Protein Family IF03089

Metagenome Isolate
193 Members
102 Samples
162 Scaffolds
416.51 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10042207|Ga0123353_100422074
Length
467 aa
Sequence
LQKILAGKINLFLGMWDKKVVFGLKPLNNKKIFYPFNNGNHKIYTVKLKTFILSVIFLLTIFSTNAAYLLIPMDMEQKNHLKAYGIAYFTITKDIDVSWLLNYRGGSFMCVYNAGVEDECVIRGVSYQVIADVQAAAILNEMAATESNMDEVKLTKVPKIAVYSPKNKLPWDDAVTLVLTYAEIPYDVIYDEEVMNDALPKYDWLHVHHEDFTGQYGKFWSNYKNHAWYVEDVKLNEATAAKLGFKKVSQLKLAVAKKIRDFVMGGGYMFAMCSAPDSFDIALAADGVDICDVPFDGDPVEPNAQQKLNYDNCFAFTDFNIVTNPHIYRKSDIDVNPAIHTQNKKNDFFTLFEFSAKWDPVPTMLTQNHQNVIVGFMGQTTAFSNNRIKPHVVILGETKIFDEARYIHGTYGNGTFTFYSGHDPEDYQHFVGDPPTDLNLFPNSPGYRLILNNVLFPAAKKQKQKT*

📊 Sample Types

Isolate 16.1%
Metagenome 83.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 33.3%
Unclassified 24.0%
Formicidae 9.4%
Kalotermitidae 8.3%
Culicidae 5.2%
Armadillidiidae 5.2%
Elmidae 3.1%
Daphniidae 2.1%
Rhinotermitidae 2.1%
Termopsidae 2.1%
Hodotermitidae 1.0%
Passalidae 1.0%
Nephropidae 1.0%
Hydrophilidae 1.0%
Apidae 1.0%

🌳 Taxonomy

Archaea 0
Bacteria 177
Eukaryota 0
Viruses 0
Unclassified 16

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820746860 Unclassified Bacteroidetes Th196P3bin126 Isolate Unclassified
2 2820770630 Unclassified Bacteroidetes Lab288P3bin130 Isolate Unclassified
3 2882250448 Bizionia sp. APA-3 Isolate
4 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
5 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
12 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
13 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
16 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
17 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
18 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
19 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
20 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
21 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
22 2820219087 Unclassified Ignavibacteria Th196P3bin14 Isolate Unclassified
23 2864836148 Arcicella rosea S00070 Isolate Elmidae
24 2864878056 Flavobacterium notoginsengisoli S00128 Isolate Elmidae
25 2864886855 Flavobacterium nitrogenifigens S00142 Isolate Elmidae
26 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
27 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
28 2811995047 Flavobacterium succinicans DD5b Isolate Daphniidae
29 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
30 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
31 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
32 2820788205 Unclassified Bacteroidetes Emb289P1bin57 Isolate Unclassified
33 2894649344 Allomuricauda alvinocaridis SCR12 Isolate Unclassified
34 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
35 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
36 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
37 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
38 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
39 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
43 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
44 2820765201 Unclassified Bacteroidetes Lab288P3bin82 Isolate Unclassified
45 2820789850 Unclassified Bacteroidetes Cu122P3bin3 Isolate Unclassified
46 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
51 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
52 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
53 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
54 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae
55 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
56 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
57 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
58 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
59 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
60 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
61 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
62 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
63 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
64 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
65 2509276035 Saprospira grandis HR1, DSM 2844 Isolate
66 2820785563 Unclassified Bacteroidetes Emb289P1bin74 Isolate Unclassified
67 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
68 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
69 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
70 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
71 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
72 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
73 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
74 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
75 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
76 2740892547 Fibrobacteria bacterium GUT77 MC_77 Isolate Unclassified
77 2820724199 Unclassified Cloacimonetes Th196P3bin22 Isolate Unclassified
78 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
79 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
80 2838772460 Aquimarina sp. I32.4 Isolate Nephropidae
81 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
82 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
83 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
84 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
85 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
86 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
87 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
88 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
89 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
90 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
91 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
92 8065497608 Tellurirhabdus bombi IE-0392 Isolate Apidae
93 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
94 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
95 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
96 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
97 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
98 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
99 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
100 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
101 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
102 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_103016 3300042659 Bacteria 6307
2 Ga0466710_283268 3300042613 Bacteria 2466
3 Ga0466731_211505 3300042622 Bacteria 3211
4 Ga0466731_266903 3300042622 Bacteria 60514
5 Ga0466702_288337 3300042635 Bacteria 1732
6 Ga0466703_407651 3300042636 Bacteria 5298
7 Ga0466704_173397 3300042643 Bacteria 4688
8 Ga0466709_083595 3300042648 Bacteria 26100
9 Ga0466701_061937 3300042598 Bacteria 1816
10 Ga0466706_065290 3300042599 Bacteria 12121
11 Ga0466707_001681 3300042601 Bacteria 12758
12 Ga0466707_158052 3300042601 Bacteria 5529
13 Ga0160433_100032 3300012846 Bacteria 165473
14 Ga0264413_105305 3300024493 Bacteria 15609
15 Ga0415639_270234 3300038395 Bacteria 1232
16 Ga0466690_173926 3300042590 Unclassified 6566
17 Ga0466696_455700 3300042596 Bacteria 12920
18 Ga0123355_10000161 3300009826 Bacteria 81946
19 Ga0123356_10034598 3300010049 Bacteria 4722
20 Ga0123353_10001557 3300010167 Bacteria 28122
21 Ga0123353_10042207 3300010167 Bacteria 7212
22 AustNasuHG_c1003134 3300000089 Bacteria 5963
23 JGI24702J35022_10016240 3300002462 Bacteria 4082
24 JGI24702J35022_10061252 3300002462 Bacteria 2013
25 Ga0072941_1006410 3300005201 Unclassified 17131
26 Ga0103265_1000697 3300007068 Bacteria 5583
27 Ga0466732_041734 3300042656 Bacteria 75299
28 Ga0466712_270085 3300042614 Bacteria 1812
29 Ga0466729_122349 3300042621 Bacteria 2049
30 Ga0466735_022680 3300042624 Bacteria 5600
31 Ga0466709_098402 3300042648 Bacteria 118141
32 Ga0466724_00778 3300042649 Bacteria 5292
33 Ga0466706_165084 3300042599 Bacteria 195712
34 Ga0466707_021774 3300042601 Bacteria 6918
35 Ga0466714_010671 3300042603 Bacteria 2535
36 Ga0466717_306322 3300042604 Unclassified 2254
37 Ga0466720_068655 3300042607 Bacteria 12399
38 Ga0466697_006762 3300042611 Bacteria 2706
39 Ga0415639_043885 3300038395 Bacteria 2972
40 Ga0123356_10001642 3300010049 Bacteria 24549
41 Ga0123353_10000048 3300010167 Bacteria 132187
42 JGI24695J34938_10000249 3300002450 Bacteria 52020
43 JGI24696J40584_12960459 3300002834 Bacteria 7300
44 Ga0072940_1013756 3300005200 Bacteria 6388
45 Ga0072941_1022743 3300005201 Bacteria 11065
46 Ga0102735_1000198 3300007080 Unclassified 15380
47 Ga0102734_1000079 3300007129 Bacteria 54104
48 Ga0103267_1005462 3300007190 Bacteria 3553
49 Ga0466712_088280 3300042614 Bacteria 3385
50 Ga0466715_382018 3300042616 Unclassified 23228
51 Ga0466729_191748 3300042621 Bacteria 8466
52 Ga0466731_359950 3300042622 Bacteria 2236
53 Ga0466701_100742 3300042598 Bacteria 6223
54 Ga0466700_037350 3300042600 Bacteria 11942
55 Ga0466713_041543 3300042602 Bacteria 8044
56 Ga0466696_002758 3300042596 Bacteria 19389
57 Ga0123356_10022648 3300010049 Bacteria 5927
58 Ga0123356_10039577 3300010049 Unclassified 4392
59 Ga0123353_10011313 3300010167 Bacteria 12558
60 Ga0123353_10089038 3300010167 Bacteria 4970
61 Ga0123354_10233665 3300010882 Bacteria 1914
62 Ga0102737_1000040 3300007142 Bacteria 38273
63 Ga0103268_1000990 3300007192 Unclassified 7611
64 Ga0466715_378211 3300042616 Bacteria 1987
65 Ga0466723_330665 3300042618 Bacteria 10340
66 Ga0466731_012393 3300042622 Bacteria 11846
67 Ga0466735_127798 3300042624 Bacteria 4067
68 Ga0466702_301303 3300042635 Unclassified 1496
69 Ga0466709_180467 3300042648 Bacteria 40114
70 Ga0466713_010765 3300042602 Bacteria 37272
71 Ga0466713_070245 3300042602 Bacteria 20718
72 Ga0466714_025262 3300042603 Bacteria 3458
73 Ga0160455_100412 3300012837 Bacteria 23367
74 Ga0160472_100761 3300012839 Unclassified 14340
75 Ga0160434_100238 3300012850 Bacteria 23270
76 Ga0466694_150704 3300042594 Bacteria 1721
77 Ga0466696_311000 3300042596 Bacteria 2054
78 Ga0466699_351928 3300042597 Bacteria 2779
79 Ga0123356_10022039 3300010049 Bacteria 6015
80 Ga0123356_10064122 3300010049 Bacteria 3434
81 Ga0123353_10003772 3300010167 Unclassified 19302
82 Ga0123353_10026406 3300010167 Bacteria 8869
83 Ga0123353_10063692 3300010167 Bacteria 5914
84 Ga0123353_10384179 3300010167 Bacteria 2098
85 JGI24698J34947_10008697 3300002449 Bacteria 5568
86 JGI24702J35022_10001141 3300002462 Bacteria 16511
87 Ga0103267_1001946 3300007190 Unclassified 10724
88 Ga0466697_081097 3300042611 Bacteria 3168
89 Ga0466718_134283 3300042617 Bacteria 6839
90 Ga0466734_105676 3300042623 Bacteria 2582
91 Ga0466702_048934 3300042635 Bacteria 5554
92 Ga0466703_385315 3300042636 Bacteria 3694
93 Ga0466720_060162 3300042607 Bacteria 5160
94 Ga0466720_175826 3300042607 Bacteria 1641
95 Ga0466720_177014 3300042607 Bacteria 27521
96 Ga0160469_100154 3300012824 Bacteria 76254
97 Ga0160460_100068 3300012845 Bacteria 160857
98 Ga0160443_100413 3300012848 Bacteria 33783
99 Ga0160457_1001100 3300012858 Bacteria 8439
100 Ga0264413_105306 3300024493 Unclassified 11576
101 Ga0415639_043852 3300038395 Bacteria 1348
102 Ga0123356_10000436 3300010049 Bacteria 47690
103 Ga0123353_10022792 3300010167 Bacteria 9457
104 Ga0123353_10240659 3300010167 Bacteria 2812
105 JGI24695J34938_10003105 3300002450 Bacteria 11870
106 JGI24702J35022_10146271 3300002462 Bacteria 1323
107 CVPL010W_10000627 3300002931 Bacteria 40635
108 Ga0072941_1048112 3300005201 Bacteria 14724
109 Ga0072941_1073869 3300005201 Unclassified 4241
110 Ga0466732_130254 3300042656 Bacteria 2675
111 Ga0466732_177137 3300042656 Bacteria 1534
112 Ga0466732_384759 3300042656 Bacteria 2158
113 Ga0466718_105114 3300042617 Bacteria 13621
114 Ga0466726_280749 3300042619 Bacteria 3900
115 Ga0466708_409937 3300042652 Bacteria 4046
116 Ga0466706_051635 3300042599 Bacteria 8362
117 Ga0466707_293694 3300042601 Unclassified 3829
118 Ga0466713_057198 3300042602 Bacteria 57543
119 Ga0466714_058710 3300042603 Bacteria 109931
120 Ga0160441_100013 3300012825 Bacteria 353830
121 Ga0160435_1000005 3300012857 Bacteria 359635
122 Ga0415639_042366 3300038395 Bacteria 12021
123 Ga0415639_054987 3300038395 Bacteria 4096
124 Ga0466656_227258 3300042550 Bacteria 2611
125 Ga0466657_289518 3300042582 Bacteria 4298
126 Ga0123356_10000992 3300010049 Bacteria 31515
127 Ga0123356_10024324 3300010049 Bacteria 5701
128 Ga0123354_10048710 3300010882 Unclassified 6438
129 JGI24696J40584_12961524 3300002834 Bacteria 19637
130 Ga0466732_036404 3300042656 Bacteria 5188
131 Ga0466710_030848 3300042613 Bacteria 9015
132 Ga0466731_179773 3300042622 Bacteria 5407
133 Ga0466735_027194 3300042624 Bacteria 14165
134 Ga0466706_286100 3300042599 Bacteria 13496
135 Ga0466700_362509 3300042600 Bacteria 109813
136 Ga0466717_009727 3300042604 Bacteria 1571
137 Ga0466721_144068 3300042608 Bacteria 24041
138 Ga0264413_156359 3300024493 Bacteria 2732
139 Ga0415639_001954 3300038395 Bacteria 43278
140 Ga0466694_201329 3300042594 Bacteria 7813
141 Ga0123356_10015725 3300010049 Bacteria 7242
142 Ga0123353_10003378 3300010167 Bacteria 20169
143 Ga0123354_10034812 3300010882 Bacteria 7872
144 Ga0123354_10218825 3300010882 Unclassified 2031
145 Ga0160465_100054 3300012803 Bacteria 130977
146 Ga0160470_100043 3300012813 Bacteria 189187
147 Ga0072941_1000967 3300005201 Bacteria 66192
148 Ga0072941_1511487 3300005201 Bacteria 2439
149 Ga0102740_1000163 3300007140 Bacteria 18409
150 Ga0466710_439552 3300042613 Bacteria 6063
151 Ga0466710_455812 3300042613 Bacteria 3902
152 Ga0466712_032554 3300042614 Bacteria 10285
153 Ga0466702_409512 3300042635 Bacteria 1233
154 Ga0466701_098317 3300042598 Bacteria 8150
155 Ga0466706_118402 3300042599 Bacteria 2271
156 Ga0466722_057211 3300042609 Bacteria 2236
157 Ga0466695_129296 3300042595 Bacteria 21897
158 Ga0123353_10000425 3300010167 Bacteria 52261
159 Ga0123353_10008800 3300010167 Bacteria 13833
160 IMNBL1DRAFT_c0002975 3300000062 Bacteria 11257
161 Ga0068305_10046751 3300005083 Bacteria 29879
162 Ga0102739_1000017 3300007095 Bacteria 58340

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042635 Ga0466702_301303 Ga0466702_301303_441_1454 337
2 3300042635 Ga0466702_409512 Ga0466702_409512_124_1197 357
3 3300007190 Ga0103267_1001946 Ga0103267_10019463 360
4 3300007190 Ga0103267_1005462 Ga0103267_10054623 370
5 3300038395 Ga0415639_043852 Ga0415639_043852_26_1138 370
6 3300042616 Ga0466715_378211 Ga0466715_378211_837_1967 376
7 3300000062 IMNBL1DRAFT_c0002975 IMNBL1DRAFT_00029755 392
8 3300042596 Ga0466696_455700 Ga0466696_455700_3978_5159 393
9 3300042599 Ga0466706_065290 Ga0466706_065290_6855_8036 393
10 3300042603 Ga0466714_025262 Ga0466714_025262_833_2014 393
11 3300042656 Ga0466732_130254 Ga0466732_130254_1250_2431 393
12 3300012845 Ga0160460_100068 Ga0160460_10006874 394
13 3300038395 Ga0415639_270234 Ga0415639_270234_38_1222 394
14 3300042601 Ga0466707_293694 Ga0466707_293694_881_2158 394
15 3300042602 Ga0466713_070245 Ga0466713_070245_7801_8985 394
16 3300042611 Ga0466697_006762 Ga0466697_006762_1316_2500 394
17 3300042613 Ga0466710_030848 Ga0466710_030848_334_1518 394
18 3300042622 Ga0466731_266903 Ga0466731_266903_31013_32197 394
19 iso_pr_bacteria 2820219087 2820219811 394
20 3300002834 JGI24696J40584_12961524 JGI24696J40584_129615246 395
21 3300010049 Ga0123356_10039577 Ga0123356_100395772 395
22 3300010049 Ga0123356_10064122 Ga0123356_100641222 395
23 3300010167 Ga0123353_10003772 Ga0123353_1000377212 395
24 3300012837 Ga0160455_100412 Ga0160455_10041215 395
25 3300042601 Ga0466707_001681 Ga0466707_001681_2109_3296 395
26 iso_pr_bacteria 2894649344 2894650982 395
27 3300007080 Ga0102735_1000198 Ga0102735_100019810 397
28 3300007095 Ga0102739_1000017 Ga0102739_100001737 397
29 3300007129 Ga0102734_1000079 Ga0102734_100007943 397
30 3300007140 Ga0102740_1000163 Ga0102740_10001637 397
31 3300007192 Ga0103268_1000990 Ga0103268_10009902 397
32 3300042624 Ga0466735_027194 Ga0466735_027194_11942_13135 397
33 3300007142 Ga0102737_1000040 Ga0102737_100004037 398
34 3300042602 Ga0466713_010765 Ga0466713_010765_35545_36741 398
35 3300042599 Ga0466706_051635 Ga0466706_051635_3457_4656 399
36 3300042603 Ga0466714_010671 Ga0466714_010671_281_1480 399
37 3300042550 Ga0466656_227258 Ga0466656_227258_410_1612 400
38 iso_pr_bacteria 2820746860 2820747527 400
39 3300042621 Ga0466729_122349 Ga0466729_122349_465_1742 401
40 3300042600 Ga0466700_362509 Ga0466700_362509_37353_38612 403
41 3300042604 Ga0466717_306322 Ga0466717_306322_621_1874 403
42 3300042616 Ga0466715_382018 Ga0466715_382018_4535_5812 406
43 3300042601 Ga0466707_158052 Ga0466707_158052_3279_4502 407
44 3300042602 Ga0466713_041543 Ga0466713_041543_3101_4324 407
45 3300010167 Ga0123353_10000425 Ga0123353_1000042531 408
46 3300002462 JGI24702J35022_10016240 JGI24702J35022_100162403 410
47 3300005201 Ga0072941_1000967 Ga0072941_10009679 410
48 3300042607 Ga0466720_068655 Ga0466720_068655_1496_2734 412
49 3300042607 Ga0466720_177014 Ga0466720_177014_7277_8515 412
50 3300002462 JGI24702J35022_10061252 JGI24702J35022_100612522 413
51 3300010049 Ga0123356_10000436 Ga0123356_1000043642 415
52 3300010167 Ga0123353_10089038 Ga0123353_100890382 416
53 3300042598 Ga0466701_098317 Ga0466701_098317_4142_5407 416
54 3300042604 Ga0466717_009727 Ga0466717_009727_60_1313 417
55 3300005083 Ga0068305_10046751 Ga0068305_1004675113 418
56 3300038395 Ga0415639_054987 Ga0415639_054987_2669_3925 418
57 3300042603 Ga0466714_058710 Ga0466714_058710_95261_96517 418
58 3300042614 Ga0466712_088280 Ga0466712_088280_1266_2522 418
59 3300042656 Ga0466732_384759 Ga0466732_384759_557_1813 418
60 iso_pr_bacteria 2820719201 2820720585 418
61 iso_pr_bacteria 2882250448 2882253620 418
62 iso_pr_bacteria 8065497608 8065499855 418
63 3300002449 JGI24698J34947_10008697 JGI24698J34947_100086975 419
64 3300005201 Ga0072941_1048112 Ga0072941_104811213 419
65 3300010049 Ga0123356_10001642 Ga0123356_100016429 419
66 3300010049 Ga0123356_10015725 Ga0123356_100157255 419
67 3300010049 Ga0123356_10022648 Ga0123356_100226482 419
68 3300010167 Ga0123353_10003378 Ga0123353_100033782 419
69 3300012813 Ga0160470_100043 Ga0160470_100043141 419
70 3300012846 Ga0160433_100032 Ga0160433_100032140 419
71 3300012848 Ga0160443_100413 Ga0160443_10041332 419
72 3300038395 Ga0415639_042366 Ga0415639_042366_2902_4161 419
73 3300042590 Ga0466690_173926 Ga0466690_173926_4937_6196 419
74 3300042597 Ga0466699_351928 Ga0466699_351928_1428_2687 419
75 3300042599 Ga0466706_286100 Ga0466706_286100_5758_7017 419
76 3300042614 Ga0466712_032554 Ga0466712_032554_8598_9857 419
77 3300042618 Ga0466723_330665 Ga0466723_330665_5090_6349 419
78 3300042622 Ga0466731_359950 Ga0466731_359950_504_1763 419
79 3300042623 Ga0466734_105676 Ga0466734_105676_270_1529 419
80 3300042635 Ga0466702_048934 Ga0466702_048934_3563_4822 419
81 3300042635 Ga0466702_288337 Ga0466702_288337_384_1643 419
82 3300042648 Ga0466709_083595 Ga0466709_083595_6471_7730 419
83 3300042652 Ga0466708_409937 Ga0466708_409937_1076_2335 419
84 iso_pr_bacteria 2864878056 2864882572 419
85 iso_pr_bacteria 2864886855 2864891234 419
86 iso_pr_bacteria 2873776654 2873777791 419
87 3300005201 Ga0072941_1006410 Ga0072941_100641013 420
88 3300005201 Ga0072941_1073869 Ga0072941_10738693 420
89 3300010049 Ga0123356_10022039 Ga0123356_100220396 420
90 3300038395 Ga0415639_043885 Ga0415639_043885_1535_2797 420
91 3300042596 Ga0466696_002758 Ga0466696_002758_2793_4055 420
92 3300042648 Ga0466709_098402 Ga0466709_098402_63781_65043 420
93 iso_pr_bacteria 2820750388 2820750511 420
94 iso_pr_bacteria 2820765201 2820765303 420
95 iso_pr_bacteria 8065497608 8065500513 420
96 3300002462 JGI24702J35022_10146271 JGI24702J35022_101462711 421
97 3300010049 Ga0123356_10034598 Ga0123356_100345981 421
98 3300010167 Ga0123353_10063692 Ga0123353_100636925 421
99 3300010882 Ga0123354_10034812 Ga0123354_100348122 421
100 3300012824 Ga0160469_100154 Ga0160469_10015472 421
101 3300012825 Ga0160441_100013 Ga0160441_100013259 421
102 3300012858 Ga0160457_1001100 Ga0160457_10011003 421
103 3300042594 Ga0466694_150704 Ga0466694_150704_137_1402 421
104 3300042594 Ga0466694_201329 Ga0466694_201329_4664_5929 421
105 3300042598 Ga0466701_100742 Ga0466701_100742_186_1451 421
106 3300042599 Ga0466706_118402 Ga0466706_118402_992_2257 421
107 3300042602 Ga0466713_057198 Ga0466713_057198_37098_38363 421
108 3300042607 Ga0466720_175826 Ga0466720_175826_197_1462 421
109 3300042611 Ga0466697_081097 Ga0466697_081097_1856_3121 421
110 3300042613 Ga0466710_283268 Ga0466710_283268_917_2182 421
111 3300042613 Ga0466710_455812 Ga0466710_455812_2205_3470 421
112 3300042617 Ga0466718_105114 Ga0466718_105114_9263_10528 421
113 3300042624 Ga0466735_022680 Ga0466735_022680_841_2106 421
114 3300042624 Ga0466735_127798 Ga0466735_127798_1871_3136 421
115 3300042636 Ga0466703_385315 Ga0466703_385315_2394_3659 421
116 3300042643 Ga0466704_173397 Ga0466704_173397_3228_4493 421
117 3300042656 Ga0466732_041734 Ga0466732_041734_63949_65214 421
118 iso_pr_bacteria 2820753519 2820754309 421
119 iso_pr_bacteria 2820755292 2820755763 421
120 iso_pr_bacteria 2820783511 2820783707 421
121 iso_pr_bacteria 2820792843 2820794173 421
122 iso_pr_bacteria 2820795054 2820796501 421
123 iso_pr_bacteria 2820797595 2820798164 421
124 iso_pr_bacteria 2864836148 2864840135 421
125 3300002834 JGI24696J40584_12960459 JGI24696J40584_129604593 422
126 3300002931 CVPL010W_10000627 CVPL010W_100006277 422
127 3300010049 Ga0123356_10000992 Ga0123356_1000099218 422
128 3300010049 Ga0123356_10024324 Ga0123356_100243243 422
129 3300010167 Ga0123353_10011313 Ga0123353_100113133 422
130 3300010167 Ga0123353_10022792 Ga0123353_100227921 422
131 3300010167 Ga0123353_10026406 Ga0123353_100264065 422
132 3300010882 Ga0123354_10048710 Ga0123354_100487104 422
133 3300010882 Ga0123354_10218825 Ga0123354_102188252 422
134 3300012839 Ga0160472_100761 Ga0160472_10076110 422
135 3300012850 Ga0160434_100238 Ga0160434_10023822 422
136 3300012857 Ga0160435_1000005 Ga0160435_1000005133 422
137 3300042596 Ga0466696_311000 Ga0466696_311000_741_2009 422
138 3300042599 Ga0466706_165084 Ga0466706_165084_130300_131568 422
139 3300042613 Ga0466710_439552 Ga0466710_439552_4670_5938 422
140 3300042622 Ga0466731_012393 Ga0466731_012393_2908_4176 422
141 3300042648 Ga0466709_180467 Ga0466709_180467_28953_30221 422
142 3300042656 Ga0466732_177137 Ga0466732_177137_170_1438 422
143 3300042659 Ga0466733_103016 Ga0466733_103016_2488_3756 422
144 iso_pr_bacteria 2820785563 2820786470 422
145 iso_pr_bacteria 2820788205 2820788677 422
146 3300005201 Ga0072941_1022743 Ga0072941_10227438 423
147 3300009826 Ga0123355_10000161 Ga0123355_1000016158 423
148 3300012803 Ga0160465_100054 Ga0160465_10005437 423
149 3300042582 Ga0466657_289518 Ga0466657_289518_2054_3325 423
150 3300042595 Ga0466695_129296 Ga0466695_129296_13400_14671 423
151 3300042608 Ga0466721_144068 Ga0466721_144068_11641_12912 423
152 3300042617 Ga0466718_134283 Ga0466718_134283_5052_6323 423
153 3300042621 Ga0466729_191748 Ga0466729_191748_2706_3977 423
154 3300042622 Ga0466731_211505 Ga0466731_211505_339_1610 423
155 iso_pr_bacteria 2820770630 2820770888 423
156 3300010167 Ga0123353_10000048 Ga0123353_10000048115 424
157 3300010882 Ga0123354_10233665 Ga0123354_102336651 424
158 3300042598 Ga0466701_061937 Ga0466701_061937_390_1664 424
159 iso_pr_bacteria 2590828803 2592927191 424
160 3300005201 Ga0072941_1511487 Ga0072941_15114871 425
161 3300024493 Ga0264413_156359 Ga0264413_1563593 425
162 3300038395 Ga0415639_001954 Ga0415639_001954_13576_14853 425
163 3300042619 Ga0466726_280749 Ga0466726_280749_933_2210 425
164 3300042636 Ga0466703_407651 Ga0466703_407651_380_1657 425
165 3300042601 Ga0466707_021774 Ga0466707_021774_2377_3657 426
166 3300010167 Ga0123353_10240659 Ga0123353_102406591 427
167 3300042609 Ga0466722_057211 Ga0466722_057211_702_1985 427
168 3300042656 Ga0466732_036404 Ga0466732_036404_1042_2325 427
169 3300042607 Ga0466720_060162 Ga0466720_060162_1094_2380 428
170 3300000089 AustNasuHG_c1003134 AustNasuHG_10031342 429
171 iso_pr_bacteria 2509276035 2509456989 429
172 iso_pr_bacteria 2820724199 2820724821 429
173 3300042600 Ga0466700_037350 Ga0466700_037350_62_1357 431
174 iso_pr_bacteria 2820789850 2820791099 431
175 3300010167 Ga0123353_10008800 Ga0123353_100088003 433
176 3300005200 Ga0072940_1013756 Ga0072940_10137565 434
177 3300042649 Ga0466724_00778 Ga0466724_00778_2669_4012 434
178 3300024493 Ga0264413_105306 Ga0264413_10530610 435
179 iso_pr_bacteria 2740892547 2743912817 435
180 3300007068 Ga0103265_1000697 Ga0103265_10006974 436
181 3300010167 Ga0123353_10001557 Ga0123353_100015579 436
182 3300024493 Ga0264413_105305 Ga0264413_1053059 436
183 3300042622 Ga0466731_179773 Ga0466731_179773_2578_3891 437
184 iso_pr_bacteria 2811995047 2812945432 437
185 iso_pr_bacteria 2838772460 2838773435 438
186 3300002462 JGI24702J35022_10001141 JGI24702J35022_100011413 442
187 3300002450 JGI24695J34938_10003105 JGI24695J34938_100031055 447
188 3300042614 Ga0466712_270085 Ga0466712_270085_292_1638 448
189 iso_pr_bacteria 2778260935 2778343407 455
190 iso_pr_bacteria 2778260938 2778349956 455
191 3300002450 JGI24695J34938_10000249 JGI24695J34938_1000024912 456
192 3300010167 Ga0123353_10384179 Ga0123353_103841792 457
193 3300010167 Ga0123353_10042207 Ga0123353_100422074 467

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.