Protein Family IF03081

Metagenome Isolate
191 Members
97 Samples
152 Scaffolds
252.62 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10028155|Ga0123353_100281552
Length
290 aa
Sequence
VFLSIGVAIPQCQNSRGRHKALPCGDKQIERMAITMDKTKRRPIIAGNWKMNKNPAEARELIRAIKPLVENADCEVVACVPFVDLKDIIDETTGTNIKAGAQNCHFEEKGAFTGEISAPMLKNIGAEYVIIGHSERRTYFGETDSAVNLRTKAALGQGLKVILCVGEYLEQRERGITFEIVRMQTKIALDGVNAEMLKNVVIAYEPVWAIGTGKTATAEQANEVCKGIRDLIGELCGAAAAEAVAVQYGGSMNAKNAAELLSMPDIDGGLIGGASLVPEDFAAIVSAAG*

📊 Sample Types

Isolate 20.4%
Metagenome 79.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 28.4%
Termitidae 22.1%
Kalotermitidae 15.8%
Formicidae 10.5%
Apidae 3.2%
Scarabaeidae 3.2%
Termopsidae 2.1%
Passalidae 2.1%
Culicidae 2.1%
Elmidae 1.1%
Rhinotermitidae 1.1%
Chrysomelidae 1.1%
Penaeidae 1.1%
Hydrophilidae 1.1%
Tenebrionidae 1.1%
Hodotermitidae 1.1%
Ceratopogonidae 1.1%
Nephropidae 1.1%
Plutellidae 1.1%

🌳 Taxonomy

Archaea 0
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820811576 Unclassified Actinobacteria Nt197P3bin53 Isolate Unclassified
2 2864909992 Bacillus velezensis S00166 Isolate Elmidae
3 2902896024 Pseudoalteromonas sp. S1612 Isolate Unclassified
4 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
5 2590828840 Clostridium sp. 2 Isolate Termitidae
6 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
7 2820477775 Unclassified Firmicutes Lab288P1bin79 Isolate Unclassified
8 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
12 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
16 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
17 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
18 2523231078 Paenibacillus larvae larvae 4-309, DSM 25430 Isolate Apidae
19 2820506701 Unclassified Firmicutes Lab288P1bin46 Isolate Unclassified
20 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
21 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
22 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
23 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
24 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
25 2998833917 Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym Isolate Chrysomelidae
26 2900804455 Listeria sp. PSOL-1 Marseille-P4284 Isolate Unclassified
27 2671180705 Pseudoalteromonas piscicida S2040 Isolate Unclassified
28 2820250282 Unclassified Firmicutes Th196P3bin66 Isolate Unclassified
29 2820393573 Unclassified Firmicutes Nc150P1bin9 Isolate Unclassified
30 2772190895 Unclassified Elusimicrobia Emb289P1_bin39 Isolate Unclassified
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
36 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
37 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
38 2849099867 Paenibacillus larvae larvae ERIC_I Isolate Unclassified
39 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
40 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
41 2820424542 Unclassified Firmicutes Lab288P3bin47 Isolate Unclassified
42 8082023105 Niallia sp. Man26 Isolate Penaeidae
43 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
44 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
45 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
46 2820813074 Unclassified Actinobacteria Nt197P3bin52 Isolate Unclassified
47 2849104611 Paenibacillus larvae larvae Eric_IV Isolate Apidae
48 2873562573 Thermomonas sp. HDW16 Isolate Hydrophilidae
49 2820457604 Unclassified Firmicutes Lab288P3bin15 Isolate Unclassified
50 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
51 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
52 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
53 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
54 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
55 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
56 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
57 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
58 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
59 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
60 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
61 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
62 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
63 2902916284 Pseudoalteromonas rubra S1946 Isolate Unclassified
64 2914375287 Culicoidibacter larvae CS-1 Isolate Ceratopogonidae
65 2731957677 Alkalihalobacillus trypoxylicola NBRC 102646 Isolate Scarabaeidae
66 2820263778 Unclassified Firmicutes Th196P3bin37 Isolate Unclassified
67 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
68 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
69 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
70 641736255 Paenibacillus larvae larvae BRL-230010 Isolate Unclassified
71 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
72 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
73 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
74 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
75 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
76 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
77 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
78 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
79 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
80 2820510699 Unclassified Firmicutes Lab288P1bin40 Isolate Unclassified
81 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
82 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
83 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
84 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
85 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
86 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
87 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
88 3300012849 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG Metagenome Culicidae
89 3300035363 Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut Metagenome Plutellidae
90 2850744690 Paenibacillus larvae larvae DSM 25430 Isolate Apidae
91 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
92 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
93 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
94 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
95 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
96 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
97 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 2227479905 2225789004 Bacteria 4467
2 Ga0068305_10165488 3300005083 Bacteria 7990
3 Ga0072941_1057665 3300005201 Bacteria 38454
4 Ga0072941_1174662 3300005201 Unclassified 1894
5 Ga0072941_1289851 3300005201 Unclassified 1627
6 Ga0102734_1000033 3300007129 Bacteria 71720
7 Ga0466711_381864 3300042615 Bacteria 71251
8 Ga0466734_055737 3300042623 Bacteria 4711
9 Ga0466709_036643 3300042648 Bacteria 1264
10 Ga0123355_10091883 3300009826 Bacteria 4810
11 Ga0123353_10213092 3300010167 Bacteria 3028
12 Ga0123354_10259063 3300010882 Bacteria 1742
13 2227528804 2225789004 Bacteria 3190
14 AustNasuHG_c1007329 3300000089 Bacteria 3928
15 JGI24703J35330_11745442 3300002501 Bacteria 4592
16 Ga0068302_10587118 3300005071 Bacteria 2658
17 Ga0160447_101485 3300012849 Unclassified 9079
18 Ga0415639_013362 3300038395 Bacteria 13522
19 Ga0466691_219068 3300042593 Bacteria 1252
20 Ga0466706_253000 3300042599 Bacteria 8725
21 Ga0466717_046344 3300042604 Bacteria 5820
22 Ga0466734_125451 3300042623 Bacteria 1827
23 Ga0466708_059311 3300042652 Bacteria 20368
24 Ga0123355_10002083 3300009826 Bacteria 28232
25 Ga0123355_10730886 3300009826 Bacteria 1126
26 Ga0123353_10000142 3300010167 Bacteria 87975
27 Ga0123353_10057118 3300010167 Bacteria 6250
28 2227086385 2225789004 Bacteria 9931
29 Ga0068305_10025267 3300005083 Bacteria 4155
30 Ga0072941_1013455 3300005201 Bacteria 31411
31 Ga0072941_1038660 3300005201 Bacteria 7629
32 Ga0102734_1000047 3300007129 Bacteria 103490
33 Ga0160436_1001087 3300012861 Bacteria 7963
34 Ga0415639_050709 3300038395 Bacteria 6176
35 Ga0466710_057586 3300042613 Bacteria 11776
36 Ga0466706_164052 3300042599 Bacteria 208763
37 Ga0466706_165915 3300042599 Bacteria 2298
38 Ga0466706_240352 3300042599 Bacteria 3874
39 Ga0466707_202459 3300042601 Bacteria 205011
40 Ga0466729_247344 3300042621 Bacteria 73177
41 Ga0466729_295951 3300042621 Bacteria 5398
42 Ga0466729_317512 3300042621 Bacteria 15877
43 Ga0466704_207348 3300042643 Bacteria 1872
44 Ga0123353_10076349 3300010167 Bacteria 5384
45 Ga0466705_135026 3300042612 Bacteria 3416
46 Ga0466705_237790 3300042612 Bacteria 16604
47 Ga0103261_1000128 3300007083 Unclassified 13565
48 Ga0102739_1000036 3300007095 Bacteria 38325
49 Ga0102737_1000382 3300007142 Bacteria 28336
50 Ga0415639_117293 3300038395 Unclassified 8290
51 Ga0466715_147951 3300042616 Bacteria 8869
52 Ga0466715_230222 3300042616 Bacteria 2799
53 Ga0466723_319943 3300042618 Bacteria 6380
54 Ga0466706_234606 3300042599 Bacteria 15733
55 Ga0466706_280858 3300042599 Bacteria 94293
56 Ga0466716_109659 3300042605 Bacteria 2508
57 Ga0466734_089088 3300042623 Bacteria 3181
58 Ga0466703_222210 3300042636 Bacteria 13927
59 Ga0123353_10036459 3300010167 Bacteria 7703
60 Ga0123353_10117051 3300010167 Bacteria 4287
61 Ga0123353_10632173 3300010167 Bacteria 1520
62 JGI24703J35330_11574549 3300002501 Bacteria 1291
63 Ga0072941_1169045 3300005201 Bacteria 4304
64 Ga0102740_1000095 3300007140 Bacteria 35846
65 Ga0466711_368837 3300042615 Bacteria 1183
66 Ga0466726_074357 3300042619 Bacteria 12107
67 Ga0466706_014651 3300042599 Bacteria 4895
68 Ga0466706_043454 3300042599 Bacteria 1531
69 Ga0466706_203587 3300042599 Unclassified 24676
70 Ga0466734_119299 3300042623 Bacteria 1030
71 Ga0123357_10251169 3300009784 Bacteria 1892
72 Ga0123353_10108040 3300010167 Bacteria 4484
73 Ga0123353_10180741 3300010167 Bacteria 3340
74 Ga0123353_10369422 3300010167 Bacteria 2151
75 Ga0466705_377302 3300042612 Bacteria 3549
76 JGI24702J35022_10002230 3300002462 Bacteria 11920
77 JGI24703J35330_11739875 3300002501 Bacteria 3342
78 Ga0072941_1125384 3300005201 Bacteria 3749
79 Ga0103260_1000074 3300007139 Bacteria 26630
80 Ga0160436_1000520 3300012861 Bacteria 14318
81 Ga0415639_046650 3300038395 Bacteria 1046
82 Ga0466711_237586 3300042615 Bacteria 1736
83 Ga0466715_261140 3300042616 Bacteria 3000
84 Ga0466726_037756 3300042619 Bacteria 4181
85 Ga0466728_046430 3300042620 Bacteria 43059
86 Ga0466701_019515 3300042598 Bacteria 190398
87 Ga0466706_067670 3300042599 Bacteria 6326
88 Ga0466706_134420 3300042599 Bacteria 46018
89 Ga0466714_071134 3300042603 Bacteria 11114
90 Ga0466719_088608 3300042606 Bacteria 1009
91 Ga0466703_181159 3300042636 Bacteria 6692
92 Ga0466724_43013 3300042649 Bacteria 36848
93 Ga0123357_10388607 3300009784 Bacteria 1285
94 Ga0123355_10460253 3300009826 Bacteria 1597
95 Ga0123356_10008250 3300010049 Bacteria 10365
96 Ga0123353_10287142 3300010167 Bacteria 2522
97 Ga0466733_122410 3300042659 Bacteria 24342
98 Ga0530661_000158 3300056564 Bacteria 60301
99 IMNBL1DRAFT_c0023659 3300000062 Bacteria 2403
100 JGI24703J35330_11348756 3300002501 Bacteria 899
101 JGI24703J35330_11748852 3300002501 Bacteria 50255
102 CVPL010W_10004989 3300002931 Bacteria 14793
103 Ga0068305_10384425 3300005083 Bacteria 4324
104 Ga0072940_1210426 3300005200 Bacteria 1081
105 Ga0102736_1000036 3300007052 Unclassified 41208
106 Ga0102738_1000195 3300007141 Bacteria 14677
107 Ga0415639_069138 3300038395 Bacteria 9688
108 Ga0415639_137335 3300038395 Bacteria 3105
109 Ga0466699_160235 3300042597 Bacteria 1328
110 Ga0466723_073678 3300042618 Bacteria 19551
111 Ga0466723_339180 3300042618 Bacteria 3805
112 Ga0466701_044349 3300042598 Bacteria 7090
113 Ga0466706_053616 3300042599 Bacteria 2114
114 Ga0466706_115768 3300042599 Bacteria 24582
115 Ga0466706_124034 3300042599 Bacteria 12629
116 Ga0466707_153818 3300042601 Bacteria 78814
117 Ga0466713_088502 3300042602 Bacteria 43318
118 Ga0466717_014536 3300042604 Bacteria 5715
119 Ga0466721_061369 3300042608 Bacteria 5638
120 Ga0466704_017914 3300042643 Bacteria 16770
121 Ga0123355_10038884 3300009826 Bacteria 7737
122 Ga0123355_10112457 3300009826 Bacteria 4250
123 Ga0123355_10154379 3300009826 Bacteria 3477
124 Ga0123355_10180787 3300009826 Unclassified 3131
125 Ga0123355_10282436 3300009826 Bacteria 2290
126 Ga0123355_10348108 3300009826 Bacteria 1966
127 Ga0123355_11082034 3300009826 Bacteria 837
128 Ga0123356_10184479 3300010049 Bacteria 2111
129 Ga0123356_10262906 3300010049 Bacteria 1811
130 Ga0123353_10110583 3300010167 Bacteria 4427
131 Ga0123353_11444171 3300010167 Bacteria 881
132 Ga0160464_100676 3300012805 Bacteria 20532
133 IMNBL1DRAFT_c0000312 3300000062 Bacteria 41387
134 JGI24702J35022_10007152 3300002462 Bacteria 6416
135 Ga0072941_1023234 3300005201 Unclassified 19251
136 Ga0103263_100112 3300007042 Bacteria 23715
137 Ga0247289_0650 3300035363 Bacteria 4537
138 Ga0466690_397241 3300042590 Unclassified 4875
139 Ga0466696_029793 3300042596 Bacteria 3441
140 Ga0466696_445403 3300042596 Bacteria 4029
141 Ga0466715_499972 3300042616 Bacteria 39477
142 Ga0466706_115224 3300042599 Bacteria 42735
143 Ga0466713_087963 3300042602 Bacteria 29681
144 Ga0466713_121343 3300042602 Bacteria 46873
145 Ga0466714_154169 3300042603 Bacteria 2237
146 Ga0466721_164266 3300042608 Bacteria 1312
147 Ga0123355_10021583 3300009826 Bacteria 10308
148 Ga0123356_10057146 3300010049 Bacteria 3636
149 Ga0123356_10430351 3300010049 Bacteria 1464
150 Ga0123353_10014617 3300010167 Bacteria 11330
151 Ga0123353_10028155 3300010167 Bacteria 8626
152 Ga0123354_10529901 3300010882 Bacteria 900

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11444171 Ga0123353_114441711 233
2 3300005200 Ga0072940_1210426 Ga0072940_12104261 236
3 3300042612 Ga0466705_135026 Ga0466705_135026_21_731 236
4 3300010167 Ga0123353_10057118 Ga0123353_100571182 238
5 3300010049 Ga0123356_10430351 Ga0123356_104303512 239
6 3300012805 Ga0160464_100676 Ga0160464_10067610 240
7 3300042608 Ga0466721_061369 Ga0466721_061369_4740_5510 243
8 3300042608 Ga0466721_164266 Ga0466721_164266_259_996 245
9 3300042615 Ga0466711_381864 Ga0466711_381864_10944_11681 245
10 3300042599 Ga0466706_280858 Ga0466706_280858_51804_52544 246
11 3300042618 Ga0466723_073678 Ga0466723_073678_11464_12204 246
12 iso_pr_bacteria 2671180705 2673868782 246
13 iso_pr_bacteria 2820495292 2820495676 246
14 3300009826 Ga0123355_10180787 Ga0123355_101807874 247
15 iso_pr_bacteria 2902916284 2902919887 247
16 3300009826 Ga0123355_10154379 Ga0123355_101543792 248
17 3300042616 Ga0466715_147951 Ga0466715_147951_3024_3770 248
18 3300042621 Ga0466729_317512 Ga0466729_317512_5883_6629 248
19 3300042643 Ga0466704_207348 Ga0466704_207348_900_1646 248
20 iso_pr_bacteria 2590828840 2593256455 248
21 iso_pr_bacteria 2820457604 2820458984 248
22 iso_pr_bacteria 2820506701 2820507317 248
23 3300000062 IMNBL1DRAFT_c0000312 IMNBL1DRAFT_000031214 249
24 3300002501 JGI24703J35330_11574549 JGI24703J35330_115745491 249
25 3300009826 Ga0123355_10002083 Ga0123355_1000208314 249
26 3300009826 Ga0123355_11082034 Ga0123355_110820341 249
27 3300010167 Ga0123353_10036459 Ga0123353_100364595 249
28 3300042615 Ga0466711_368837 Ga0466711_368837_398_1147 249
29 3300042621 Ga0466729_295951 Ga0466729_295951_3279_4028 249
30 3300042623 Ga0466734_119299 Ga0466734_119299_262_1011 249
31 iso_pr_bacteria 2636416028 2638996641 249
32 iso_pr_bacteria 2873562573 2873563934 249
33 iso_pr_bacteria 2902896024 2902898396 249
34 iso_pr_bacteria 2989309576 2989313057 249
35 3300000089 AustNasuHG_c1007329 AustNasuHG_10073294 250
36 3300002501 JGI24703J35330_11348756 JGI24703J35330_113487561 250
37 3300002501 JGI24703J35330_11739875 JGI24703J35330_117398752 250
38 3300002501 JGI24703J35330_11745442 JGI24703J35330_117454422 250
39 3300002501 JGI24703J35330_11748852 JGI24703J35330_1174885238 250
40 3300005201 Ga0072941_1023234 Ga0072941_102323415 250
41 3300005201 Ga0072941_1038660 Ga0072941_10386605 250
42 3300005201 Ga0072941_1169045 Ga0072941_11690453 250
43 3300009826 Ga0123355_10038884 Ga0123355_100388846 250
44 3300009826 Ga0123355_10091883 Ga0123355_100918833 250
45 3300009826 Ga0123355_10112457 Ga0123355_101124572 250
46 3300009826 Ga0123355_10282436 Ga0123355_102824363 250
47 3300009826 Ga0123355_10460253 Ga0123355_104602532 250
48 3300009826 Ga0123355_10730886 Ga0123355_107308862 250
49 3300038395 Ga0415639_046650 Ga0415639_046650_43_795 250
50 3300042596 Ga0466696_029793 Ga0466696_029793_2653_3405 250
51 3300042599 Ga0466706_240352 Ga0466706_240352_2744_3496 250
52 3300042623 Ga0466734_125451 Ga0466734_125451_618_1370 250
53 3300042652 Ga0466708_059311 Ga0466708_059311_13859_14611 250
54 iso_pr_bacteria 2523231078 2523493361 250
55 iso_pr_bacteria 2820393573 2820393948 250
56 iso_pr_bacteria 2849099867 2849104299 250
57 iso_pr_bacteria 2849104611 2849104916 250
58 iso_pr_bacteria 2850744690 2850744967 250
59 iso_pr_bacteria 2852337885 2852340839 250
60 iso_pr_bacteria 641736255 641741321 250
61 iso_pr_bacteria 651324002 651579431 250
62 2225789004 2227479905 2227936752 251
63 3300005201 Ga0072941_1057665 Ga0072941_105766513 251
64 3300010167 Ga0123353_10117051 Ga0123353_101170513 251
65 3300010167 Ga0123353_10180741 Ga0123353_101807412 251
66 3300010167 Ga0123353_10287142 Ga0123353_102871422 251
67 3300035363 Ga0247289_0650 Ga0247289_0650_2185_2940 251
68 3300042597 Ga0466699_160235 Ga0466699_160235_78_833 251
69 3300042598 Ga0466701_019515 Ga0466701_019515_125601_126356 251
70 3300042598 Ga0466701_044349 Ga0466701_044349_3468_4223 251
71 3300042602 Ga0466713_087963 Ga0466713_087963_2446_3201 251
72 3300042603 Ga0466714_071134 Ga0466714_071134_127_882 251
73 3300042603 Ga0466714_154169 Ga0466714_154169_1253_2008 251
74 3300042604 Ga0466717_046344 Ga0466717_046344_69_824 251
75 3300042612 Ga0466705_237790 Ga0466705_237790_11024_11779 251
76 3300042613 Ga0466710_057586 Ga0466710_057586_9837_10592 251
77 3300042618 Ga0466723_339180 Ga0466723_339180_1498_2253 251
78 3300042621 Ga0466729_247344 Ga0466729_247344_23410_24165 251
79 3300042623 Ga0466734_055737 Ga0466734_055737_247_1002 251
80 3300042636 Ga0466703_181159 Ga0466703_181159_2179_2934 251
81 3300042649 Ga0466724_43013 Ga0466724_43013_100_855 251
82 iso_pr_bacteria 2731957677 2732687308 251
83 iso_pr_bacteria 2772190895 2773441294 251
84 iso_pr_bacteria 2820367663 2820369612 251
85 iso_pr_bacteria 2820510699 2820510835 251
86 iso_pr_bacteria 2900804455 2900806277 251
87 iso_pr_bacteria 2914375287 2914376059 251
88 iso_pr_bacteria 8064531044 8064534240 251
89 3300005083 Ga0068305_10025267 Ga0068305_100252673 252
90 3300005083 Ga0068305_10384425 Ga0068305_103844254 252
91 3300005201 Ga0072941_1174662 Ga0072941_11746622 252
92 3300007129 Ga0102734_1000033 Ga0102734_10000332 252
93 3300009826 Ga0123355_10348108 Ga0123355_103481082 252
94 3300010049 Ga0123356_10008250 Ga0123356_100082508 252
95 3300010049 Ga0123356_10057146 Ga0123356_100571465 252
96 3300010167 Ga0123353_10108040 Ga0123353_101080403 252
97 3300010167 Ga0123353_10213092 Ga0123353_102130923 252
98 3300010882 Ga0123354_10529901 Ga0123354_105299011 252
99 3300012849 Ga0160447_101485 Ga0160447_10148510 252
100 3300012861 Ga0160436_1000520 Ga0160436_100052013 252
101 3300012861 Ga0160436_1001087 Ga0160436_10010877 252
102 3300038395 Ga0415639_013362 Ga0415639_013362_11206_11964 252
103 3300042602 Ga0466713_121343 Ga0466713_121343_1213_1971 252
104 3300042606 Ga0466719_088608 Ga0466719_088608_217_975 252
105 3300042612 Ga0466705_377302 Ga0466705_377302_482_1240 252
106 3300042616 Ga0466715_230222 Ga0466715_230222_1590_2348 252
107 3300042620 Ga0466728_046430 Ga0466728_046430_19893_20651 252
108 3300042623 Ga0466734_089088 Ga0466734_089088_658_1416 252
109 iso_pr_bacteria 8082023105 8082026514 252
110 3300002462 JGI24702J35022_10007152 JGI24702J35022_100071526 253
111 3300005083 Ga0068305_10165488 Ga0068305_1016548811 253
112 3300010167 Ga0123353_10632173 Ga0123353_106321732 253
113 3300038395 Ga0415639_117293 Ga0415639_117293_5022_5783 253
114 3300042593 Ga0466691_219068 Ga0466691_219068_139_900 253
115 3300042599 Ga0466706_165915 Ga0466706_165915_472_1233 253
116 3300042599 Ga0466706_253000 Ga0466706_253000_1680_2441 253
117 3300042601 Ga0466707_153818 Ga0466707_153818_5344_6105 253
118 3300042601 Ga0466707_202459 Ga0466707_202459_54524_55285 253
119 3300042605 Ga0466716_109659 Ga0466716_109659_373_1134 253
120 iso_pr_bacteria 2791355481 2794425458 253
121 iso_pr_bacteria 2820263778 2820264358 253
122 iso_pr_bacteria 2820477775 2820478089 253
123 iso_pr_bacteria 2864909992 2864911865 253
124 iso_pr_bacteria 8043041867 8043044121 253
125 3300002931 CVPL010W_10004989 CVPL010W_100049894 254
126 3300007083 Ga0103261_1000128 Ga0103261_10001283 254
127 3300007139 Ga0103260_1000074 Ga0103260_100007422 254
128 3300007140 Ga0102740_1000095 Ga0102740_10000953 254
129 3300007141 Ga0102738_1000195 Ga0102738_100019512 254
130 3300007142 Ga0102737_1000382 Ga0102737_10003823 254
131 3300009784 Ga0123357_10251169 Ga0123357_102511692 254
132 3300010167 Ga0123353_10369422 Ga0123353_103694222 254
133 3300042599 Ga0466706_067670 Ga0466706_067670_565_1329 254
134 3300042599 Ga0466706_124034 Ga0466706_124034_7750_8514 254
135 3300042602 Ga0466713_088502 Ga0466713_088502_41069_41833 254
136 3300042616 Ga0466715_499972 Ga0466715_499972_33565_34329 254
137 3300056564 Ga0530661_000158 Ga0530661_000158_50690_51454 254
138 iso_pr_bacteria 2820244222 2820245964 254
139 iso_pr_bacteria 2820250282 2820252317 254
140 iso_pr_bacteria 2820420508 2820421546 254
141 iso_pr_bacteria 2820424542 2820424809 254
142 2225789004 2227528804 2228039040 255
143 3300002462 JGI24702J35022_10002230 JGI24702J35022_100022305 255
144 3300007042 Ga0103263_100112 Ga0103263_10011222 255
145 3300007052 Ga0102736_1000036 Ga0102736_100003641 255
146 3300007095 Ga0102739_1000036 Ga0102739_100003632 255
147 3300007129 Ga0102734_1000047 Ga0102734_100004780 255
148 3300009826 Ga0123355_10021583 Ga0123355_100215839 255
149 3300010167 Ga0123353_10000142 Ga0123353_1000014234 255
150 3300010167 Ga0123353_10014617 Ga0123353_100146175 255
151 3300038395 Ga0415639_069138 Ga0415639_069138_2335_3102 255
152 3300042659 Ga0466733_122410 Ga0466733_122410_21710_22477 255
153 2225789004 2227086385 2227463347 256
154 3300038395 Ga0415639_050709 Ga0415639_050709_296_1066 256
155 3300038395 Ga0415639_137335 Ga0415639_137335_1527_2297 256
156 3300042599 Ga0466706_014651 Ga0466706_014651_4066_4836 256
157 3300042599 Ga0466706_043454 Ga0466706_043454_141_911 256
158 3300042599 Ga0466706_053616 Ga0466706_053616_1164_1934 256
159 3300042599 Ga0466706_115224 Ga0466706_115224_6986_7756 256
160 3300042599 Ga0466706_115768 Ga0466706_115768_23541_24311 256
161 3300042599 Ga0466706_134420 Ga0466706_134420_19852_20622 256
162 3300042599 Ga0466706_164052 Ga0466706_164052_146024_146794 256
163 3300042599 Ga0466706_203587 Ga0466706_203587_330_1100 256
164 3300042599 Ga0466706_234606 Ga0466706_234606_10459_11229 256
165 3300042636 Ga0466703_222210 Ga0466703_222210_6467_7237 256
166 iso_pr_bacteria 2820811576 2820811820 256
167 iso_pr_bacteria 2820813074 2820814467 256
168 3300010049 Ga0123356_10184479 Ga0123356_101844792 257
169 3300042643 Ga0466704_017914 Ga0466704_017914_7212_8006 257
170 3300005071 Ga0068302_10587118 Ga0068302_105871182 258
171 3300010167 Ga0123353_10110583 Ga0123353_101105831 258
172 3300042590 Ga0466690_397241 Ga0466690_397241_626_1432 258
173 3300042615 Ga0466711_237586 Ga0466711_237586_300_1076 258
174 3300042619 Ga0466726_037756 Ga0466726_037756_2776_3552 258
175 iso_pr_bacteria 2998833917 2998834107 258
176 3300005201 Ga0072941_1013455 Ga0072941_101345527 259
177 3300005201 Ga0072941_1125384 Ga0072941_11253842 259
178 3300005201 Ga0072941_1289851 Ga0072941_12898512 259
179 3300010167 Ga0123353_10076349 Ga0123353_100763491 259
180 3300042596 Ga0466696_445403 Ga0466696_445403_1471_2250 259
181 3300009784 Ga0123357_10388607 Ga0123357_103886071 261
182 3300010882 Ga0123354_10259063 Ga0123354_102590632 262
183 3300042619 Ga0466726_074357 Ga0466726_074357_10979_11773 264
184 3300000062 IMNBL1DRAFT_c0023659 IMNBL1DRAFT_00236593 266
185 3300042604 Ga0466717_014536 Ga0466717_014536_1143_1979 266
186 3300042648 Ga0466709_036643 Ga0466709_036643_96_896 266
187 3300042618 Ga0466723_319943 Ga0466723_319943_632_1435 267
188 iso_pr_bacteria 2529293168 2531453442 267
189 3300010049 Ga0123356_10262906 Ga0123356_102629062 273
190 3300042616 Ga0466715_261140 Ga0466715_261140_98_934 278
191 3300010167 Ga0123353_10028155 Ga0123353_100281552 290

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00121 TIM Triosephosphate isomerase 43 287 0.98

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00121 GO:0004807 triose-phosphate isomerase activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.