Protein Family IF03077

Metagenome Isolate
472 Members
212 Samples
371 Scaffolds
572.43 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10024343|Ga0123353_100243436
Length
667 aa
Sequence
LHHFIEQPVNDDFCVFVKPSIIVNPKNPLANHQRFSPLTQNGIIRYNVGLVFLLSAMPKTSREKHQTNTETQSPALMMSGADILIQSLVNAGVDVIWSYPGGTVIPLHQAMTRFRDKLRVILPRQEQGGGFAAQGYARSTGKIGVCTATSGPGAANLITSIADAKLDSIPLLAITGQVATPAIGSDAFQETPFTEMCRSVTKHHYLVTDVNNIARIVREAIHIATTGRPGPVLIDVPRNIQVAQCIPDFNAEMDLPGYDDEFPEPSDDVLEQIAEDIRKAKNPILYVGGGIIASDSSAELRKLAELTQIPVTTTMMALSAFPREHKLSLGMPGMHGTAYANHAIHDCDLLLAFGVRFDDRVTGKASEFAKHAKIIHVDIDSSEINKVKQADIAVVCNVKDVLQGLLKKLGKYKPSPELERWHQKIDQWKHEMPMDFGTTCGKFSATDVESPHITAQYAIHELWKATHNRDAIIVTGVGQHQMWTAQFYRFSKPRTWLSSAGLGTMGFGLPAAIGAKVAHPDKLVIDIDGDGSFQMNIQEMATCHCEKIPMKVMLLNNQHLGMVMQWEDRFFQSNRAHTYLGPIDHPETLGKGTGIGPETRYPDFVAIAKGFGWEAMLVSEKSELPAAIEKMIDHPGSFLLDVTIPYQEHVLPMIPAGATVLEMIRR*

📊 Sample Types

Isolate 21.2%
Metagenome 78.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 33.5%
Termitidae 17.0%
Formicidae 9.3%
Kalotermitidae 7.7%
Culicidae 5.7%
Armadillidiidae 4.6%
Tenebrionidae 3.6%
Elmidae 3.1%
Scarabaeidae 2.6%
Blattidae 2.1%
Rhinotermitidae 2.1%
Termopsidae 2.1%
Passalidae 1.5%
Drosophilidae 1.0%
Thomisidae 0.5%
Hodotermitidae 0.5%
Aphrophoridae 0.5%
Daphniidae 0.5%
Aphididae 0.5%
Pseudophyllodromiidae 0.5%
Bombycidae 0.5%
Kiwaidae 0.5%

🌳 Taxonomy

Archaea 12
Bacteria 440
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 8114076984 Elizabethkingia anophelis R26 Isolate Culicidae
2 2820814774 Unclassified Actinobacteria Nt197P3bin39 Isolate Unclassified
3 2864788197 Elizabethkingia anophelis S00027 Isolate Elmidae
4 2864822740 Chryseobacterium shigense S00064 Isolate Elmidae
5 2882250448 Bizionia sp. APA-3 Isolate
6 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
7 2963634138 Unclassified Bacilli bacterium PM5-3 Isolate Blattidae
8 2585428085 Sporobacter termitidis DSM 10068 Isolate Termitidae
9 2630969010 Friedmanniella luteola DSM 21741 Isolate Thomisidae
10 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
11 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
12 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
13 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
16 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
17 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
18 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
19 648028014 Candidatus Sulcia muelleri CARI Isolate Unclassified
20 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300007052 Ant gut microbial communities from Cephalotes eduarduli, Brazil Metagenome Formicidae
25 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
26 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
27 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
28 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
29 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
30 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
31 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
32 3300012829 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG Metagenome Armadillidiidae
33 3300012839 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG Metagenome Culicidae
34 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
35 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
36 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
37 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
38 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
39 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
41 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
42 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
43 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
44 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
45 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
46 2864948220 Elizabethkingia anophelis S00205 Isolate Elmidae
47 2510917001 Candidatus Sulcia muelleri PSPU Isolate Aphrophoridae
48 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
49 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
50 2773857680 Unclassified Methanomassiliicoccaceae Emb289P3bin41 Isolate Unclassified
51 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
52 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
53 2820641689 Unclassified Firmicutes Cu122P5bin5 Isolate Unclassified
54 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
55 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
56 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
57 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
58 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
59 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
60 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
61 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
62 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
63 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
64 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
65 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
66 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
67 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
68 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
69 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
70 2864923010 Elizabethkingia anophelis S00177 Isolate Elmidae
71 2896321640 Sphingobacterium sp. xlx-130 Isolate
72 2931425734 Nocardioides sp. J2M5 Isolate
73 2931430189 Tessaracoccus palaemonis J1M15 Isolate
74 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
75 2963635624 Unclassified Bacilli bacterium PM5-9 Isolate Blattidae
76 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
77 2820581541 Unclassified Firmicutes Emb289P3bin127 Isolate Unclassified
78 2820007728 Unclassified Synergistetes Lab288P3bin114 Isolate Unclassified
79 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
80 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
81 3300007141 Ant gut microbial communities from Cephalotes maculatus, Brazil Metagenome Formicidae
82 3300007188 Ant gut microbial communities from Cephalotes rohweri, Arizona, USA Metagenome Formicidae
83 3300009460 Microbial communities of aphids from Pistacia texana in Langtry, TX, USA - Geopemphigus sp. seqcov Metagenome
84 3300012824 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E11 MG Metagenome Armadillidiidae
85 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
86 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
87 3300012854 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E1 MG Metagenome Culicidae
88 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
89 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
90 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
91 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
92 2896330536 Sphingobacterium sp. xlx-96 Isolate
93 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
94 2529292732 Elizabethkingia anophelis R26 Isolate Culicidae
95 2773857697 Unclassified Methanomassiliicoccaceae Th196P4bin34 Isolate Unclassified
96 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
97 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
98 2998929858 Bacteroidetes endosymbiont of Geopemphigus sp. GspS2-BC2016 Isolate Aphididae
99 3300002464 Anopheles gambiae gut viral communities from New Mexico State University, USA - SM1 Metagenome Culicidae
100 3300007083 Ant gut microbial communities from Cephalotes persimilis, Brazil Metagenome Formicidae
101 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
102 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
103 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
104 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
105 3300012819 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E11 MG Metagenome Armadillidiidae
106 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae
107 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
108 2820914081 Unclassified Actinobacteria Emb289P3bin87 Isolate Unclassified
109 2864831662 Chryseobacterium sediminis S00068 Isolate Elmidae
110 2898741527 Sphingobacterium sp. xlx-73 Isolate
111 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
112 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
113 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
114 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
115 2820490862 Unclassified Firmicutes Lab288P1bin64 Isolate Unclassified
116 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
117 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
118 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
119 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
120 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
121 8020009074 Elizabethkingia anophelis MSU001 Isolate Culicidae
122 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
123 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
124 3300006995 Ant gut microbial communities from Cephalotes angustus, Brazil Metagenome Formicidae
125 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
126 3300007142 Ant gut microbial communities from Cephalotes grandinosus, Brazil Metagenome Formicidae
127 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
128 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
129 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
130 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
131 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
132 2896350215 Sphingobacterium sp. xlx-183 Isolate
133 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
134 2687453757 Opitutus sp. Cag34 Isolate Unclassified
135 2706794701 Opitutaceae bacterium TSB47 Isolate Rhinotermitidae
136 2773857677 Methanoplasma sp. Cu122P5bin30 Isolate Unclassified
137 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
138 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
139 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
140 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
141 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
142 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
143 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
144 2820733257 Unclassified Chloroflexi Lab288P4bin59 Isolate Unclassified
145 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
146 3002678670 Agromyces sp. G127AT Isolate Unclassified
147 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
148 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
149 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
150 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
151 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
152 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
153 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
154 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
155 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
156 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
157 2847090942 Elizabethkingia anophelis Ag1 Isolate Culicidae
158 2864882932 Chryseobacterium shingense S00136 Isolate Elmidae
159 2687453786 Chryseobacterium culicis DSM 23031 Isolate Unclassified
160 2773857688 Unclassified Methanomassiliicoccaceae Nt197P3bin45 Isolate Unclassified
161 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
162 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
163 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
164 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
165 2820580397 Unclassified Firmicutes Emb289P3bin133 Isolate Unclassified
166 2603880164 Opitutus sp. Isolate Formicidae
167 2820137450 Unclassified Proteobacteria Emb289P3bin120 Isolate Unclassified
168 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
169 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
170 646311952 Sebaldella termitidis ATCC 33386 Isolate Unclassified
171 8030347546 Propionimicrobium sp. PCR01-08-3 Isolate Tenebrionidae
172 3002029927 Blattabacterium cuenoti CHORISOsp Isolate Pseudophyllodromiidae
173 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
174 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
175 3300007095 Ant gut microbial communities from Cephalotes minutus, Brazil Metagenome Formicidae
176 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
177 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
178 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
179 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
180 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
181 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
182 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
183 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
184 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
185 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
186 2820894511 Unclassified Actinobacteria Lab288P1bin103 Isolate Unclassified
187 2820911766 Unclassified Actinobacteria Emb289P3bin96 Isolate Unclassified
188 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
189 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
190 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
191 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
192 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
193 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
194 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
195 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
196 2820380671 Unclassified Firmicutes Nt197P1bin4 Isolate Unclassified
197 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
198 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
199 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
200 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
201 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
202 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
203 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
204 3300007067 Ant gut microbial communities from Cephalotes spinosus, Peru Metagenome Formicidae
205 3300007068 Ant gut microbial communities from Cephalotes simillimus, Peru Metagenome Formicidae
206 3300007139 Ant gut microbial communities from Cephalotes pellans, Brazil Metagenome Formicidae
207 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
208 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
209 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
210 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
211 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
212 3300013007 Symbiotic microbial communities associated with the hydrothermal yeti crab kiwa sp. n. from the East Pacific Rise in the East Pacific Ocean - crab 1, guts Metagenome Kiwaidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_042717 3300042612 Bacteria 21329
2 Ga0466735_057798 3300042624 Bacteria 6194
3 Ga0466735_081139 3300042624 Bacteria 4699
4 Ga0466735_164792 3300042624 Bacteria 4036
5 Ga0466703_313034 3300042636 Bacteria 8491
6 Ga0466704_344496 3300042643 Bacteria 4954
7 Ga0466704_395985 3300042643 Bacteria 4741
8 Ga0466704_508228 3300042643 Bacteria 66197
9 Ga0466709_288828 3300042648 Bacteria 18400
10 Ga0466709_308129 3300042648 Bacteria 2835
11 Ga0466724_08127 3300042649 Bacteria 26680
12 Ga0466724_30060 3300042649 Unclassified 4314
13 Ga0466724_46140 3300042649 Bacteria 630192
14 Ga0123356_10000767 3300010049 Bacteria 35460
15 Ga0123356_10003716 3300010049 Bacteria 15903
16 Ga0123356_10003864 3300010049 Bacteria 15608
17 Ga0123356_10045660 3300010049 Bacteria 4076
18 Ga0123353_10001968 3300010167 Bacteria 25332
19 Ga0123353_10005272 3300010167 Bacteria 16908
20 Ga0123353_10019895 3300010167 Bacteria 9999
21 Ga0123353_10036222 3300010167 Bacteria 7728
22 Ga0123353_10368508 3300010167 Bacteria 2155
23 Ga0123354_10093659 3300010882 Bacteria 4128
24 Ga0160465_100152 3300012803 Bacteria 60106
25 Ga0466701_035380 3300042598 Bacteria 6995
26 Ga0466706_030493 3300042599 Bacteria 13577
27 Ga0466706_228217 3300042599 Bacteria 67941
28 Ga0466707_168226 3300042601 Bacteria 11522
29 Ga0466713_001026 3300042602 Bacteria 36059
30 Ga0466714_055030 3300042603 Bacteria 6787
31 Ga0466705_498368 3300042612 Bacteria 11688
32 Ga0466711_051710 3300042615 Bacteria 25077
33 Ga0466715_059738 3300042616 Bacteria 13741
34 Ga0466715_079488 3300042616 Bacteria 17871
35 Ga0466715_170777 3300042616 Bacteria 2928
36 Ga0466723_011755 3300042618 Bacteria 6044
37 Ga0466723_012899 3300042618 Bacteria 3016
38 Ga0466728_454134 3300042620 Bacteria 12943
39 Ga0466729_043233 3300042621 Bacteria 2620
40 Ga0160432_102495 3300012818 Bacteria 3847
41 Ga0160431_104803 3300012828 Bacteria 2388
42 Ga0160458_100263 3300012832 Unclassified 33700
43 Ga0160433_100053 3300012846 Bacteria 130466
44 Ga0160430_101833 3300012852 Bacteria 7368
45 Ga0466691_110498 3300042593 Bacteria 6244
46 Ga0466696_005003 3300042596 Bacteria 5482
47 Ga0466696_023490 3300042596 Bacteria 3141
48 Ga0466696_217649 3300042596 Bacteria 2244
49 Ga0466701_010990 3300042598 Bacteria 332169
50 2227430793 2225789004 Bacteria 5571
51 IMNBGM34_c000044 3300000036 Bacteria 34860
52 JGI24695J34938_10001251 3300002450 Bacteria 22330
53 CVPL010W_10000615 3300002931 Unclassified 52736
54 Ga0072941_1147642 3300005201 Unclassified 3689
55 Ga0102737_1001419 3300007142 Unclassified 6687
56 Ga0103264_1015614 3300007188 Bacteria 3722
57 Ga0466697_072335 3300042611 Bacteria 13627
58 Ga0466705_336039 3300042612 Bacteria 4742
59 Ga0562376_0018 3300056857 Bacteria 481690
60 Ga0562374_0013 3300057007 Bacteria 1517757
61 Ga0466731_113174 3300042622 Bacteria 1863
62 Ga0466735_087349 3300042624 Bacteria 5417
63 Ga0466703_217671 3300042636 Bacteria 6856
64 Ga0466704_258016 3300042643 Bacteria 2990
65 Ga0466708_312416 3300042652 Bacteria 85118
66 Ga0466727_155884 3300042655 Bacteria 6773
67 Ga0123356_10000473 3300010049 Bacteria 45077
68 Ga0123356_10004719 3300010049 Bacteria 14042
69 Ga0123356_10008333 3300010049 Bacteria 10310
70 Ga0123356_10046959 3300010049 Bacteria 4018
71 Ga0123356_10093482 3300010049 Bacteria 2870
72 Ga0123353_10001983 3300010167 Bacteria 25286
73 Ga0123353_10006872 3300010167 Bacteria 15276
74 Ga0123353_10007831 3300010167 Bacteria 14507
75 Ga0123353_10057794 3300010167 Bacteria 6214
76 Ga0123354_10019215 3300010882 Bacteria 10726
77 Ga0466706_014225 3300042599 Bacteria 6235
78 Ga0466706_161207 3300042599 Bacteria 22327
79 Ga0466706_164315 3300042599 Bacteria 60572
80 Ga0466713_050983 3300042602 Bacteria 10911
81 Ga0466714_008590 3300042603 Unclassified 2309
82 Ga0466698_005253 3300042610 Bacteria 2085
83 Ga0466705_481155 3300042612 Bacteria 3792
84 Ga0466715_237416 3300042616 Bacteria 16444
85 Ga0466723_004854 3300042618 Bacteria 12577
86 Ga0466723_022972 3300042618 Bacteria 101765
87 Ga0466723_213455 3300042618 Bacteria 6776
88 Ga0466723_348373 3300042618 Bacteria 7676
89 Ga0466726_098184 3300042619 Bacteria 19922
90 Ga0466728_373369 3300042620 Archaea 2248
91 Ga0160468_100137 3300012819 Bacteria 69665
92 Ga0160467_101583 3300012829 Unclassified 8107
93 Ga0466657_062863 3300042582 Bacteria 5178
94 Ga0466690_109494 3300042590 Bacteria 8516
95 Ga0466692_045732 3300042591 Bacteria 10384
96 Ga0466692_161938 3300042591 Bacteria 121742
97 Ga0466691_042808 3300042593 Bacteria 14280
98 IMNBL1DRAFT_c0000879 3300000062 Bacteria 23426
99 IMNBL1DRAFT_c0019906 3300000062 Bacteria 2733
100 AustNasuHG_c1003867 3300000089 Bacteria 5394
101 JGI24703J35330_11747896 3300002501 Bacteria 8938
102 Ga0103263_100075 3300007042 Bacteria 55291
103 Ga0103264_1000101 3300007188 Bacteria 49856
104 Ga0103267_1000427 3300007190 Bacteria 14622
105 Ga0127649_100531 3300009460 Bacteria 18197
106 Ga0466705_005716 3300042612 Bacteria 4717
107 Ga0466703_393877 3300042636 Bacteria 98275
108 Ga0466704_294025 3300042643 Bacteria 7152
109 Ga0466709_199853 3300042648 Bacteria 2812
110 Ga0123355_10072821 3300009826 Bacteria 5509
111 Ga0123355_10170856 3300009826 Bacteria 3250
112 Ga0123356_10000351 3300010049 Bacteria 52507
113 Ga0123356_10002065 3300010049 Bacteria 21651
114 Ga0123356_10004177 3300010049 Bacteria 14977
115 Ga0123356_10008395 3300010049 Bacteria 10269
116 Ga0123356_10119852 3300010049 Bacteria 2557
117 Ga0123353_10003646 3300010167 Bacteria 19520
118 Ga0123353_10005903 3300010167 Bacteria 16192
119 Ga0466706_028908 3300042599 Bacteria 27379
120 Ga0466706_138301 3300042599 Bacteria 29290
121 Ga0466706_156906 3300042599 Bacteria 4906
122 Ga0466700_137486 3300042600 Bacteria 5854
123 Ga0466719_306626 3300042606 Bacteria 7564
124 Ga0466705_437717 3300042612 Bacteria 40567
125 Ga0466710_011851 3300042613 Bacteria 4534
126 Ga0466711_137983 3300042615 Bacteria 7284
127 Ga0466711_184519 3300042615 Bacteria 28551
128 Ga0466723_045042 3300042618 Bacteria 5201
129 Ga0466723_132916 3300042618 Bacteria 42296
130 Ga0160431_104770 3300012828 Bacteria 2405
131 Ga0160433_100368 3300012846 Bacteria 26229
132 Ga0160445_100280 3300012847 Bacteria 33950
133 Ga0160443_100327 3300012848 Bacteria 44155
134 Ga0466692_169156 3300042591 Bacteria 59346
135 Ga0466694_175619 3300042594 Bacteria 2665
136 Ga0466696_004159 3300042596 Bacteria 9316
137 IMNBL1DRAFT_c0000088 3300000062 Bacteria 80215
138 CVPL010W_10002748 3300002931 Bacteria 24536
139 Ga0072941_1226800 3300005201 Bacteria 7719
140 Ga0102736_1000106 3300007052 Bacteria 26068
141 Ga0102735_1000030 3300007080 Bacteria 73717
142 Ga0102740_1000220 3300007140 Bacteria 16312
143 Ga0103268_1001540 3300007192 Unclassified 10722
144 Ga0466705_151059 3300042612 Bacteria 39890
145 Ga0466705_343921 3300042612 Bacteria 17979
146 Ga0466703_392640 3300042636 Bacteria 16164
147 Ga0466704_453215 3300042643 Bacteria 5840
148 Ga0466724_11157 3300042649 Archaea 1968
149 Ga0466727_261820 3300042655 Bacteria 15247
150 Ga0123356_10000425 3300010049 Bacteria 48140
151 Ga0123356_10000676 3300010049 Bacteria 37752
152 Ga0123356_10019663 3300010049 Bacteria 6400
153 Ga0123356_10030487 3300010049 Bacteria 5048
154 Ga0123356_10040931 3300010049 Bacteria 4317
155 Ga0123353_10181181 3300010167 Bacteria 3335
156 Ga0160454_100001 3300012798 Bacteria 780029
157 Ga0466707_277610 3300042601 Bacteria 10435
158 Ga0466713_040722 3300042602 Bacteria 16258
159 Ga0466713_079531 3300042602 Bacteria 32951
160 Ga0466714_153426 3300042603 Bacteria 5784
161 Ga0466722_168692 3300042609 Bacteria 15443
162 Ga0466715_001157 3300042616 Bacteria 44509
163 Ga0466715_314467 3300042616 Bacteria 26093
164 Ga0466715_321177 3300042616 Bacteria 8081
165 Ga0466715_350435 3300042616 Unclassified 1872
166 Ga0466726_200393 3300042619 Bacteria 4630
167 Ga0466726_271206 3300042619 Bacteria 3999
168 Ga0466726_345058 3300042619 Bacteria 18048
169 Ga0160441_100409 3300012825 Bacteria 35491
170 Ga0466692_158668 3300042591 Bacteria 509148
171 Ga0466691_063579 3300042593 Bacteria 12437
172 Ga0466691_074227 3300042593 Bacteria 2281
173 Ga0466694_034645 3300042594 Bacteria 15920
174 JGI24696J40584_12961142 3300002834 Archaea 11149
175 Ga0072941_1035574 3300005201 Bacteria 9949
176 Ga0103265_1000010 3300007068 Bacteria 47599
177 Ga0103261_1000031 3300007083 Bacteria 447718
178 Ga0102739_1000414 3300007095 Unclassified 25069
179 Ga0104050_1005409 3300007153 Unclassified 10548
180 Ga0466733_082697 3300042659 Bacteria 8091
181 Ga0562379_0125 3300056790 Bacteria 239397
182 Ga0466729_227373 3300042621 Unclassified 2344
183 Ga0466730_011760 3300042625 Bacteria 327787
184 Ga0466703_337715 3300042636 Bacteria 2135
185 Ga0466704_256111 3300042643 Bacteria 159283
186 Ga0466724_04368 3300042649 Unclassified 4313
187 Ga0466708_048002 3300042652 Bacteria 4133
188 Ga0466725_218436 3300042654 Bacteria 2942
189 Ga0466727_149972 3300042655 Bacteria 8441
190 Ga0123356_10004461 3300010049 Bacteria 14469
191 Ga0123356_10005385 3300010049 Bacteria 13038
192 Ga0123356_10088599 3300010049 Unclassified 2943
193 Ga0123356_10204741 3300010049 Bacteria 2016
194 Ga0123353_10000019 3300010167 Bacteria 185006
195 Ga0123353_10046154 3300010167 Bacteria 6919
196 Ga0123353_10069659 3300010167 Bacteria 5650
197 Ga0123353_10181626 3300010167 Bacteria 3330
198 Ga0466701_102190 3300042598 Bacteria 20013
199 Ga0466706_077133 3300042599 Bacteria 15518
200 Ga0466706_257047 3300042599 Bacteria 5831
201 Ga0466700_457508 3300042600 Bacteria 4681
202 Ga0466714_124343 3300042603 Bacteria 29085
203 Ga0466716_053160 3300042605 Unclassified 7046
204 Ga0466698_502308 3300042610 Bacteria 2732
205 Ga0466705_397101 3300042612 Bacteria 24789
206 Ga0466711_042770 3300042615 Bacteria 2959
207 Ga0466711_334169 3300042615 Bacteria 5146
208 Ga0466711_511514 3300042615 Bacteria 38268
209 Ga0466715_138633 3300042616 Bacteria 9372
210 Ga0466723_141507 3300042618 Bacteria 6112
211 Ga0466723_287759 3300042618 Bacteria 52406
212 Ga0160469_102064 3300012824 Bacteria 4205
213 Ga0160441_100594 3300012825 Bacteria 23225
214 Ga0160459_100664 3300012831 Bacteria 12004
215 Ga0160433_100420 3300012846 Bacteria 22641
216 Ga0160457_1000009 3300012858 Bacteria 506736
217 Ga0265387_1000749 3300024582 Bacteria 4979
218 Ga0466694_006347 3300042594 Bacteria 12968
219 Ga0466694_327094 3300042594 Bacteria 4515
220 Ga0466695_358698 3300042595 Bacteria 69758
221 Ga0466699_146309 3300042597 Bacteria 10230
222 JGI24695J34938_10031752 3300002450 Bacteria 2446
223 Ga0068305_10066994 3300005083 Bacteria 10185
224 Ga0102733_100004 3300006995 Bacteria 97031
225 Ga0102734_1000084 3300007129 Bacteria 29145
226 Ga0102734_1000373 3300007129 Bacteria 42767
227 Ga0123357_10000026 3300009784 Bacteria 128045
228 Ga0466705_296838 3300042612 Bacteria 15201
229 Ga0466733_166692 3300042659 Bacteria 9523
230 Ga0562378_0355 3300056814 Bacteria 89245
231 Ga0562377_0071 3300056842 Bacteria 439264
232 Ga0562375_5239 3300056856 Bacteria 8246
233 Ga0466735_115119 3300042624 Bacteria 11278
234 Ga0466735_156955 3300042624 Bacteria 5972
235 Ga0466704_288212 3300042643 Bacteria 11956
236 Ga0466704_350877 3300042643 Bacteria 6942
237 Ga0466724_66581 3300042649 Bacteria 665985
238 Ga0466708_231841 3300042652 Bacteria 67849
239 Ga0466708_240824 3300042652 Bacteria 7216
240 Ga0466708_265321 3300042652 Bacteria 14189
241 Ga0466708_416110 3300042652 Bacteria 70714
242 Ga0466708_453937 3300042652 Bacteria 13560
243 Ga0466727_033664 3300042655 Bacteria 4729
244 Ga0466727_335509 3300042655 Bacteria 1995
245 Ga0123356_10000857 3300010049 Unclassified 33875
246 Ga0123356_10002217 3300010049 Bacteria 20923
247 Ga0123356_10042576 3300010049 Bacteria 4230
248 Ga0123353_10044345 3300010167 Bacteria 7050
249 Ga0123353_10064987 3300010167 Unclassified 5857
250 Ga0123353_10091438 3300010167 Bacteria 4902
251 Ga0160464_100594 3300012805 Bacteria 23577
252 Ga0160466_103808 3300012809 Bacteria 2339
253 Ga0466701_076067 3300042598 Bacteria 52733
254 Ga0466701_079356 3300042598 Bacteria 4121
255 Ga0466706_060587 3300042599 Bacteria 19790
256 Ga0466707_343250 3300042601 Bacteria 2671
257 Ga0466713_015872 3300042602 Bacteria 9979
258 Ga0466713_115569 3300042602 Bacteria 9264
259 Ga0466722_051638 3300042609 Bacteria 15472
260 Ga0466715_033684 3300042616 Bacteria 15295
261 Ga0466723_038935 3300042618 Bacteria 2211
262 Ga0466723_353883 3300042618 Bacteria 2535
263 Ga0466728_320717 3300042620 Bacteria 40765
264 Ga0466729_173068 3300042621 Archaea 2519
265 Ga0160467_100220 3300012829 Bacteria 73452
266 Ga0160457_1001346 3300012858 Bacteria 6961
267 Ga0415639_028590 3300038395 Bacteria 5178
268 Ga0415639_177472 3300038395 Bacteria 2309
269 Ga0466699_153989 3300042597 Bacteria 13711
270 JGI24699J35502_11072256 3300002509 Bacteria 1860
271 Ga0068302_10036884 3300005071 Unclassified 2842
272 Ga0102736_1000057 3300007052 Bacteria 31963
273 Ga0103266_1000044 3300007067 Bacteria 89495
274 Ga0103260_1000014 3300007139 Bacteria 144579
275 Ga0102738_1000007 3300007141 Bacteria 181972
276 Ga0123357_10000615 3300009784 Bacteria 35314
277 Ga0466705_205810 3300042612 Bacteria 60547
278 Ga0466729_289568 3300042621 Bacteria 8241
279 Ga0466731_119536 3300042622 Bacteria 6554
280 Ga0466734_083099 3300042623 Archaea 42182
281 Ga0466730_054806 3300042625 Bacteria 801523
282 Ga0466709_053158 3300042648 Bacteria 3597
283 Ga0466724_22014 3300042649 Bacteria 158058
284 Ga0466708_102293 3300042652 Bacteria 30401
285 Ga0123356_10037628 3300010049 Bacteria 4513
286 Ga0123356_10047381 3300010049 Bacteria 4000
287 Ga0123353_10000170 3300010167 Bacteria 82296
288 Ga0123353_10024343 3300010167 Bacteria 9189
289 Ga0466706_141330 3300042599 Bacteria 30346
290 Ga0466706_177431 3300042599 Bacteria 7418
291 Ga0466713_048951 3300042602 Bacteria 3485
292 Ga0466713_090088 3300042602 Bacteria 4949
293 Ga0466713_107330 3300042602 Bacteria 4950
294 Ga0466719_075479 3300042606 Bacteria 2539
295 Ga0466719_144344 3300042606 Bacteria 5662
296 Ga0466711_045149 3300042615 Bacteria 15753
297 Ga0466711_239916 3300042615 Bacteria 5746
298 Ga0466715_083240 3300042616 Bacteria 8564
299 Ga0466715_302876 3300042616 Bacteria 31216
300 Ga0466715_345723 3300042616 Bacteria 5407
301 Ga0466715_485848 3300042616 Bacteria 6382
302 Ga0466718_049318 3300042617 Bacteria 63032
303 Ga0466729_166636 3300042621 Bacteria 1935
304 Ga0160455_100990 3300012837 Unclassified 10263
305 Ga0160460_101647 3300012845 Bacteria 6861
306 Ga0160448_103398 3300012854 Bacteria 4672
307 Ga0160436_1000942 3300012861 Bacteria 8858
308 Ga0415639_048593 3300038395 Bacteria 7917
309 Ga0466692_076702 3300042591 Bacteria 28626
310 Ga0466692_203370 3300042591 Bacteria 17661
311 Ga0466694_019092 3300042594 Bacteria 7763
312 JGI24695J34938_10000343 3300002450 Bacteria 45746
313 Ga0104048_1168692 3300007143 Bacteria 3121
314 Ga0103267_1000232 3300007190 Bacteria 26322
315 Ga0466697_181375 3300042611 Bacteria 3284
316 Ga0466705_118311 3300042612 Bacteria 3731
317 Ga0466705_128592 3300042612 Bacteria 3992
318 Ga0466705_168660 3300042612 Bacteria 101305
319 Ga0466705_385246 3300042612 Bacteria 20984
320 Ga0466703_081658 3300042636 Bacteria 26167
321 Ga0466703_100612 3300042636 Bacteria 66039
322 Ga0466704_173941 3300042643 Bacteria 14798
323 Ga0466704_305519 3300042643 Archaea 1856
324 Ga0466709_046875 3300042648 Bacteria 5608
325 Ga0466724_25732 3300042649 Bacteria 52198
326 Ga0466708_305430 3300042652 Bacteria 9932
327 Ga0466725_252676 3300042654 Bacteria 2017
328 Ga0466725_375722 3300042654 Bacteria 2035
329 Ga0466727_057740 3300042655 Bacteria 4952
330 Ga0123355_10051660 3300009826 Bacteria 6670
331 Ga0123356_10003304 3300010049 Bacteria 16938
332 Ga0123356_10019715 3300010049 Bacteria 6391
333 Ga0123356_10036312 3300010049 Bacteria 4603
334 Ga0123353_10068738 3300010167 Bacteria 5689
335 Ga0123353_10122886 3300010167 Bacteria 4173
336 Ga0123353_10128321 3300010167 Bacteria 4072
337 Ga0123354_10042200 3300010882 Bacteria 7036
338 Ga0123354_10044998 3300010882 Bacteria 6761
339 Ga0123354_10140068 3300010882 Archaea 2998
340 Ga0466701_076781 3300042598 Archaea 4714
341 Ga0466700_452118 3300042600 Bacteria 32804
342 Ga0466707_350957 3300042601 Bacteria 12319
343 Ga0466713_075165 3300042602 Bacteria 11919
344 Ga0466717_030873 3300042604 Bacteria 2530
345 Ga0466717_165713 3300042604 Bacteria 2272
346 Ga0466719_125371 3300042606 Bacteria 4071
347 Ga0466719_522042 3300042606 Bacteria 3922
348 Ga0466720_097536 3300042607 Bacteria 8907
349 Ga0466722_088105 3300042609 Bacteria 10951
350 Ga0466722_132299 3300042609 Bacteria 91418
351 Ga0466722_260930 3300042609 Bacteria 5351
352 Ga0466712_034590 3300042614 Bacteria 2744
353 Ga0466723_069274 3300042618 Bacteria 5691
354 Ga0466723_137319 3300042618 Bacteria 34367
355 Ga0466723_251514 3300042618 Bacteria 3660
356 Ga0466729_141427 3300042621 Bacteria 6498
357 Ga0466729_196745 3300042621 Bacteria 21071
358 Ga0160472_100115 3300012839 Bacteria 127421
359 Ga0160444_100090 3300012841 Bacteria 116868
360 Ga0160430_102614 3300012852 Bacteria 5569
361 Ga0157631_118613 3300013007 Bacteria 11644
362 Ga0415639_006492 3300038395 Bacteria 23076
363 Ga0466690_017021 3300042590 Bacteria 3363
364 Ga0466690_162583 3300042590 Bacteria 31228
365 Ga0466692_043174 3300042591 Bacteria 22907
366 Ga0466701_001389 3300042598 Bacteria 2409
367 2227466310 2225789004 Bacteria 24399
368 IMNBL1DRAFT_c0016261 3300000062 Bacteria 3193
369 Meta3P_1002643 3300002464 Bacteria 29387
370 Ga0072941_1000016 3300005201 Bacteria 165423
371 Ga0102737_1000026 3300007142 Unclassified 42067

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042603 Ga0466714_008590 Ga0466714_008590_12_1370 443
2 3300042654 Ga0466725_252676 Ga0466725_252676_575_1975 466
3 3300042618 Ga0466723_011755 Ga0466723_011755_4531_5943 470
4 iso_pr_bacteria 2820007728 2820008171 471
5 iso_pu_archaea 2773857697 2774175231 485
6 3300038395 Ga0415639_177472 Ga0415639_177472_41_1534 497
7 3300010049 Ga0123356_10047381 Ga0123356_100473812 507
8 3300042599 Ga0466706_177431 Ga0466706_177431_1620_3305 515
9 3300042643 Ga0466704_305519 Ga0466704_305519_72_1637 521
10 3300042649 Ga0466724_04368 Ga0466724_04368_1062_2798 526
11 3300042643 Ga0466704_258016 Ga0466704_258016_1092_2804 528
12 3300042652 Ga0466708_305430 Ga0466708_305430_8071_9717 535
13 3300010049 Ga0123356_10000425 Ga0123356_1000042532 536
14 3300010167 Ga0123353_10005272 Ga0123353_1000527214 536
15 3300012829 Ga0160467_101583 Ga0160467_1015833 536
16 3300012837 Ga0160455_100990 Ga0160455_1009903 536
17 3300042609 Ga0466722_168692 Ga0466722_168692_12317_14011 541
18 3300042612 Ga0466705_385246 Ga0466705_385246_6051_7676 541
19 iso_pr_bacteria 2529293168 2531455720 541
20 3300010882 Ga0123354_10044998 Ga0123354_100449982 542
21 3300000062 IMNBL1DRAFT_c0000088 IMNBL1DRAFT_000008850 543
22 3300010167 Ga0123353_10068738 Ga0123353_100687384 543
23 3300042618 Ga0466723_012899 Ga0466723_012899_350_2032 543
24 3300056842 Ga0562377_0071 Ga0562377_0071_295763_297469 543
25 iso_pr_bacteria 2820607737 2820610710 543
26 3300010049 Ga0123356_10004177 Ga0123356_1000417712 544
27 3300010049 Ga0123356_10005385 Ga0123356_100053854 545
28 3300010167 Ga0123353_10001983 Ga0123353_100019838 545
29 3300042603 Ga0466714_124343 Ga0466714_124343_1588_3252 545
30 3300002509 JGI24699J35502_11072256 JGI24699J35502_110722561 546
31 3300042618 Ga0466723_022972 Ga0466723_022972_62077_63810 546
32 3300042654 Ga0466725_375722 Ga0466725_375722_72_1712 546
33 3300042659 Ga0466733_166692 Ga0466733_166692_5113_6819 546
34 2225789004 2227430793 2227870327 547
35 3300009826 Ga0123355_10072821 Ga0123355_100728215 547
36 3300010167 Ga0123353_10003646 Ga0123353_1000364615 547
37 3300010882 Ga0123354_10093659 Ga0123354_100936593 547
38 3300038395 Ga0415639_006492 Ga0415639_006492_21392_23035 547
39 3300042591 Ga0466692_169156 Ga0466692_169156_45820_47655 547
40 3300005201 Ga0072941_1147642 Ga0072941_11476422 548
41 3300010049 Ga0123356_10002217 Ga0123356_100022178 548
42 3300010167 Ga0123353_10046154 Ga0123353_100461543 548
43 3300042652 Ga0466708_231841 Ga0466708_231841_42241_43971 548
44 iso_pr_bacteria 2781125665 2781341524 548
45 3300010049 Ga0123356_10000351 Ga0123356_1000035119 549
46 3300010167 Ga0123353_10128321 Ga0123353_101283214 549
47 3300042598 Ga0466701_035380 Ga0466701_035380_4094_5764 549
48 iso_pr_bacteria 2820931684 2820932978 549
49 3300010049 Ga0123356_10003304 Ga0123356_1000330414 550
50 3300012846 Ga0160433_100053 Ga0160433_1000535 550
51 3300042599 Ga0466706_077133 Ga0466706_077133_11808_13508 550
52 3300042643 Ga0466704_344496 Ga0466704_344496_848_2605 550
53 3300042649 Ga0466724_11157 Ga0466724_11157_263_1933 550
54 3300056856 Ga0562375_5239 Ga0562375_5239_4241_5893 550
55 iso_pr_bacteria 2781125660 2781331330 550
56 iso_pr_bacteria 2820570671 2820572495 550
57 3300010049 Ga0123356_10000473 Ga0123356_1000047329 551
58 3300042598 Ga0466701_076067 Ga0466701_076067_3712_5448 551
59 3300042599 Ga0466706_030493 Ga0466706_030493_2761_4446 551
60 3300042600 Ga0466700_452118 Ga0466700_452118_28297_29952 551
61 3300042649 Ga0466724_30060 Ga0466724_30060_1063_2799 551
62 3300010167 Ga0123353_10181626 Ga0123353_101816262 552
63 3300010882 Ga0123354_10140068 Ga0123354_101400682 552
64 3300042611 Ga0466697_181375 Ga0466697_181375_135_1841 552
65 3300042620 Ga0466728_454134 Ga0466728_454134_10818_12509 552
66 3300042652 Ga0466708_453937 Ga0466708_453937_1032_2909 552
67 3300000062 IMNBL1DRAFT_c0016261 IMNBL1DRAFT_00162613 553
68 3300002501 JGI24703J35330_11747896 JGI24703J35330_117478962 553
69 3300042601 Ga0466707_350957 Ga0466707_350957_8815_10503 553
70 3300042603 Ga0466714_153426 Ga0466714_153426_4063_5724 553
71 3300042652 Ga0466708_048002 Ga0466708_048002_588_2297 553
72 3300038395 Ga0415639_028590 Ga0415639_028590_1303_2967 554
73 3300038395 Ga0415639_048593 Ga0415639_048593_2759_4423 554
74 iso_pr_bacteria 2585428085 2587833876 554
75 iso_pr_bacteria 2781125695 2781439423 554
76 iso_pr_bacteria 651324002 651580070 554
77 3300042618 Ga0466723_069274 Ga0466723_069274_451_2118 555
78 3300042618 Ga0466723_132916 Ga0466723_132916_5930_7597 555
79 3300042655 Ga0466727_261820 Ga0466727_261820_3219_4919 555
80 3300042659 Ga0466733_082697 Ga0466733_082697_528_2195 555
81 3300024582 Ga0265387_1000749 Ga0265387_10007493 556
82 3300042598 Ga0466701_076781 Ga0466701_076781_952_2622 556
83 3300042598 Ga0466701_079356 Ga0466701_079356_1302_2972 556
84 3300042599 Ga0466706_156906 Ga0466706_156906_1226_2926 556
85 3300042611 Ga0466697_072335 Ga0466697_072335_11840_13510 556
86 3300042621 Ga0466729_173068 Ga0466729_173068_662_2350 556
87 3300042623 Ga0466734_083099 Ga0466734_083099_8084_9754 556
88 iso_pr_bacteria 2989309576 2989314102 556
89 iso_pu_archaea 2773857680 2774151191 556
90 iso_pu_archaea 2773857688 2774162216 556
91 3300002450 JGI24695J34938_10001251 JGI24695J34938_100012518 557
92 3300009826 Ga0123355_10051660 Ga0123355_100516605 557
93 3300010049 Ga0123356_10000857 Ga0123356_1000085725 557
94 3300010049 Ga0123356_10008395 Ga0123356_100083953 557
95 3300010049 Ga0123356_10046959 Ga0123356_100469591 557
96 3300010049 Ga0123356_10093482 Ga0123356_100934822 557
97 3300010167 Ga0123353_10006872 Ga0123353_100068729 557
98 3300010167 Ga0123353_10368508 Ga0123353_103685082 557
99 3300010882 Ga0123354_10042200 Ga0123354_100422002 557
100 3300042593 Ga0466691_074227 Ga0466691_074227_595_2268 557
101 3300042596 Ga0466696_005003 Ga0466696_005003_1892_3643 557
102 3300042602 Ga0466713_015872 Ga0466713_015872_7353_9026 557
103 3300042619 Ga0466726_098184 Ga0466726_098184_17818_19491 557
104 3300042622 Ga0466731_113174 Ga0466731_113174_167_1840 557
105 3300042655 Ga0466727_335509 Ga0466727_335509_159_1967 557
106 iso_pr_bacteria 2636416028 2638993035 557
107 iso_pr_bacteria 2820641689 2820643383 557
108 3300005201 Ga0072941_1000016 Ga0072941_100001635 558
109 3300042601 Ga0466707_168226 Ga0466707_168226_2388_4094 558
110 3300042612 Ga0466705_005716 Ga0466705_005716_2722_4398 558
111 3300042612 Ga0466705_042717 Ga0466705_042717_4864_6597 558
112 3300042621 Ga0466729_141427 Ga0466729_141427_462_2138 558
113 3300002834 JGI24696J40584_12961142 JGI24696J40584_129611423 559
114 3300010049 Ga0123356_10008333 Ga0123356_100083337 559
115 3300010167 Ga0123353_10069659 Ga0123353_100696593 559
116 3300042590 Ga0466690_162583 Ga0466690_162583_22690_24369 559
117 3300042609 Ga0466722_051638 Ga0466722_051638_7422_9101 559
118 3300042612 Ga0466705_128592 Ga0466705_128592_2235_3914 559
119 3300042612 Ga0466705_481155 Ga0466705_481155_500_2179 559
120 3300042615 Ga0466711_184519 Ga0466711_184519_26830_28509 559
121 3300042616 Ga0466715_485848 Ga0466715_485848_4691_6370 559
122 3300042618 Ga0466723_141507 Ga0466723_141507_2577_4256 559
123 3300042620 Ga0466728_373369 Ga0466728_373369_250_1929 559
124 3300042621 Ga0466729_043233 Ga0466729_043233_144_1823 559
125 3300042621 Ga0466729_227373 Ga0466729_227373_184_1863 559
126 3300042636 Ga0466703_217671 Ga0466703_217671_2160_3839 559
127 iso_pr_bacteria 2820490862 2820490973 559
128 iso_pr_bacteria 2820581541 2820581809 559
129 iso_pr_bacteria 2820733257 2820733861 559
130 iso_pr_bacteria 2820836992 2820837793 559
131 iso_pr_bacteria 2963634138 2963634421 559
132 iso_pr_bacteria 2963635624 2963636068 559
133 iso_pu_archaea 2773857677 2774148205 559
134 3300010049 Ga0123356_10019663 Ga0123356_100196635 560
135 3300010167 Ga0123353_10064987 Ga0123353_100649874 560
136 3300010167 Ga0123353_10122886 Ga0123353_101228862 560
137 3300042615 Ga0466711_051710 Ga0466711_051710_12521_14203 560
138 3300042616 Ga0466715_138633 Ga0466715_138633_6887_8569 560
139 3300042616 Ga0466715_345723 Ga0466715_345723_3035_4717 560
140 3300042618 Ga0466723_038935 Ga0466723_038935_180_1862 560
141 3300000062 IMNBL1DRAFT_c0000879 IMNBL1DRAFT_00008797 561
142 3300000062 IMNBL1DRAFT_c0019906 IMNBL1DRAFT_00199063 561
143 3300010167 Ga0123353_10181181 Ga0123353_101811812 561
144 3300042594 Ga0466694_034645 Ga0466694_034645_8796_10481 561
145 3300042594 Ga0466694_175619 Ga0466694_175619_904_2628 561
146 3300042599 Ga0466706_014225 Ga0466706_014225_2878_4563 561
147 3300042599 Ga0466706_060587 Ga0466706_060587_202_1887 561
148 3300042599 Ga0466706_138301 Ga0466706_138301_21407_23092 561
149 3300042599 Ga0466706_141330 Ga0466706_141330_9635_11320 561
150 3300042599 Ga0466706_257047 Ga0466706_257047_2353_4038 561
151 3300042601 Ga0466707_277610 Ga0466707_277610_4339_6024 561
152 3300042612 Ga0466705_296838 Ga0466705_296838_5290_6975 561
153 3300042612 Ga0466705_343921 Ga0466705_343921_277_1962 561
154 3300042613 Ga0466710_011851 Ga0466710_011851_2651_4336 561
155 3300042616 Ga0466715_314467 Ga0466715_314467_1308_2993 561
156 3300042624 Ga0466735_156955 Ga0466735_156955_443_2128 561
157 iso_pr_bacteria 2820380671 2820381425 561
158 iso_pr_bacteria 648028014 648180327 561
159 3300042590 Ga0466690_017021 Ga0466690_017021_226_1938 562
160 3300042602 Ga0466713_048951 Ga0466713_048951_251_1939 562
161 3300042652 Ga0466708_102293 Ga0466708_102293_27913_29652 562
162 iso_pr_bacteria 2820244222 2820245848 562
163 3300002931 CVPL010W_10002748 CVPL010W_100027483 563
164 3300007140 Ga0102740_1000220 Ga0102740_100022011 563
165 3300009826 Ga0123355_10170856 Ga0123355_101708563 563
166 3300010049 Ga0123356_10088599 Ga0123356_100885992 563
167 3300010167 Ga0123353_10019895 Ga0123353_100198955 563
168 3300042594 Ga0466694_019092 Ga0466694_019092_3165_4901 563
169 3300042594 Ga0466694_327094 Ga0466694_327094_2259_3950 563
170 3300042612 Ga0466705_498368 Ga0466705_498368_3253_4944 563
171 3300042652 Ga0466708_416110 Ga0466708_416110_61312_63003 563
172 iso_pr_bacteria 2820254385 2820254718 563
173 iso_pr_bacteria 2998929858 2998930531 563
174 3300009460 Ga0127649_100531 Ga0127649_1005316 564
175 3300010049 Ga0123356_10019715 Ga0123356_100197156 564
176 3300042591 Ga0466692_203370 Ga0466692_203370_8929_10623 564
177 3300042597 Ga0466699_146309 Ga0466699_146309_6410_8104 564
178 3300042597 Ga0466699_153989 Ga0466699_153989_3515_5209 564
179 3300042610 Ga0466698_502308 Ga0466698_502308_914_2608 564
180 3300042612 Ga0466705_168660 Ga0466705_168660_36739_38451 564
181 3300042619 Ga0466726_200393 Ga0466726_200393_2726_4420 564
182 3300042636 Ga0466703_392640 Ga0466703_392640_6853_8547 564
183 3300042643 Ga0466704_256111 Ga0466704_256111_108485_110179 564
184 iso_pr_bacteria 2781125661 2781333999 564
185 iso_pr_bacteria 2781125664 2781339430 564
186 iso_pr_bacteria 2820768849 2820769764 564
187 iso_pr_bacteria 2820774381 2820775148 564
188 iso_pr_bacteria 2882250448 2882251648 564
189 3300042612 Ga0466705_151059 Ga0466705_151059_32555_34252 565
190 3300042615 Ga0466711_137983 Ga0466711_137983_1297_2994 565
191 3300042643 Ga0466704_173941 Ga0466704_173941_6531_8228 565
192 3300042648 Ga0466709_046875 Ga0466709_046875_690_2408 565
193 3300042648 Ga0466709_308129 Ga0466709_308129_80_1831 565
194 iso_pr_bacteria 2510917001 2510921671 565
195 3300010882 Ga0123354_10019215 Ga0123354_100192159 566
196 3300042607 Ga0466720_097536 Ga0466720_097536_5266_6999 566
197 3300042614 Ga0466712_034590 Ga0466712_034590_984_2684 566
198 3300042621 Ga0466729_289568 Ga0466729_289568_1842_3542 566
199 iso_pr_bacteria 2781125693 2781433710 566
200 3300005083 Ga0068305_10066994 Ga0068305_100669946 567
201 3300010049 Ga0123356_10045660 Ga0123356_100456602 567
202 3300042599 Ga0466706_161207 Ga0466706_161207_2847_4550 567
203 3300042616 Ga0466715_079488 Ga0466715_079488_5895_7598 567
204 3300042624 Ga0466735_057798 Ga0466735_057798_3093_4796 567
205 iso_pr_bacteria 2781125631 2781269015 567
206 iso_pr_bacteria 2781125663 2781338152 567
207 3300000089 AustNasuHG_c1003867 AustNasuHG_10038674 568
208 3300010049 Ga0123356_10003716 Ga0123356_100037165 568
209 3300010049 Ga0123356_10004719 Ga0123356_100047198 568
210 3300010167 Ga0123353_10005903 Ga0123353_100059033 568
211 3300012847 Ga0160445_100280 Ga0160445_1002804 568
212 3300042594 Ga0466694_006347 Ga0466694_006347_2471_4177 568
213 iso_pr_bacteria 646311952 646427152 568
214 3300005201 Ga0072941_1035574 Ga0072941_10355746 569
215 3300010049 Ga0123356_10036312 Ga0123356_100363122 569
216 3300010167 Ga0123353_10000019 Ga0123353_10000019148 569
217 3300042599 Ga0466706_028908 Ga0466706_028908_4881_6590 569
218 3300042612 Ga0466705_397101 Ga0466705_397101_16097_17806 569
219 3300042618 Ga0466723_251514 Ga0466723_251514_114_1823 569
220 3300042618 Ga0466723_353883 Ga0466723_353883_173_1882 569
221 3300042599 Ga0466706_164315 Ga0466706_164315_5157_6869 570
222 3300042603 Ga0466714_055030 Ga0466714_055030_1118_2830 570
223 3300042612 Ga0466705_296838 Ga0466705_296838_1972_3684 570
224 3300042618 Ga0466723_213455 Ga0466723_213455_4775_6487 570
225 3300042636 Ga0466703_100612 Ga0466703_100612_27270_28982 570
226 iso_pr_bacteria 2781125658 2781324842 570
227 3300042612 Ga0466705_205810 Ga0466705_205810_31581_33296 571
228 3300042620 Ga0466728_320717 Ga0466728_320717_13106_14821 571
229 3300042652 Ga0466708_312416 Ga0466708_312416_77777_79492 571
230 3300010049 Ga0123356_10204741 Ga0123356_102047411 572
231 3300042593 Ga0466691_042808 Ga0466691_042808_551_2269 572
232 3300042600 Ga0466700_137486 Ga0466700_137486_2293_4011 572
233 3300042602 Ga0466713_075165 Ga0466713_075165_10048_11766 572
234 3300042602 Ga0466713_115569 Ga0466713_115569_4115_5833 572
235 3300042616 Ga0466715_001157 Ga0466715_001157_41191_42909 572
236 3300042616 Ga0466715_321177 Ga0466715_321177_2457_4175 572
237 3300042618 Ga0466723_287759 Ga0466723_287759_50272_51990 572
238 3300042648 Ga0466709_199853 Ga0466709_199853_821_2539 572
239 3300042652 Ga0466708_265321 Ga0466708_265321_12082_13800 572
240 3300042655 Ga0466727_155884 Ga0466727_155884_4277_5995 572
241 iso_pr_bacteria 2820137450 2820140028 572
242 3300010049 Ga0123356_10003864 Ga0123356_1000386412 573
243 3300042590 Ga0466690_109494 Ga0466690_109494_1835_3556 573
244 3300042596 Ga0466696_004159 Ga0466696_004159_2276_3997 573
245 3300042617 Ga0466718_049318 Ga0466718_049318_56243_57964 573
246 3300042643 Ga0466704_288212 Ga0466704_288212_4028_5749 573
247 3300042643 Ga0466704_294025 Ga0466704_294025_4837_6558 573
248 2225789004 2227466310 2227905831 574
249 3300010049 Ga0123356_10119852 Ga0123356_101198522 574
250 3300042604 Ga0466717_030873 Ga0466717_030873_697_2436 574
251 3300042618 Ga0466723_348373 Ga0466723_348373_3517_5241 574
252 3300042624 Ga0466735_081139 Ga0466735_081139_962_2686 574
253 3300042625 Ga0466730_011760 Ga0466730_011760_267531_269255 574
254 3300042636 Ga0466703_337715 Ga0466703_337715_37_1761 574
255 iso_pr_bacteria 2687453786 2690173161 574
256 iso_pr_bacteria 2820580397 2820580418 574
257 iso_pr_bacteria 2864831662 2864831926 574
258 iso_pr_bacteria 3002029927 3002030008 574
259 3300002450 JGI24695J34938_10000343 JGI24695J34938_1000034318 575
260 3300010049 Ga0123356_10042576 Ga0123356_100425763 575
261 3300042595 Ga0466695_358698 Ga0466695_358698_29478_31205 575
262 3300042598 Ga0466701_010990 Ga0466701_010990_25410_27137 575
263 3300042606 Ga0466719_306626 Ga0466719_306626_2856_4583 575
264 3300042618 Ga0466723_004854 Ga0466723_004854_6016_7743 575
265 iso_pr_bacteria 2864822740 2864824398 575
266 iso_pr_bacteria 2864882932 2864883283 575
267 3300010049 Ga0123356_10000767 Ga0123356_1000076717 576
268 3300042582 Ga0466657_062863 Ga0466657_062863_216_1946 576
269 iso_pr_bacteria 2820914081 2820914510 576
270 3300005201 Ga0072941_1226800 Ga0072941_12268003 577
271 3300042643 Ga0466704_395985 Ga0466704_395985_2749_4482 577
272 3300042652 Ga0466708_240824 Ga0466708_240824_2443_4176 577
273 3300012819 Ga0160468_100137 Ga0160468_10013757 578
274 3300042606 Ga0466719_075479 Ga0466719_075479_753_2489 578
275 3300042616 Ga0466715_237416 Ga0466715_237416_5098_6834 578
276 3300042618 Ga0466723_137319 Ga0466723_137319_1084_2820 578
277 3300042648 Ga0466709_053158 Ga0466709_053158_1651_3405 578
278 3300012841 Ga0160444_100090 Ga0160444_10009042 579
279 3300042593 Ga0466691_063579 Ga0466691_063579_7742_9481 579
280 3300042612 Ga0466705_336039 Ga0466705_336039_2631_4370 579
281 3300042621 Ga0466729_166636 Ga0466729_166636_171_1910 579
282 3300042624 Ga0466735_087349 Ga0466735_087349_2326_4065 579
283 3300010049 Ga0123356_10000676 Ga0123356_1000067619 580
284 3300010167 Ga0123353_10036222 Ga0123353_100362226 580
285 3300012803 Ga0160465_100152 Ga0160465_10015231 580
286 3300012858 Ga0160457_1001346 Ga0160457_10013462 580
287 3300042598 Ga0466701_102190 Ga0466701_102190_8990_10732 580
288 3300042624 Ga0466735_164792 Ga0466735_164792_2240_3982 580
289 3300042625 Ga0466730_054806 Ga0466730_054806_478145_479887 580
290 3300042648 Ga0466709_288828 Ga0466709_288828_3883_5625 580
291 3300042649 Ga0466724_25732 Ga0466724_25732_7046_8788 580
292 iso_pr_bacteria 2579779088 2582239334 580
293 iso_pr_bacteria 2896321640 2896323890 580
294 iso_pr_bacteria 2896330536 2896332459 580
295 iso_pr_bacteria 2896350215 2896352271 580
296 iso_pr_bacteria 2898741527 2898744327 580
297 iso_pr_bacteria 2931430189 2931431306 580
298 3300007143 Ga0104048_1168692 Ga0104048_11686922 581
299 3300007153 Ga0104050_1005409 Ga0104050_10054099 581
300 3300012824 Ga0160469_102064 Ga0160469_1020643 581
301 3300042593 Ga0466691_110498 Ga0466691_110498_1286_3031 581
302 3300042596 Ga0466696_217649 Ga0466696_217649_451_2196 581
303 3300042599 Ga0466706_228217 Ga0466706_228217_62517_64262 581
304 3300042606 Ga0466719_522042 Ga0466719_522042_146_1891 581
305 3300042636 Ga0466703_081658 Ga0466703_081658_23366_25111 581
306 3300042643 Ga0466704_453215 Ga0466704_453215_915_2660 581
307 iso_pr_bacteria 2590828803 2592928367 581
308 iso_pr_bacteria 2781125644 2781295937 581
309 3300012798 Ga0160454_100001 Ga0160454_10000136 582
310 3300012828 Ga0160431_104770 Ga0160431_1047701 582
311 3300012829 Ga0160467_100220 Ga0160467_10022019 582
312 3300012832 Ga0160458_100263 Ga0160458_1002632 582
313 3300042602 Ga0466713_090088 Ga0466713_090088_1335_3083 582
314 3300042609 Ga0466722_260930 Ga0466722_260930_2605_4353 582
315 3300042615 Ga0466711_511514 Ga0466711_511514_10923_12671 582
316 3300042643 Ga0466704_350877 Ga0466704_350877_266_2104 582
317 iso_pr_bacteria 8030347546 8030348467 582
318 3300009784 Ga0123357_10000026 Ga0123357_10000026107 583
319 3300010049 Ga0123356_10002065 Ga0123356_1000206514 583
320 3300012809 Ga0160466_103808 Ga0160466_1038082 583
321 3300012839 Ga0160472_100115 Ga0160472_10011544 583
322 3300042591 Ga0466692_045732 Ga0466692_045732_2262_4013 583
323 3300042602 Ga0466713_050983 Ga0466713_050983_7061_8812 583
324 3300042602 Ga0466713_079531 Ga0466713_079531_27600_29351 583
325 3300042616 Ga0466715_059738 Ga0466715_059738_2514_4265 583
326 3300042616 Ga0466715_170777 Ga0466715_170777_127_2001 583
327 3300042616 Ga0466715_350435 Ga0466715_350435_76_1827 583
328 3300042636 Ga0466703_313034 Ga0466703_313034_527_2278 583
329 3300042655 Ga0466727_149972 Ga0466727_149972_1970_3721 583
330 iso_pr_bacteria 2820911766 2820911807 583
331 3300007052 Ga0102736_1000057 Ga0102736_100005716 584
332 3300007068 Ga0103265_1000010 Ga0103265_10000106 584
333 3300007129 Ga0102734_1000373 Ga0102734_100037329 584
334 3300007188 Ga0103264_1000101 Ga0103264_100010137 584
335 3300007190 Ga0103267_1000232 Ga0103267_100023219 584
336 3300012846 Ga0160433_100368 Ga0160433_10036819 584
337 3300012846 Ga0160433_100420 Ga0160433_1004207 584
338 3300012858 Ga0160457_1000009 Ga0160457_1000009292 584
339 3300042643 Ga0466704_508228 Ga0466704_508228_64114_65868 584
340 3300042649 Ga0466724_22014 Ga0466724_22014_152672_154426 584
341 iso_pr_bacteria 2529292732 2529758708 584
342 iso_pr_bacteria 2630969010 2634123903 584
343 iso_pr_bacteria 2847090942 2847092704 584
344 iso_pr_bacteria 2864788197 2864791592 584
345 iso_pr_bacteria 2864923010 2864926406 584
346 iso_pr_bacteria 2864948220 2864951614 584
347 iso_pr_bacteria 8020009074 8020011257 584
348 iso_pr_bacteria 8114076984 8114079214 584
349 3300002464 Meta3P_1002643 Meta3P_10026435 585
350 3300010049 Ga0123356_10004461 Ga0123356_100044613 585
351 3300010049 Ga0123356_10037628 Ga0123356_100376281 585
352 3300056857 Ga0562376_0018 Ga0562376_0018_341563_343320 585
353 iso_pr_bacteria 2931425734 2931426968 585
354 3300005071 Ga0068302_10036884 Ga0068302_100368842 586
355 3300010049 Ga0123356_10030487 Ga0123356_100304875 586
356 3300010167 Ga0123353_10057794 Ga0123353_100577943 586
357 3300012825 Ga0160441_100409 Ga0160441_10040921 586
358 3300042615 Ga0466711_334169 Ga0466711_334169_1982_3742 586
359 3300056790 Ga0562379_0125 Ga0562379_0125_55587_57347 586
360 3300056814 Ga0562378_0355 Ga0562378_0355_24807_26567 586
361 iso_pr_bacteria 2820814774 2820816549 586
362 3300010049 Ga0123356_10040931 Ga0123356_100409313 587
363 3300042602 Ga0466713_001026 Ga0466713_001026_5276_7039 587
364 3300042609 Ga0466722_088105 Ga0466722_088105_4937_6748 587
365 3300009784 Ga0123357_10000615 Ga0123357_100006152 589
366 3300013007 Ga0157631_118613 Ga0157631_1186138 589
367 3300042600 Ga0466700_457508 Ga0466700_457508_2869_4638 589
368 3300042606 Ga0466719_125371 Ga0466719_125371_305_2074 589
369 3300042619 Ga0466726_271206 Ga0466726_271206_2050_3819 589
370 3300042654 Ga0466725_218436 Ga0466725_218436_409_2208 589
371 3300042655 Ga0466727_057740 Ga0466727_057740_690_2459 589
372 3300042606 Ga0466719_144344 Ga0466719_144344_3113_5008 590
373 iso_pr_bacteria 2781125659 2781329152 590
374 3300010167 Ga0123353_10044345 Ga0123353_100443452 591
375 3300042619 Ga0466726_345058 Ga0466726_345058_12241_14016 591
376 3300042622 Ga0466731_119536 Ga0466731_119536_2360_4135 591
377 iso_pr_bacteria 2508501067 2508839084 591
378 iso_pr_bacteria 2603880164 2606011868 591
379 iso_pr_bacteria 2687453757 2690049519 591
380 3300002931 CVPL010W_10000615 CVPL010W_1000061533 592
381 3300006995 Ga0102733_100004 Ga0102733_1000048 592
382 3300007042 Ga0103263_100075 Ga0103263_10007542 592
383 3300007052 Ga0102736_1000106 Ga0102736_100010616 592
384 3300007067 Ga0103266_1000044 Ga0103266_100004417 592
385 3300007080 Ga0102735_1000030 Ga0102735_100003026 592
386 3300007083 Ga0103261_1000031 Ga0103261_100003181 592
387 3300007095 Ga0102739_1000414 Ga0102739_10004149 592
388 3300007129 Ga0102734_1000084 Ga0102734_100008422 592
389 3300007139 Ga0103260_1000014 Ga0103260_100001436 592
390 3300007141 Ga0102738_1000007 Ga0102738_100000752 592
391 3300007142 Ga0102737_1000026 Ga0102737_100002642 592
392 3300007142 Ga0102737_1001419 Ga0102737_10014195 592
393 3300007188 Ga0103264_1015614 Ga0103264_10156142 592
394 3300007192 Ga0103268_1001540 Ga0103268_100154013 592
395 3300042602 Ga0466713_040722 Ga0466713_040722_3233_5011 592
396 3300057007 Ga0562374_0013 Ga0562374_0013_287298_289175 592
397 iso_pr_bacteria 2940239174 2940239970 592
398 iso_pr_bacteria 2940377351 2940378966 592
399 3300012848 Ga0160443_100327 Ga0160443_10032746 593
400 3300012861 Ga0160436_1000942 Ga0160436_10009423 593
401 3300042612 Ga0466705_118311 Ga0466705_118311_626_2407 593
402 3300042636 Ga0466703_393877 Ga0466703_393877_90190_91971 593
403 3300042610 Ga0466698_005253 Ga0466698_005253_96_1880 594
404 3300042615 Ga0466711_045149 Ga0466711_045149_4072_5856 594
405 3300042602 Ga0466713_107330 Ga0466713_107330_2342_4129 595
406 3300042615 Ga0466711_042770 Ga0466711_042770_279_2066 595
407 iso_pr_bacteria 2820171952 2820172788 595
408 iso_pr_bacteria 2820196379 2820197878 595
409 iso_pr_bacteria 2820201435 2820203306 595
410 3300010167 Ga0123353_10000170 Ga0123353_100001706 596
411 3300010167 Ga0123353_10091438 Ga0123353_100914382 596
412 3300042591 Ga0466692_043174 Ga0466692_043174_21067_22857 596
413 3300042609 Ga0466722_132299 Ga0466722_132299_56900_58720 596
414 iso_pr_bacteria 2820180635 2820181342 596
415 iso_pr_bacteria 2820205024 2820207408 596
416 3300002450 JGI24695J34938_10031752 JGI24695J34938_100317521 597
417 3300010167 Ga0123353_10007831 Ga0123353_100078317 597
418 iso_pr_bacteria 3002678670 3002681508 597
419 3300042591 Ga0466692_158668 Ga0466692_158668_299849_301648 599
420 3300042605 Ga0466716_053160 Ga0466716_053160_2056_3855 599
421 3300042615 Ga0466711_239916 Ga0466711_239916_138_1937 599
422 3300042616 Ga0466715_033684 Ga0466715_033684_9517_11316 599
423 3300042618 Ga0466723_045042 Ga0466723_045042_1149_2948 599
424 3300042649 Ga0466724_08127 Ga0466724_08127_8868_10670 600
425 3300042649 Ga0466724_46140 Ga0466724_46140_33445_35247 600
426 iso_pr_bacteria 2816332114 2816398322 600
427 iso_pr_bacteria 2820845766 2820847675 600
428 iso_pr_bacteria 2820894511 2820895161 600
429 iso_pr_bacteria 2847305884 2847308882 600
430 iso_pr_bacteria 2884613238 2884616366 600
431 iso_pr_bacteria 2918394494 2918394991 600
432 iso_pr_bacteria 8067987626 8067988975 600
433 3300012805 Ga0160464_100594 Ga0160464_1005942 601
434 3300012818 Ga0160432_102495 Ga0160432_1024952 601
435 3300012825 Ga0160441_100594 Ga0160441_10059422 601
436 3300012828 Ga0160431_104803 Ga0160431_1048032 601
437 3300012852 Ga0160430_102614 Ga0160430_1026143 601
438 iso_pr_bacteria 2639763185 2642347413 601
439 iso_pr_bacteria 2639763186 2642353053 601
440 iso_pr_bacteria 2820178484 2820179760 601
441 iso_pr_bacteria 2857493320 2857496776 601
442 iso_pr_bacteria 2857498920 2857502075 601
443 3300012845 Ga0160460_101647 Ga0160460_1016475 602
444 3300012852 Ga0160430_101833 Ga0160430_1018332 602
445 3300042596 Ga0466696_023490 Ga0466696_023490_1205_3013 602
446 3300042601 Ga0466707_343250 Ga0466707_343250_440_2248 602
447 iso_pr_bacteria 2706794701 2708048758 602
448 iso_pr_bacteria 2883683260 2883683265 602
449 3300042591 Ga0466692_076702 Ga0466692_076702_6732_8543 603
450 3300042591 Ga0466692_161938 Ga0466692_161938_73430_75241 603
451 iso_pr_bacteria 2836973655 2836973872 604
452 iso_pr_bacteria 2837204985 2837205376 604
453 3300042604 Ga0466717_165713 Ga0466717_165713_56_1873 605
454 3300042616 Ga0466715_083240 Ga0466715_083240_757_2574 605
455 iso_pr_bacteria 2818991320 2819437831 608
456 3300042655 Ga0466727_033664 Ga0466727_033664_1099_2928 609
457 3300012854 Ga0160448_103398 Ga0160448_1033982 612
458 3300042649 Ga0466724_66581 Ga0466724_66581_632714_634579 612
459 3300042598 Ga0466701_001389 Ga0466701_001389_333_2180 615
460 3300010167 Ga0123353_10001968 Ga0123353_100019686 616
461 3300012831 Ga0160459_100664 Ga0160459_1006648 617
462 iso_pr_bacteria 2517572100 2517755711 621
463 3300042612 Ga0466705_437717 Ga0466705_437717_13105_14973 622
464 3300042624 Ga0466735_115119 Ga0466735_115119_1426_3306 626
465 3300000036 IMNBGM34_c000044 IMNBGM34_00004417 632
466 3300007190 Ga0103267_1000427 Ga0103267_100042714 633
467 iso_pr_bacteria 2824199081 2824200124 633
468 iso_pr_bacteria 2645727657 2646404766 636
469 3300042621 Ga0466729_196745 Ga0466729_196745_8378_10303 641
470 iso_pr_bacteria 8012935351 8012935542 644
471 3300042616 Ga0466715_302876 Ga0466715_302876_22315_24273 652
472 3300010167 Ga0123353_10024343 Ga0123353_100243436 667

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain 270 405 0.98
PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain 476 642 0.96
PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain 78 191 0.96

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF02776 GO:0030976 thiamine pyrophosphate binding MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.86 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.