300000062 | Bacteria | 25410 |
| 66 | Ga0072941_1294424 | 3300005201 | Unclassified | 1556 |
| 67 | Ga0466705_085012 | 3300042612 | Bacteria | 5557 |
| 68 | Ga0466703_412985 | 3300042636 | Bacteria | 6408 |
| 69 | Ga0466723_326527 | 3300042618 | Bacteria | 8684 |
| 70 | Ga0466691_127674 | 3300042593 | Bacteria | 11737 |
| 71 | Ga0466706_104368 | 3300042599 | Bacteria | 11562 |
| 72 | Ga0466713_088794 | 3300042602 | Bacteria | 20552 |
| 73 | Ga0466719_283993 | 3300042606 | Bacteria | 3749 |
| 74 | 2227080791 | 2225789004 | Bacteria | 41979 |
| 75 | JGI24702J35022_10000043 | 3300002462 | Bacteria | 52570 |
| 76 | Ga0466732_058962 | 3300042656 | Bacteria | 3957 |
| 77 | Ga0466735_036541 | 3300042624 | Bacteria | 1466 |
| 78 | Ga0466704_051910 | 3300042643 | Bacteria | 10915 |
| 79 | Ga0466708_247588 | 3300042652 | Bacteria | 14400 |
| 80 | Ga0466727_042687 | 3300042655 | Bacteria | 90775 |
| 81 | Ga0466710_344683 | 3300042613 | Bacteria | 2061 |
| 82 | Ga0466711_317316 | 3300042615 | Bacteria | 3488 |
| 83 | Ga0466715_565722 | 3300042616 | Bacteria | 2762 |
| 84 | Ga0466726_139474 | 3300042619 | Bacteria | 4387 |
| 85 | Ga0123356_10052479 | 3300010049 | Bacteria | 3793 |
| 86 | Ga0123353_10135962 | 3300010167 | Bacteria | 3942 |
| 87 | Ga0466690_265413 | 3300042590 | Unclassified | 5612 |
| 88 | Ga0466701_080615 | 3300042598 | Bacteria | 5380 |
| 89 | Ga0466706_111816 | 3300042599 | Bacteria | 19512 |
| 90 | Ga0466713_004830 | 3300042602 | Bacteria | 17469 |
| 91 | Ga0466698_457661 | 3300042610 | Bacteria | 4622 |
| 92 | JGI24702J35022_10024026 | 3300002462 | Bacteria | 3294 |
| 93 | Ga0466697_150127 | 3300042611 | Bacteria | 16959 |
| 94 | Ga0466705_153953 | 3300042612 | Bacteria | 6439 |
| 95 | Ga0466731_370950 | 3300042622 | Bacteria | 29682 |
| 96 | Ga0466704_613633 | 3300042643 | Bacteria | 4805 |
| 97 | Ga0466727_148661 | 3300042655 | Unclassified | 3361 |
| 98 | Ga0466710_410830 | 3300042613 | Bacteria | 2445 |
| 99 | Ga0466710_416632 | 3300042613 | Bacteria | 5108 |
| 100 | Ga0466726_216938 | 3300042619 | Bacteria | 10941 |
| 101 | Ga0123353_10014439 | 3300010167 | Bacteria | 11388 |
| 102 | Ga0123353_10057420 | 3300010167 | Bacteria | 6235 |
| 103 | Ga0123353_10307927 | 3300010167 | Bacteria | 2413 |
| 104 | Ga0123353_10496388 | 3300010167 | Bacteria | 1780 |
| 105 | Ga0415639_227524 | 3300038395 | Bacteria | 1470 |
| 106 | Ga0466691_186282 | 3300042593 | Bacteria | 110439 |
| 107 | Ga0466707_117862 | 3300042601 | Bacteria | 6114 |
| 108 | Ga0466714_082032 | 3300042603 | Bacteria | 1623 |
| 109 | Ga0466720_006336 | 3300042607 | Bacteria | 1574 |
| 110 | 2227303003 | 2225789004 | Bacteria | 29568 |
| 111 | IMNBL1DRAFT_c0019456 | 3300000062 | Bacteria | 2780 |
| 112 | JGI24695J34938_10000921 | 3300002450 | Bacteria | 26914 |
| 113 | JGI24702J35022_10001486 | 3300002462 | Bacteria | 14546 |
| 114 | JGI24702J35022_10036711 | 3300002462 | Bacteria | 2618 |
| 115 | JGI24696J40584_12959681 | 3300002834 | Bacteria | 5463 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042615 | Ga0466711_248141 | Ga0466711_248141_84_1295 | 394 |
| 2 | 3300042594 | Ga0466694_098013 | Ga0466694_098013_499_1689 | 396 |
| 3 | 3300042624 | Ga0466735_036541 | Ga0466735_036541_13_1239 | 408 |
| 4 | 3300042611 | Ga0466697_002003 | Ga0466697_002003_364_1740 | 425 |
| 5 | 3300010167 | Ga0123353_10001245 | Ga0123353_1000124520 | 428 |
| 6 | 3300042649 | Ga0466724_44043 | Ga0466724_44043_1568_2944 | 430 |
| 7 | 3300042622 | Ga0466731_370950 | Ga0466731_370950_19288_20664 | 434 |
| 8 | 3300002462 | JGI24702J35022_10000043 | JGI24702J35022_1000004346 | 437 |
| 9 | 3300010049 | Ga0123356_10052479 | Ga0123356_100524792 | 437 |
| 10 | 3300010167 | Ga0123353_10014439 | Ga0123353_100144397 | 439 |
| 11 | 3300038395 | Ga0415639_227524 | Ga0415639_227524_57_1376 | 439 |
| 12 | 3300042598 | Ga0466701_022200 | Ga0466701_022200_34291_35667 | 439 |
| 13 | 3300042613 | Ga0466710_423418 | Ga0466710_423418_795_2171 | 440 |
| 14 | 3300042610 | Ga0466698_457661 | Ga0466698_457661_1670_3046 | 443 |
| 15 | 3300042600 | Ga0466700_172636 | Ga0466700_172636_269_1642 | 444 |
| 16 | 3300010882 | Ga0123354_10309438 | Ga0123354_103094382 | 445 |
| 17 | 3300042593 | Ga0466691_128298 | Ga0466691_128298_8416_9753 | 445 |
| 18 | 3300042622 | Ga0466731_350611 | Ga0466731_350611_3750_5126 | 445 |
| 19 | 3300042613 | Ga0466710_225212 | Ga0466710_225212_273_1646 | 446 |
| 20 | 3300010167 | Ga0123353_10307927 | Ga0123353_103079272 | 449 |
| 21 | 3300042656 | Ga0466732_058962 | Ga0466732_058962_1783_3174 | 453 |
| 22 | 3300042613 | Ga0466710_410830 | Ga0466710_410830_741_2111 | 456 |
| 23 | 3300010167 | Ga0123353_10003643 | Ga0123353_1000364314 | 457 |
| 24 | 3300042582 | Ga0466657_165999 | Ga0466657_165999_15771_17144 | 457 |
| 25 | 3300042598 | Ga0466701_042840 | Ga0466701_042840_51148_52521 | 457 |
| 26 | 3300042649 | Ga0466724_04033 | Ga0466724_04033_3926_5299 | 457 |
| 27 | 3300042594 | Ga0466694_251036 | Ga0466694_251036_1117_2493 | 458 |
| 28 | 3300042601 | Ga0466707_117862 | Ga0466707_117862_1280_2656 | 458 |
| 29 | 3300042607 | Ga0466720_006336 | Ga0466720_006336_30_1406 | 458 |
| 30 | 3300042613 | Ga0466710_006597 | Ga0466710_006597_50_1426 | 458 |
| 31 | 3300042613 | Ga0466710_335384 | Ga0466710_335384_924_2300 | 458 |
| 32 | 3300042616 | Ga0466715_038006 | Ga0466715_038006_814_2190 | 458 |
| 33 | 3300042622 | Ga0466731_148646 | Ga0466731_148646_4133_5509 | 458 |
| 34 | 3300042622 | Ga0466731_294254 | Ga0466731_294254_10_1386 | 458 |
| 35 | 3300042656 | Ga0466732_143597 | Ga0466732_143597_1609_2985 | 458 |
| 36 | iso_pr_bacteria | 2820753519 | 2820755276 | 458 |
| 37 | iso_pr_bacteria | 2820755292 | 2820755629 | 458 |
| 38 | iso_pr_bacteria | 2820783511 | 2820785439 | 458 |
| 39 | iso_pr_bacteria | 2820792843 | 2820794977 | 458 |
| 40 | iso_pr_bacteria | 2820795054 | 2820795378 | 458 |
| 41 | iso_pr_bacteria | 2820797595 | 2820797716 | 458 |
| 42 | 3300002450 | JGI24695J34938_10000921 | JGI24695J34938_100009218 | 459 |
| 43 | 3300002462 | JGI24702J35022_10024026 | JGI24702J35022_100240263 | 459 |
| 44 | 3300002834 | JGI24696J40584_12937490 | JGI24696J40584_129374902 | 459 |
| 45 | 3300002834 | JGI24696J40584_12959681 | JGI24696J40584_129596811 | 459 |
| 46 | 3300005201 | Ga0072941_1294424 | Ga0072941_12944241 | 459 |
| 47 | 3300010049 | Ga0123356_10010660 | Ga0123356_100106605 | 459 |
| 48 | 3300010049 | Ga0123356_10193843 | Ga0123356_101938432 | 459 |
| 49 | 3300010167 | Ga0123353_10000524 | Ga0123353_1000052410 | 459 |
| 50 | 3300010167 | Ga0123353_10009879 | Ga0123353_1000987912 | 459 |
| 51 | 3300010167 | Ga0123353_10135962 | Ga0123353_101359624 | 459 |
| 52 | 3300010167 | Ga0123353_10197041 | Ga0123353_101970412 | 459 |
| 53 | 3300010882 | Ga0123354_10101108 | Ga0123354_101011083 | 459 |
| 54 | 2225789004 | 2227303003 | 2227752998 | 460 |
| 55 | 3300042592 | Ga0466693_267952 | Ga0466693_267952_689_2074 | 461 |
| 56 | 3300042596 | Ga0466696_438532 | Ga0466696_438532_1323_2708 | 461 |
| 57 | 3300042598 | Ga0466701_080615 | Ga0466701_080615_135_1520 | 461 |
| 58 | 3300042602 | Ga0466713_088794 | Ga0466713_088794_8369_9754 | 461 |
| 59 | 3300042613 | Ga0466710_344683 | Ga0466710_344683_229_1614 | 461 |
| 60 | 3300042619 | Ga0466726_139474 | Ga0466726_139474_2572_3957 | 461 |
| 61 | 3300042648 | Ga0466709_366043 | Ga0466709_366043_9092_10477 | 461 |
| 62 | 3300042652 | Ga0466708_247588 | Ga0466708_247588_10789_12174 | 461 |
| 63 | iso_pr_bacteria | 2820737921 | 2820738877 | 461 |
| 64 | 3300002462 | JGI24702J35022_10005031 | JGI24702J35022_100050317 | 462 |
| 65 | 3300002504 | JGI24705J35276_12211111 | JGI24705J35276_122111111 | 462 |
| 66 | 3300010167 | Ga0123353_10496388 | Ga0123353_104963881 | 462 |
| 67 | 3300042603 | Ga0466714_053209 | Ga0466714_053209_1513_2901 | 462 |
| 68 | 3300042612 | Ga0466705_153953 | Ga0466705_153953_3952_5340 | 462 |
| 69 | 3300042636 | Ga0466703_412985 | Ga0466703_412985_411_1799 | 462 |
| 70 | 3300042643 | Ga0466704_613633 | Ga0466704_613633_92_1480 | 462 |
| 71 | 3300042648 | Ga0466709_404772 | Ga0466709_404772_2690_4078 | 462 |
| 72 | 3300042652 | Ga0466708_061894 | Ga0466708_061894_2800_4188 | 462 |
| 73 | 3300042655 | Ga0466727_042687 | Ga0466727_042687_26107_27495 | 462 |
| 74 | 2225789004 | 2227080791 | 2227454118 | 463 |
| 75 | 3300042590 | Ga0466690_265413 | Ga0466690_265413_1061_2452 | 463 |
| 76 | 3300042590 | Ga0466690_289464 | Ga0466690_289464_233_1624 | 463 |
| 77 | 3300042591 | Ga0466692_029952 | Ga0466692_029952_3375_4766 | 463 |
| 78 | 3300042593 | Ga0466691_032786 | Ga0466691_032786_2644_4035 | 463 |
| 79 | 3300042593 | Ga0466691_127674 | Ga0466691_127674_2585_3976 | 463 |
| 80 | 3300042599 | Ga0466706_104368 | Ga0466706_104368_5139_6530 | 463 |
| 81 | 3300042602 | Ga0466713_004830 | Ga0466713_004830_13630_15021 | 463 |
| 82 | 3300042605 | Ga0466716_014100 | Ga0466716_014100_2521_3912 | 463 |
| 83 | 3300042606 | Ga0466719_283993 | Ga0466719_283993_1604_2995 | 463 |
| 84 | 3300042611 | Ga0466697_150127 | Ga0466697_150127_4442_5833 | 463 |
| 85 | 3300042612 | Ga0466705_085012 | Ga0466705_085012_290_1681 | 463 |
| 86 | 3300042615 | Ga0466711_317316 | Ga0466711_317316_836_2227 | 463 |
| 87 | 3300042616 | Ga0466715_458370 | Ga0466715_458370_10233_11624 | 463 |
| 88 | 3300042616 | Ga0466715_565722 | Ga0466715_565722_644_2035 | 463 |
| 89 | 3300042618 | Ga0466723_162835 | Ga0466723_162835_10060_11451 | 463 |
| 90 | 3300042619 | Ga0466726_216938 | Ga0466726_216938_7099_8490 | 463 |
| 91 | 3300042620 | Ga0466728_328142 | Ga0466728_328142_5037_6428 | 463 |
| 92 | 3300042620 | Ga0466728_482084 | Ga0466728_482084_3126_4517 | 463 |
| 93 | 3300042643 | Ga0466704_035521 | Ga0466704_035521_255_1646 | 463 |
| 94 | 3300042643 | Ga0466704_475354 | Ga0466704_475354_1786_3177 | 463 |
| 95 | 3300042652 | Ga0466708_101521 | Ga0466708_101521_7839_9230 | 463 |
| 96 | iso_pr_bacteria | 2820767225 | 2820767819 | 463 |
| 97 | iso_pr_bacteria | 2820772500 | 2820772650 | 463 |
| 98 | 3300000062 | IMNBL1DRAFT_c0000765 | IMNBL1DRAFT_00007652 | 464 |
| 99 | 3300000062 | IMNBL1DRAFT_c0019456 | IMNBL1DRAFT_00194562 | 464 |
| 100 | 3300002462 | JGI24702J35022_10036711 | JGI24702J35022_100367112 | 464 |
| 101 | 3300002834 | JGI24696J40584_12938849 | JGI24696J40584_129388491 | 464 |
| 102 | 3300010049 | Ga0123356_10156757 | Ga0123356_101567572 | 464 |
| 103 | 3300042603 | Ga0466714_082032 | Ga0466714_082032_168_1562 | 464 |
| 104 | 3300042643 | Ga0466704_051910 | Ga0466704_051910_2085_3479 | 464 |
| 105 | 3300042652 | Ga0466708_069911 | Ga0466708_069911_1238_2632 | 464 |
| 106 | 3300002462 | JGI24702J35022_10021767 | JGI24702J35022_100217671 | 465 |
| 107 | 3300010167 | Ga0123353_10001720 | Ga0123353_100017204 | 465 |
| 108 | 3300010167 | Ga0123353_10458894 | Ga0123353_104588943 | 465 |
| 109 | 3300042602 | Ga0466713_065185 | Ga0466713_065185_7281_8678 | 465 |
| 110 | 3300042616 | Ga0466715_540931 | Ga0466715_540931_2313_3710 | 465 |
| 111 | 3300042618 | Ga0466723_140932 | Ga0466723_140932_396_1793 | 465 |
| 112 | iso_pr_bacteria | 2820736622 | 2820737174 | 465 |
| 113 | iso_pr_bacteria | 2820740053 | 2820741681 | 465 |
| 114 | 3300002462 | JGI24702J35022_10001486 | JGI24702J35022_100014862 | 466 |
| 115 | 3300042604 | Ga0466717_200839 | Ga0466717_200839_138_1538 | 466 |
| 116 | 3300042655 | Ga0466727_148661 | Ga0466727_148661_84_1484 | 466 |
| 117 | 3300042594 | Ga0466694_180729 | Ga0466694_180729_16795_18198 | 467 |
| 118 | 3300042618 | Ga0466723_326527 | Ga0466723_326527_6606_8009 | 467 |
| 119 | 3300042593 | Ga0466691_186282 | Ga0466691_186282_75224_76633 | 469 |
| 120 | 3300042609 | Ga0466722_239795 | Ga0466722_239795_24_1436 | 470 |
| 121 | 3300042613 | Ga0466710_416632 | Ga0466710_416632_1113_2528 | 471 |
| 122 | 3300042599 | Ga0466706_111816 | Ga0466706_111816_7605_9026 | 473 |
| 123 | 3300042648 | Ga0466709_404640 | Ga0466709_404640_4779_6203 | 474 |
| 124 | 3300042656 | Ga0466732_031869 | Ga0466732_031869_57_1517 | 486 |
| 125 | 3300042596 | Ga0466696_172325 | Ga0466696_172325_9714_11186 | 490 |
| 126 | 3300010167 | Ga0123353_10057420 | Ga0123353_100574203 | 492 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.9 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.