Protein Family IF03081
Metagenome
Isolate
191
Members
97
Samples
152
Scaffolds
252.62
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10028155|Ga0123353_100281552
- Length
- 290 aa
- Sequence
- VFLSIGVAIPQCQNSRGRHKALPCGDKQIERMAITMDKTKRRPIIAGNWKMNKNPAEARELIRAIKPLVENADCEVVACVPFVDLKDIIDETTGTNIKAGAQNCHFEEKGAFTGEISAPMLKNIGAEYVIIGHSERRTYFGETDSAVNLRTKAALGQGLKVILCVGEYLEQRERGITFEIVRMQTKIALDGVNAEMLKNVVIAYEPVWAIGTGKTATAEQANEVCKGIRDLIGELCGAAAAEAVAVQYGGSMNAKNAAELLSMPDIDGGLIGGASLVPEDFAAIVSAAG*
Sample Types
Isolate
20.4%
Metagenome
79.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
28.4%
Termitidae
22.1%
Kalotermitidae
15.8%
Formicidae
10.5%
Apidae
3.2%
Scarabaeidae
3.2%
Termopsidae
2.1%
Passalidae
2.1%
Culicidae
2.1%
Elmidae
1.1%
Rhinotermitidae
1.1%
Chrysomelidae
1.1%
Penaeidae
1.1%
Hydrophilidae
1.1%
Tenebrionidae
1.1%
Hodotermitidae
1.1%
Ceratopogonidae
1.1%
Nephropidae
1.1%
Plutellidae
1.1%
Taxonomy
Archaea
0
Bacteria
181
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820811576 | Unclassified Actinobacteria Nt197P3bin53 | Isolate | Unclassified |
| 2 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 3 | 2902896024 | Pseudoalteromonas sp. S1612 | Isolate | Unclassified |
| 4 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 5 | 2590828840 | Clostridium sp. 2 | Isolate | Termitidae |
| 6 | 2820367663 | Unclassified Firmicutes Nt197P3bin105 | Isolate | Unclassified |
| 7 | 2820477775 | Unclassified Firmicutes Lab288P1bin79 | Isolate | Unclassified |
| 8 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300007042 | Ant gut microbial communities from Cephalotes pusillus, Brazil | Metagenome | Formicidae |
| 17 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 18 | 2523231078 | Paenibacillus larvae larvae 4-309, DSM 25430 | Isolate | Apidae |
| 19 | 2820506701 | Unclassified Firmicutes Lab288P1bin46 | Isolate | Unclassified |
| 20 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 24 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 25 | 2998833917 | Enterobacteriaceae endosymbiont of Donacia clavipes DclaSym | Isolate | Chrysomelidae |
| 26 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 27 | 2671180705 | Pseudoalteromonas piscicida S2040 | Isolate | Unclassified |
| 28 | 2820250282 | Unclassified Firmicutes Th196P3bin66 | Isolate | Unclassified |
| 29 | 2820393573 | Unclassified Firmicutes Nc150P1bin9 | Isolate | Unclassified |
| 30 | 2772190895 | Unclassified Elusimicrobia Emb289P1_bin39 | Isolate | Unclassified |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 36 | 3300007129 | Ant gut microbial communities from Cephalotes atratus, Brazil | Metagenome | Formicidae |
| 37 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 38 | 2849099867 | Paenibacillus larvae larvae ERIC_I | Isolate | Unclassified |
| 39 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 40 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 41 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 42 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 43 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 44 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 45 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 46 | 2820813074 | Unclassified Actinobacteria Nt197P3bin52 | Isolate | Unclassified |
| 47 | 2849104611 | Paenibacillus larvae larvae Eric_IV | Isolate | Apidae |
| 48 | 2873562573 | Thermomonas sp. HDW16 | Isolate | Hydrophilidae |
| 49 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 50 | 2820495292 | Unclassified Firmicutes Lab288P1bin59 | Isolate | Unclassified |
| 51 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 52 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 53 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 54 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 55 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 56 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 57 | 3300002931 | Ant worker gut metagenome for colony PL010 | Metagenome | Formicidae |
| 58 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 59 | 3300007052 | Ant gut microbial communities from Cephalotes eduarduli, Brazil | Metagenome | Formicidae |
| 60 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 61 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 62 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 63 | 2902916284 | Pseudoalteromonas rubra S1946 | Isolate | Unclassified |
| 64 | 2914375287 | Culicoidibacter larvae CS-1 | Isolate | Ceratopogonidae |
| 65 | 2731957677 | Alkalihalobacillus trypoxylicola NBRC 102646 | Isolate | Scarabaeidae |
| 66 | 2820263778 | Unclassified Firmicutes Th196P3bin37 | Isolate | Unclassified |
| 67 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 68 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 69 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 70 | 641736255 | Paenibacillus larvae larvae BRL-230010 | Isolate | Unclassified |
| 71 | 651324002 | Acetonema longum APO-1, DSM 6540 | Isolate | Kalotermitidae |
| 72 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 73 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 74 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 75 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 76 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 77 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 78 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 79 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 80 | 2820510699 | Unclassified Firmicutes Lab288P1bin40 | Isolate | Unclassified |
| 81 | 8064531044 | Terrisporobacter mayombei DSM 6539 | Isolate | Unclassified |
| 82 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 83 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 84 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 85 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 86 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 87 | 3300007141 | Ant gut microbial communities from Cephalotes maculatus, Brazil | Metagenome | Formicidae |
| 88 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 89 | 3300035363 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - pupa gut | Metagenome | Plutellidae |
| 90 | 2850744690 | Paenibacillus larvae larvae DSM 25430 | Isolate | Apidae |
| 91 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 92 | 2820244222 | Unclassified Firmicutes Th196P3bin75 | Isolate | Unclassified |
| 93 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 94 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 95 | 3300007139 | Ant gut microbial communities from Cephalotes pellans, Brazil | Metagenome | Formicidae |
| 96 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 97 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | 2227479905 | 2225789004 | Bacteria | 4467 |
| 2 | Ga0068305_10165488 | 3300005083 | Bacteria | 7990 |
| 3 | Ga0072941_1057665 | 3300005201 | Bacteria | 38454 |
| 4 | Ga0072941_1174662 | 3300005201 | Unclassified | 1894 |
| 5 | Ga0072941_1289851 | 3300005201 | Unclassified | 1627 |
| 6 | Ga0102734_1000033 | 3300007129 | Bacteria | 71720 |
| 7 | Ga0466711_381864 | 3300042615 | Bacteria | 71251 |
| 8 | Ga0466734_055737 | 3300042623 | Bacteria | 4711 |
| 9 | Ga0466709_036643 | 3300042648 | Bacteria | 1264 |
| 10 | Ga0123355_10091883 | 3300009826 | Bacteria | 4810 |
| 11 | Ga0123353_10213092 | 3300010167 | Bacteria | 3028 |
| 12 | Ga0123354_10259063 | 3300010882 | Bacteria | 1742 |
| 13 | 2227528804 | 2225789004 | Bacteria | 3190 |
| 14 | AustNasuHG_c1007329 | 3300000089 | Bacteria | 3928 |
| 15 | JGI24703J35330_11745442 | 3300002501 | Bacteria | 4592 |
| 16 | Ga0068302_10587118 | 3300005071 | Bacteria | 2658 |
| 17 | Ga0160447_101485 | 3300012849 | Unclassified | 9079 |
| 18 | Ga0415639_013362 | 3300038395 | Bacteria | 13522 |
| 19 | Ga0466691_219068 | 3300042593 | Bacteria | 1252 |
| 20 | Ga0466706_253000 | 3300042599 | Bacteria | 8725 |
| 21 | Ga0466717_046344 | 3300042604 | Bacteria | 5820 |
| 22 | Ga0466734_125451 | 3300042623 | Bacteria | 1827 |
| 23 | Ga0466708_059311 | 3300042652 | Bacteria | 20368 |
| 24 | Ga0123355_10002083 | 3300009826 | Bacteria | 28232 |
| 25 | Ga0123355_10730886 | 3300009826 | Bacteria | 1126 |
| 26 | Ga0123353_10000142 | 3300010167 | Bacteria | 87975 |
| 27 | Ga0123353_10057118 | 3300010167 | Bacteria | 6250 |
| 28 | 2227086385 | 2225789004 | Bacteria | 9931 |
| 29 | Ga0068305_10025267 | 3300005083 | Bacteria | 4155 |
| 30 | Ga0072941_1013455 | 3300005201 | Bacteria | 31411 |
| 31 | Ga0072941_1038660 | 3300005201 | Bacteria | 7629 |
| 32 | Ga0102734_1000047 | 3300007129 | Bacteria | 103490 |
| 33 | Ga0160436_1001087 | 3300012861 | Bacteria | 7963 |
| 34 | Ga0415639_050709 | 3300038395 | Bacteria | 6176 |
| 35 | Ga0466710_057586 | 3300042613 | Bacteria | 11776 |
| 36 | Ga0466706_164052 | 3300042599 | Bacteria | 208763 |
| 37 | Ga0466706_165915 | 3300042599 | Bacteria | 2298 |
| 38 | Ga0466706_240352 | 3300042599 | Bacteria | 3874 |
| 39 | Ga0466707_202459 | 3300042601 | Bacteria | 205011 |
| 40 | Ga0466729_247344 | 3300042621 | Bacteria | 73177 |
| 41 | Ga0466729_295951 | 3300042621 | Bacteria | 5398 |
| 42 | Ga0466729_317512 | 3300042621 | Bacteria | 15877 |
| 43 | Ga0466704_207348 | 3300042643 | Bacteria | 1872 |
| 44 | Ga0123353_10076349 | 3300010167 | Bacteria | 5384 |
| 45 | Ga0466705_135026 | 3300042612 | Bacteria | 3416 |
| 46 | Ga0466705_237790 | 3300042612 | Bacteria | 16604 |
| 47 | Ga0103261_1000128 | 3300007083 | Unclassified | 13565 |
| 48 | Ga0102739_1000036 | 3300007095 | Bacteria | 38325 |
| 49 | Ga0102737_1000382 | 3300007142 | Bacteria | 28336 |
| 50 | Ga0415639_117293 | 3300038395 | Unclassified | 8290 |
| 51 | Ga0466715_147951 | 3300042616 | Bacteria | 8869 |
| 52 | Ga0466715_230222 | 3300042616 | Bacteria | 2799 |
| 53 | Ga0466723_319943 | 3300042618 | Bacteria | 6380 |
| 54 | Ga0466706_234606 | 3300042599 | Bacteria | 15733 |
| 55 | Ga0466706_280858 | 3300042599 | Bacteria | 94293 |
| 56 | Ga0466716_109659 | 3300042605 | Bacteria | 2508 |
| 57 | Ga0466734_089088 | 3300042623 | Bacteria | 3181 |
| 58 | Ga0466703_222210 | 3300042636 | Bacteria | 13927 |
| 59 | Ga0123353_10036459 | 3300010167 | Bacteria | 7703 |
| 60 | Ga0123353_10117051 | 3300010167 | Bacteria | 4287 |
| 61 | Ga0123353_10632173 | 3300010167 | Bacteria | 1520 |
| 62 | JGI24703J35330_11574549 | 3300002501 | Bacteria | 1291 |
| 63 | Ga0072941_1169045 | 3300005201 | Bacteria | 4304 |
| 64 | Ga0102740_1000095 | 3300007140 | Bacteria | 35846 |
| 65 | Ga0466711_368837 | 3300042615 | Bacteria | 1183 |
| 66 | Ga0466726_074357 | 3300042619 | Bacteria | 12107 |
| 67 | Ga0466706_014651 | 3300042599 | Bacteria | 4895 |
| 68 | Ga0466706_043454 | 3300042599 | Bacteria | 1531 |
| 69 | Ga0466706_203587 | 3300042599 | Unclassified | 24676 |
| 70 | Ga0466734_119299 | 3300042623 | Bacteria | 1030 |
| 71 | Ga0123357_10251169 | 3300009784 | Bacteria | 1892 |
| 72 | Ga0123353_10108040 | 3300010167 | Bacteria | 4484 |
| 73 | Ga0123353_10180741 | 3300010167 | Bacteria | 3340 |
| 74 | Ga0123353_10369422 | 3300010167 | Bacteria | 2151 |
| 75 | Ga0466705_377302 | 3300042612 | Bacteria | 3549 |
| 76 | JGI24702J35022_10002230 | 3300002462 | Bacteria | 11920 |
| 77 | JGI24703J35330_11739875 | 3300002501 | Bacteria | 3342 |
| 78 | Ga0072941_1125384 | 3300005201 | Bacteria | 3749 |
| 79 | Ga0103260_1000074 | 3300007139 | Bacteria | 26630 |
| 80 | Ga0160436_1000520 | 3300012861 | Bacteria | 14318 |
| 81 | Ga0415639_046650 | 3300038395 | Bacteria | 1046 |
| 82 | Ga0466711_237586 | 3300042615 | Bacteria | 1736 |
| 83 | Ga0466715_261140 | 3300042616 | Bacteria | 3000 |
| 84 | Ga0466726_037756 | 3300042619 | Bacteria | 4181 |
| 85 | Ga0466728_046430 | 3300042620 | Bacteria | 43059 |
| 86 | Ga0466701_019515 | 3300042598 | Bacteria | 190398 |
| 87 | Ga0466706_067670 | 3300042599 | Bacteria | 6326 |
| 88 | Ga0466706_134420 | 3300042599 | Bacteria | 46018 |
| 89 | Ga0466714_071134 | 3300042603 | Bacteria | 11114 |
| 90 | Ga0466719_088608 | 3300042606 | Bacteria | 1009 |
| 91 | Ga0466703_181159 | 3300042636 | Bacteria | 6692 |
| 92 | Ga0466724_43013 | 3300042649 | Bacteria | 36848 |
| 93 | Ga0123357_10388607 | 3300009784 | Bacteria | 1285 |
| 94 | Ga0123355_10460253 | 3300009826 | Bacteria | 1597 |
| 95 | Ga0123356_10008250 | 3300010049 | Bacteria | 10365 |
| 96 | Ga0123353_10287142 | 3300010167 | Bacteria | 2522 |
| 97 | Ga0466733_122410 | 3300042659 | Bacteria | 24342 |
| 98 | Ga0530661_000158 | 3300056564 | Bacteria | 60301 |
| 99 | IMNBL1DRAFT_c0023659 | 3300000062 | Bacteria | 2403 |
| 100 | JGI24703J35330_11348756 | 3300002501 | Bacteria | 899 |
| 101 | JGI24703J35330_11748852 | 3300002501 | Bacteria | 50255 |
| 102 | CVPL010W_10004989 | 3300002931 | Bacteria | 14793 |
| 103 | Ga0068305_10384425 | 3300005083 | Bacteria | 4324 |
| 104 | Ga0072940_1210426 | 3300005200 | Bacteria | 1081 |
| 105 | Ga0102736_1000036 | 3300007052 | Unclassified | 41208 |
| 106 | Ga0102738_1000195 | 3300007141 | Bacteria | 14677 |
| 107 | Ga0415639_069138 | 3300038395 | Bacteria | 9688 |
| 108 | Ga0415639_137335 | 3300038395 | Bacteria | 3105 |
| 109 | Ga0466699_160235 | 3300042597 | Bacteria | 1328 |
| 110 | Ga0466723_073678 | 3300042618 | Bacteria | 19551 |
| 111 | Ga0466723_339180 | 3300042618 | Bacteria | 3805 |
| 112 | Ga0466701_044349 | 3300042598 | Bacteria | 7090 |
| 113 | Ga0466706_053616 | 3300042599 | Bacteria | 2114 |
| 114 | Ga0466706_115768 | 3300042599 | Bacteria | 24582 |
| 115 | Ga0466706_124034 | 3300042599 | Bacteria | 12629 |
| 116 | Ga0466707_153818 | 3300042601 | Bacteria | 78814 |
| 117 | Ga0466713_088502 | 3300042602 | Bacteria | 43318 |
| 118 | Ga0466717_014536 | 3300042604 | Bacteria | 5715 |
| 119 | Ga0466721_061369 | 3300042608 | Bacteria | 5638 |
| 120 | Ga0466704_017914 | 3300042643 | Bacteria | 16770 |
| 121 | Ga0123355_10038884 | 3300009826 | Bacteria | 7737 |
| 122 | Ga0123355_10112457 | 3300009826 | Bacteria | 4250 |
| 123 | Ga0123355_10154379 | 3300009826 | Bacteria | 3477 |
| 124 | Ga0123355_10180787 | 3300009826 | Unclassified | 3131 |
| 125 | Ga0123355_10282436 | 3300009826 | Bacteria | 2290 |
| 126 | Ga0123355_10348108 | 3300009826 | Bacteria | 1966 |
| 127 | Ga0123355_11082034 | 3300009826 | Bacteria | 837 |
| 128 | Ga0123356_10184479 | 3300010049 | Bacteria | 2111 |
| 129 | Ga0123356_10262906 | 3300010049 | Bacteria | 1811 |
| 130 | Ga0123353_10110583 | 3300010167 | Bacteria | 4427 |
| 131 | Ga0123353_11444171 | 3300010167 | Bacteria | 881 |
| 132 | Ga0160464_100676 | 3300012805 | Bacteria | 20532 |
| 133 | IMNBL1DRAFT_c0000312 | 3300000062 | Bacteria | 41387 |
| 134 | JGI24702J35022_10007152 | 3300002462 | Bacteria | 6416 |
| 135 | Ga0072941_1023234 | 3300005201 | Unclassified | 19251 |
| 136 | Ga0103263_100112 | 3300007042 | Bacteria | 23715 |
| 137 | Ga0247289_0650 | 3300035363 | Bacteria | 4537 |
| 138 | Ga0466690_397241 | 3300042590 | Unclassified | 4875 |
| 139 | Ga0466696_029793 | 3300042596 | Bacteria | 3441 |
| 140 | Ga0466696_445403 | 3300042596 | Bacteria | 4029 |
| 141 | Ga0466715_499972 | 3300042616 | Bacteria | 39477 |
| 142 | Ga0466706_115224 | 3300042599 | Bacteria | 42735 |
| 143 | Ga0466713_087963 | 3300042602 | Bacteria | 29681 |
| 144 | Ga0466713_121343 | 3300042602 | Bacteria | 46873 |
| 145 | Ga0466714_154169 | 3300042603 | Bacteria | 2237 |
| 146 | Ga0466721_164266 | 3300042608 | Bacteria | 1312 |
| 147 | Ga0123355_10021583 | 3300009826 | Bacteria | 10308 |
| 148 | Ga0123356_10057146 | 3300010049 | Bacteria | 3636 |
| 149 | Ga0123356_10430351 | 3300010049 | Bacteria | 1464 |
| 150 | Ga0123353_10014617 | 3300010167 | Bacteria | 11330 |
| 151 | Ga0123353_10028155 | 3300010167 | Bacteria | 8626 |
| 152 | Ga0123354_10529901 | 3300010882 | Bacteria | 900 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010167 | Ga0123353_11444171 | Ga0123353_114441711 | 233 |
| 2 | 3300005200 | Ga0072940_1210426 | Ga0072940_12104261 | 236 |
| 3 | 3300042612 | Ga0466705_135026 | Ga0466705_135026_21_731 | 236 |
| 4 | 3300010167 | Ga0123353_10057118 | Ga0123353_100571182 | 238 |
| 5 | 3300010049 | Ga0123356_10430351 | Ga0123356_104303512 | 239 |
| 6 | 3300012805 | Ga0160464_100676 | Ga0160464_10067610 | 240 |
| 7 | 3300042608 | Ga0466721_061369 | Ga0466721_061369_4740_5510 | 243 |
| 8 | 3300042608 | Ga0466721_164266 | Ga0466721_164266_259_996 | 245 |
| 9 | 3300042615 | Ga0466711_381864 | Ga0466711_381864_10944_11681 | 245 |
| 10 | 3300042599 | Ga0466706_280858 | Ga0466706_280858_51804_52544 | 246 |
| 11 | 3300042618 | Ga0466723_073678 | Ga0466723_073678_11464_12204 | 246 |
| 12 | iso_pr_bacteria | 2671180705 | 2673868782 | 246 |
| 13 | iso_pr_bacteria | 2820495292 | 2820495676 | 246 |
| 14 | 3300009826 | Ga0123355_10180787 | Ga0123355_101807874 | 247 |
| 15 | iso_pr_bacteria | 2902916284 | 2902919887 | 247 |
| 16 | 3300009826 | Ga0123355_10154379 | Ga0123355_101543792 | 248 |
| 17 | 3300042616 | Ga0466715_147951 | Ga0466715_147951_3024_3770 | 248 |
| 18 | 3300042621 | Ga0466729_317512 | Ga0466729_317512_5883_6629 | 248 |
| 19 | 3300042643 | Ga0466704_207348 | Ga0466704_207348_900_1646 | 248 |
| 20 | iso_pr_bacteria | 2590828840 | 2593256455 | 248 |
| 21 | iso_pr_bacteria | 2820457604 | 2820458984 | 248 |
| 22 | iso_pr_bacteria | 2820506701 | 2820507317 | 248 |
| 23 | 3300000062 | IMNBL1DRAFT_c0000312 | IMNBL1DRAFT_000031214 | 249 |
| 24 | 3300002501 | JGI24703J35330_11574549 | JGI24703J35330_115745491 | 249 |
| 25 | 3300009826 | Ga0123355_10002083 | Ga0123355_1000208314 | 249 |
| 26 | 3300009826 | Ga0123355_11082034 | Ga0123355_110820341 | 249 |
| 27 | 3300010167 | Ga0123353_10036459 | Ga0123353_100364595 | 249 |
| 28 | 3300042615 | Ga0466711_368837 | Ga0466711_368837_398_1147 | 249 |
| 29 | 3300042621 | Ga0466729_295951 | Ga0466729_295951_3279_4028 | 249 |
| 30 | 3300042623 | Ga0466734_119299 | Ga0466734_119299_262_1011 | 249 |
| 31 | iso_pr_bacteria | 2636416028 | 2638996641 | 249 |
| 32 | iso_pr_bacteria | 2873562573 | 2873563934 | 249 |
| 33 | iso_pr_bacteria | 2902896024 | 2902898396 | 249 |
| 34 | iso_pr_bacteria | 2989309576 | 2989313057 | 249 |
| 35 | 3300000089 | AustNasuHG_c1007329 | AustNasuHG_10073294 | 250 |
| 36 | 3300002501 | JGI24703J35330_11348756 | JGI24703J35330_113487561 | 250 |
| 37 | 3300002501 | JGI24703J35330_11739875 | JGI24703J35330_117398752 | 250 |
| 38 | 3300002501 | JGI24703J35330_11745442 | JGI24703J35330_117454422 | 250 |
| 39 | 3300002501 | JGI24703J35330_11748852 | JGI24703J35330_1174885238 | 250 |
| 40 | 3300005201 | Ga0072941_1023234 | Ga0072941_102323415 | 250 |
| 41 | 3300005201 | Ga0072941_1038660 | Ga0072941_10386605 | 250 |
| 42 | 3300005201 | Ga0072941_1169045 | Ga0072941_11690453 | 250 |
| 43 | 3300009826 | Ga0123355_10038884 | Ga0123355_100388846 | 250 |
| 44 | 3300009826 | Ga0123355_10091883 | Ga0123355_100918833 | 250 |
| 45 | 3300009826 | Ga0123355_10112457 | Ga0123355_101124572 | 250 |
| 46 | 3300009826 | Ga0123355_10282436 | Ga0123355_102824363 | 250 |
| 47 | 3300009826 | Ga0123355_10460253 | Ga0123355_104602532 | 250 |
| 48 | 3300009826 | Ga0123355_10730886 | Ga0123355_107308862 | 250 |
| 49 | 3300038395 | Ga0415639_046650 | Ga0415639_046650_43_795 | 250 |
| 50 | 3300042596 | Ga0466696_029793 | Ga0466696_029793_2653_3405 | 250 |
| 51 | 3300042599 | Ga0466706_240352 | Ga0466706_240352_2744_3496 | 250 |
| 52 | 3300042623 | Ga0466734_125451 | Ga0466734_125451_618_1370 | 250 |
| 53 | 3300042652 | Ga0466708_059311 | Ga0466708_059311_13859_14611 | 250 |
| 54 | iso_pr_bacteria | 2523231078 | 2523493361 | 250 |
| 55 | iso_pr_bacteria | 2820393573 | 2820393948 | 250 |
| 56 | iso_pr_bacteria | 2849099867 | 2849104299 | 250 |
| 57 | iso_pr_bacteria | 2849104611 | 2849104916 | 250 |
| 58 | iso_pr_bacteria | 2850744690 | 2850744967 | 250 |
| 59 | iso_pr_bacteria | 2852337885 | 2852340839 | 250 |
| 60 | iso_pr_bacteria | 641736255 | 641741321 | 250 |
| 61 | iso_pr_bacteria | 651324002 | 651579431 | 250 |
| 62 | 2225789004 | 2227479905 | 2227936752 | 251 |
| 63 | 3300005201 | Ga0072941_1057665 | Ga0072941_105766513 | 251 |
| 64 | 3300010167 | Ga0123353_10117051 | Ga0123353_101170513 | 251 |
| 65 | 3300010167 | Ga0123353_10180741 | Ga0123353_101807412 | 251 |
| 66 | 3300010167 | Ga0123353_10287142 | Ga0123353_102871422 | 251 |
| 67 | 3300035363 | Ga0247289_0650 | Ga0247289_0650_2185_2940 | 251 |
| 68 | 3300042597 | Ga0466699_160235 | Ga0466699_160235_78_833 | 251 |
| 69 | 3300042598 | Ga0466701_019515 | Ga0466701_019515_125601_126356 | 251 |
| 70 | 3300042598 | Ga0466701_044349 | Ga0466701_044349_3468_4223 | 251 |
| 71 | 3300042602 | Ga0466713_087963 | Ga0466713_087963_2446_3201 | 251 |
| 72 | 3300042603 | Ga0466714_071134 | Ga0466714_071134_127_882 | 251 |
| 73 | 3300042603 | Ga0466714_154169 | Ga0466714_154169_1253_2008 | 251 |
| 74 | 3300042604 | Ga0466717_046344 | Ga0466717_046344_69_824 | 251 |
| 75 | 3300042612 | Ga0466705_237790 | Ga0466705_237790_11024_11779 | 251 |
| 76 | 3300042613 | Ga0466710_057586 | Ga0466710_057586_9837_10592 | 251 |
| 77 | 3300042618 | Ga0466723_339180 | Ga0466723_339180_1498_2253 | 251 |
| 78 | 3300042621 | Ga0466729_247344 | Ga0466729_247344_23410_24165 | 251 |
| 79 | 3300042623 | Ga0466734_055737 | Ga0466734_055737_247_1002 | 251 |
| 80 | 3300042636 | Ga0466703_181159 | Ga0466703_181159_2179_2934 | 251 |
| 81 | 3300042649 | Ga0466724_43013 | Ga0466724_43013_100_855 | 251 |
| 82 | iso_pr_bacteria | 2731957677 | 2732687308 | 251 |
| 83 | iso_pr_bacteria | 2772190895 | 2773441294 | 251 |
| 84 | iso_pr_bacteria | 2820367663 | 2820369612 | 251 |
| 85 | iso_pr_bacteria | 2820510699 | 2820510835 | 251 |
| 86 | iso_pr_bacteria | 2900804455 | 2900806277 | 251 |
| 87 | iso_pr_bacteria | 2914375287 | 2914376059 | 251 |
| 88 | iso_pr_bacteria | 8064531044 | 8064534240 | 251 |
| 89 | 3300005083 | Ga0068305_10025267 | Ga0068305_100252673 | 252 |
| 90 | 3300005083 | Ga0068305_10384425 | Ga0068305_103844254 | 252 |
| 91 | 3300005201 | Ga0072941_1174662 | Ga0072941_11746622 | 252 |
| 92 | 3300007129 | Ga0102734_1000033 | Ga0102734_10000332 | 252 |
| 93 | 3300009826 | Ga0123355_10348108 | Ga0123355_103481082 | 252 |
| 94 | 3300010049 | Ga0123356_10008250 | Ga0123356_100082508 | 252 |
| 95 | 3300010049 | Ga0123356_10057146 | Ga0123356_100571465 | 252 |
| 96 | 3300010167 | Ga0123353_10108040 | Ga0123353_101080403 | 252 |
| 97 | 3300010167 | Ga0123353_10213092 | Ga0123353_102130923 | 252 |
| 98 | 3300010882 | Ga0123354_10529901 | Ga0123354_105299011 | 252 |
| 99 | 3300012849 | Ga0160447_101485 | Ga0160447_10148510 | 252 |
| 100 | 3300012861 | Ga0160436_1000520 | Ga0160436_100052013 | 252 |
| 101 | 3300012861 | Ga0160436_1001087 | Ga0160436_10010877 | 252 |
| 102 | 3300038395 | Ga0415639_013362 | Ga0415639_013362_11206_11964 | 252 |
| 103 | 3300042602 | Ga0466713_121343 | Ga0466713_121343_1213_1971 | 252 |
| 104 | 3300042606 | Ga0466719_088608 | Ga0466719_088608_217_975 | 252 |
| 105 | 3300042612 | Ga0466705_377302 | Ga0466705_377302_482_1240 | 252 |
| 106 | 3300042616 | Ga0466715_230222 | Ga0466715_230222_1590_2348 | 252 |
| 107 | 3300042620 | Ga0466728_046430 | Ga0466728_046430_19893_20651 | 252 |
| 108 | 3300042623 | Ga0466734_089088 | Ga0466734_089088_658_1416 | 252 |
| 109 | iso_pr_bacteria | 8082023105 | 8082026514 | 252 |
| 110 | 3300002462 | JGI24702J35022_10007152 | JGI24702J35022_100071526 | 253 |
| 111 | 3300005083 | Ga0068305_10165488 | Ga0068305_1016548811 | 253 |
| 112 | 3300010167 | Ga0123353_10632173 | Ga0123353_106321732 | 253 |
| 113 | 3300038395 | Ga0415639_117293 | Ga0415639_117293_5022_5783 | 253 |
| 114 | 3300042593 | Ga0466691_219068 | Ga0466691_219068_139_900 | 253 |
| 115 | 3300042599 | Ga0466706_165915 | Ga0466706_165915_472_1233 | 253 |
| 116 | 3300042599 | Ga0466706_253000 | Ga0466706_253000_1680_2441 | 253 |
| 117 | 3300042601 | Ga0466707_153818 | Ga0466707_153818_5344_6105 | 253 |
| 118 | 3300042601 | Ga0466707_202459 | Ga0466707_202459_54524_55285 | 253 |
| 119 | 3300042605 | Ga0466716_109659 | Ga0466716_109659_373_1134 | 253 |
| 120 | iso_pr_bacteria | 2791355481 | 2794425458 | 253 |
| 121 | iso_pr_bacteria | 2820263778 | 2820264358 | 253 |
| 122 | iso_pr_bacteria | 2820477775 | 2820478089 | 253 |
| 123 | iso_pr_bacteria | 2864909992 | 2864911865 | 253 |
| 124 | iso_pr_bacteria | 8043041867 | 8043044121 | 253 |
| 125 | 3300002931 | CVPL010W_10004989 | CVPL010W_100049894 | 254 |
| 126 | 3300007083 | Ga0103261_1000128 | Ga0103261_10001283 | 254 |
| 127 | 3300007139 | Ga0103260_1000074 | Ga0103260_100007422 | 254 |
| 128 | 3300007140 | Ga0102740_1000095 | Ga0102740_10000953 | 254 |
| 129 | 3300007141 | Ga0102738_1000195 | Ga0102738_100019512 | 254 |
| 130 | 3300007142 | Ga0102737_1000382 | Ga0102737_10003823 | 254 |
| 131 | 3300009784 | Ga0123357_10251169 | Ga0123357_102511692 | 254 |
| 132 | 3300010167 | Ga0123353_10369422 | Ga0123353_103694222 | 254 |
| 133 | 3300042599 | Ga0466706_067670 | Ga0466706_067670_565_1329 | 254 |
| 134 | 3300042599 | Ga0466706_124034 | Ga0466706_124034_7750_8514 | 254 |
| 135 | 3300042602 | Ga0466713_088502 | Ga0466713_088502_41069_41833 | 254 |
| 136 | 3300042616 | Ga0466715_499972 | Ga0466715_499972_33565_34329 | 254 |
| 137 | 3300056564 | Ga0530661_000158 | Ga0530661_000158_50690_51454 | 254 |
| 138 | iso_pr_bacteria | 2820244222 | 2820245964 | 254 |
| 139 | iso_pr_bacteria | 2820250282 | 2820252317 | 254 |
| 140 | iso_pr_bacteria | 2820420508 | 2820421546 | 254 |
| 141 | iso_pr_bacteria | 2820424542 | 2820424809 | 254 |
| 142 | 2225789004 | 2227528804 | 2228039040 | 255 |
| 143 | 3300002462 | JGI24702J35022_10002230 | JGI24702J35022_100022305 | 255 |
| 144 | 3300007042 | Ga0103263_100112 | Ga0103263_10011222 | 255 |
| 145 | 3300007052 | Ga0102736_1000036 | Ga0102736_100003641 | 255 |
| 146 | 3300007095 | Ga0102739_1000036 | Ga0102739_100003632 | 255 |
| 147 | 3300007129 | Ga0102734_1000047 | Ga0102734_100004780 | 255 |
| 148 | 3300009826 | Ga0123355_10021583 | Ga0123355_100215839 | 255 |
| 149 | 3300010167 | Ga0123353_10000142 | Ga0123353_1000014234 | 255 |
| 150 | 3300010167 | Ga0123353_10014617 | Ga0123353_100146175 | 255 |
| 151 | 3300038395 | Ga0415639_069138 | Ga0415639_069138_2335_3102 | 255 |
| 152 | 3300042659 | Ga0466733_122410 | Ga0466733_122410_21710_22477 | 255 |
| 153 | 2225789004 | 2227086385 | 2227463347 | 256 |
| 154 | 3300038395 | Ga0415639_050709 | Ga0415639_050709_296_1066 | 256 |
| 155 | 3300038395 | Ga0415639_137335 | Ga0415639_137335_1527_2297 | 256 |
| 156 | 3300042599 | Ga0466706_014651 | Ga0466706_014651_4066_4836 | 256 |
| 157 | 3300042599 | Ga0466706_043454 | Ga0466706_043454_141_911 | 256 |
| 158 | 3300042599 | Ga0466706_053616 | Ga0466706_053616_1164_1934 | 256 |
| 159 | 3300042599 | Ga0466706_115224 | Ga0466706_115224_6986_7756 | 256 |
| 160 | 3300042599 | Ga0466706_115768 | Ga0466706_115768_23541_24311 | 256 |
| 161 | 3300042599 | Ga0466706_134420 | Ga0466706_134420_19852_20622 | 256 |
| 162 | 3300042599 | Ga0466706_164052 | Ga0466706_164052_146024_146794 | 256 |
| 163 | 3300042599 | Ga0466706_203587 | Ga0466706_203587_330_1100 | 256 |
| 164 | 3300042599 | Ga0466706_234606 | Ga0466706_234606_10459_11229 | 256 |
| 165 | 3300042636 | Ga0466703_222210 | Ga0466703_222210_6467_7237 | 256 |
| 166 | iso_pr_bacteria | 2820811576 | 2820811820 | 256 |
| 167 | iso_pr_bacteria | 2820813074 | 2820814467 | 256 |
| 168 | 3300010049 | Ga0123356_10184479 | Ga0123356_101844792 | 257 |
| 169 | 3300042643 | Ga0466704_017914 | Ga0466704_017914_7212_8006 | 257 |
| 170 | 3300005071 | Ga0068302_10587118 | Ga0068302_105871182 | 258 |
| 171 | 3300010167 | Ga0123353_10110583 | Ga0123353_101105831 | 258 |
| 172 | 3300042590 | Ga0466690_397241 | Ga0466690_397241_626_1432 | 258 |
| 173 | 3300042615 | Ga0466711_237586 | Ga0466711_237586_300_1076 | 258 |
| 174 | 3300042619 | Ga0466726_037756 | Ga0466726_037756_2776_3552 | 258 |
| 175 | iso_pr_bacteria | 2998833917 | 2998834107 | 258 |
| 176 | 3300005201 | Ga0072941_1013455 | Ga0072941_101345527 | 259 |
| 177 | 3300005201 | Ga0072941_1125384 | Ga0072941_11253842 | 259 |
| 178 | 3300005201 | Ga0072941_1289851 | Ga0072941_12898512 | 259 |
| 179 | 3300010167 | Ga0123353_10076349 | Ga0123353_100763491 | 259 |
| 180 | 3300042596 | Ga0466696_445403 | Ga0466696_445403_1471_2250 | 259 |
| 181 | 3300009784 | Ga0123357_10388607 | Ga0123357_103886071 | 261 |
| 182 | 3300010882 | Ga0123354_10259063 | Ga0123354_102590632 | 262 |
| 183 | 3300042619 | Ga0466726_074357 | Ga0466726_074357_10979_11773 | 264 |
| 184 | 3300000062 | IMNBL1DRAFT_c0023659 | IMNBL1DRAFT_00236593 | 266 |
| 185 | 3300042604 | Ga0466717_014536 | Ga0466717_014536_1143_1979 | 266 |
| 186 | 3300042648 | Ga0466709_036643 | Ga0466709_036643_96_896 | 266 |
| 187 | 3300042618 | Ga0466723_319943 | Ga0466723_319943_632_1435 | 267 |
| 188 | iso_pr_bacteria | 2529293168 | 2531453442 | 267 |
| 189 | 3300010049 | Ga0123356_10262906 | Ga0123356_102629062 | 273 |
| 190 | 3300042616 | Ga0466715_261140 | Ga0466715_261140_98_934 | 278 |
| 191 | 3300010167 | Ga0123353_10028155 | Ga0123353_100281552 | 290 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00121 | TIM | Triosephosphate isomerase | 43 | 287 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00121 | GO:0004807 | triose-phosphate isomerase activity | MF |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.86 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.