Protein Family IF03057
Metagenome
Isolate
160
Members
63
Samples
132
Scaffolds
314.09
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10009398|Ga0123353_100093987
- Length
- 394 aa
- Sequence
- VVFLDNVPRAGWKADNSPAWRGGREADGVVXXXXDTRGGVDSFLGFRLTGGFRCDTIPWLFFTEGKESPMIELAGIHKTFRVARRQAGFGRAVKALFSREVELVHALTDVNFTIRDGEMVGYIGPNGAGKSTTIKIMCGILTPDSGVCEIDGRTPWKERVAHVREIGVVFGQRSQLWWDVPVIDSFELIRDIYKVGANLYKRNLDELTALLDLEEIVKTPARSLSLGQRMRCEIAASLLHSPRTLFLDEPTIGLDAVSKIAVRQFIKKLSAEHGTTVILTTHDMQDIEALTERILLIGKGRILLDGGLAELKKRSSERKTLVIEHSGGAPALCEGMALCEEKEGRLVVALDPSVLSVSEAIARLAAQTEINDISVSDITAEEMVAALYREYQI*
Sample Types
Isolate
17.5%
Metagenome
82.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
40.3%
Termitidae
35.5%
Kalotermitidae
16.1%
Hodotermitidae
1.6%
Rhinotermitidae
1.6%
Scarabaeidae
1.6%
Dytiscidae
1.6%
Passalidae
1.6%
Taxonomy
Archaea
0
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820238527 | Unclassified Firmicutes Th196P3bin90 | Isolate | Unclassified |
| 2 | 2820348946 | Unclassified Firmicutes Nt197P3bin47 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2585428085 | Sporobacter termitidis DSM 10068 | Isolate | Termitidae |
| 10 | 2820227065 | Unclassified Firmicutes Th196P4bin44 | Isolate | Unclassified |
| 11 | 2820435670 | Unclassified Firmicutes Lab288P3bin217 | Isolate | Unclassified |
| 12 | 2820854745 | Unclassified Actinobacteria Lab288P3bin234 | Isolate | Unclassified |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 22 | 2820229114 | Unclassified Firmicutes Th196P4bin40 | Isolate | Unclassified |
| 23 | 2820290662 | Unclassified Firmicutes Th196P3bin135 | Isolate | Unclassified |
| 24 | 2820353569 | Unclassified Firmicutes Nt197P3bin28 | Isolate | Unclassified |
| 25 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 33 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 34 | 2820654856 | Unclassified Firmicutes Cu122P1bin2 | Isolate | Unclassified |
| 35 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 2820282995 | Unclassified Firmicutes Th196P3bin147 | Isolate | Unclassified |
| 39 | 2820329821 | Unclassified Firmicutes Nt197P3bin77 | Isolate | Unclassified |
| 40 | 2820576413 | Unclassified Firmicutes Emb289P3bin136 | Isolate | Unclassified |
| 41 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 42 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 43 | 2820547636 | Unclassified Firmicutes Lab288P1bin10 | Isolate | Unclassified |
| 44 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 45 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 46 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 47 | 2820472365 | Unclassified Firmicutes Lab288P1bin87 | Isolate | Unclassified |
| 48 | 2820563109 | Unclassified Firmicutes Emb289P3bin58 | Isolate | Unclassified |
| 49 | 2873593402 | Erysipelothrix sp. HDW6A | Isolate | Dytiscidae |
| 50 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 51 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 52 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 53 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 54 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 55 | 2820246658 | Unclassified Firmicutes Th196P3bin70 | Isolate | Unclassified |
| 56 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 57 | 2820336130 | Unclassified Firmicutes Nt197P3bin70 | Isolate | Unclassified |
| 58 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 61 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 62 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 63 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_112134 | 3300042612 | Bacteria | 69988 |
| 2 | Ga0466714_065722 | 3300042603 | Bacteria | 1961 |
| 3 | Ga0466717_007877 | 3300042604 | Bacteria | 8770 |
| 4 | Ga0123357_10037814 | 3300009784 | Bacteria | 6570 |
| 5 | Ga0123355_10016922 | 3300009826 | Bacteria | 11503 |
| 6 | Ga0123353_10007132 | 3300010167 | Bacteria | 15048 |
| 7 | Ga0123353_10026110 | 3300010167 | Bacteria | 8913 |
| 8 | Ga0466691_008700 | 3300042593 | Bacteria | 6236 |
| 9 | JGI24705J35276_12195354 | 3300002504 | Bacteria | 1524 |
| 10 | Ga0466698_127748 | 3300042610 | Bacteria | 1901 |
| 11 | Ga0466703_019738 | 3300042636 | Bacteria | 41879 |
| 12 | Ga0466725_047440 | 3300042654 | Bacteria | 2632 |
| 13 | Ga0466725_272926 | 3300042654 | Bacteria | 2104 |
| 14 | Ga0123355_10000319 | 3300009826 | Bacteria | 61820 |
| 15 | Ga0123355_10161252 | 3300009826 | Bacteria | 3378 |
| 16 | Ga0123355_10347435 | 3300009826 | Bacteria | 1969 |
| 17 | Ga0123356_10000942 | 3300010049 | Bacteria | 32205 |
| 18 | Ga0123356_10017513 | 3300010049 | Bacteria | 6816 |
| 19 | Ga0123353_10138870 | 3300010167 | Bacteria | 3895 |
| 20 | Ga0123353_10251845 | 3300010167 | Bacteria | 2734 |
| 21 | Ga0123353_10457479 | 3300010167 | Bacteria | 1877 |
| 22 | Ga0123353_10487712 | 3300010167 | Bacteria | 1801 |
| 23 | Ga0123354_10041172 | 3300010882 | Bacteria | 7141 |
| 24 | JGI24702J35022_10001085 | 3300002462 | Bacteria | 16932 |
| 25 | Ga0466705_365220 | 3300042612 | Bacteria | 1996 |
| 26 | Ga0466733_070219 | 3300042659 | Bacteria | 3421 |
| 27 | Ga0466706_260991 | 3300042599 | Unclassified | 2399 |
| 28 | Ga0466717_233913 | 3300042604 | Bacteria | 2467 |
| 29 | Ga0466718_018855 | 3300042617 | Bacteria | 1368 |
| 30 | Ga0466718_144245 | 3300042617 | Bacteria | 2260 |
| 31 | Ga0466728_274561 | 3300042620 | Bacteria | 4501 |
| 32 | Ga0466702_015081 | 3300042635 | Bacteria | 1260 |
| 33 | Ga0466704_020045 | 3300042643 | Bacteria | 3477 |
| 34 | Ga0466708_385803 | 3300042652 | Bacteria | 6215 |
| 35 | Ga0123355_10090464 | 3300009826 | Bacteria | 4855 |
| 36 | Ga0123355_10118198 | 3300009826 | Bacteria | 4120 |
| 37 | Ga0123355_10408928 | 3300009826 | Bacteria | 1743 |
| 38 | Ga0123353_10119203 | 3300010167 | Bacteria | 4244 |
| 39 | IMNBL1DRAFT_c0004267 | 3300000062 | Bacteria | 8653 |
| 40 | JGI24696J40584_12942106 | 3300002834 | Unclassified | 1729 |
| 41 | Ga0466705_239567 | 3300042612 | Bacteria | 3692 |
| 42 | Ga0466706_226117 | 3300042599 | Bacteria | 4395 |
| 43 | Ga0466714_130616 | 3300042603 | Bacteria | 1116 |
| 44 | Ga0466717_210281 | 3300042604 | Bacteria | 2544 |
| 45 | Ga0466719_484306 | 3300042606 | Bacteria | 1722 |
| 46 | Ga0466711_233007 | 3300042615 | Bacteria | 3925 |
| 47 | Ga0466715_429206 | 3300042616 | Bacteria | 39560 |
| 48 | Ga0123355_10001643 | 3300009826 | Bacteria | 31165 |
| 49 | Ga0123355_10019314 | 3300009826 | Bacteria | 10850 |
| 50 | Ga0123355_10130052 | 3300009826 | Bacteria | 3881 |
| 51 | Ga0123355_10252279 | 3300009826 | Bacteria | 2482 |
| 52 | Ga0123355_10369300 | 3300009826 | Bacteria | 1881 |
| 53 | Ga0123355_10699536 | 3300009826 | Bacteria | 1164 |
| 54 | Ga0123355_10712442 | 3300009826 | Bacteria | 1148 |
| 55 | Ga0123356_10035108 | 3300010049 | Bacteria | 4686 |
| 56 | Ga0123353_10019922 | 3300010167 | Bacteria | 9993 |
| 57 | Ga0123353_10044079 | 3300010167 | Bacteria | 7071 |
| 58 | Ga0123353_10147349 | 3300010167 | Bacteria | 3762 |
| 59 | Ga0123353_10391970 | 3300010167 | Bacteria | 2071 |
| 60 | Ga0415639_001596 | 3300038395 | Bacteria | 16462 |
| 61 | Ga0415639_153862 | 3300038395 | Bacteria | 2196 |
| 62 | Ga0466706_032296 | 3300042599 | Bacteria | 2143 |
| 63 | Ga0466714_032719 | 3300042603 | Bacteria | 4212 |
| 64 | Ga0466721_102600 | 3300042608 | Bacteria | 1845 |
| 65 | Ga0466705_464923 | 3300042612 | Bacteria | 107405 |
| 66 | Ga0466718_121877 | 3300042617 | Bacteria | 1409 |
| 67 | Ga0466702_255697 | 3300042635 | Bacteria | 5575 |
| 68 | Ga0466703_145380 | 3300042636 | Bacteria | 7606 |
| 69 | Ga0123355_10044014 | 3300009826 | Bacteria | 7264 |
| 70 | Ga0123355_10096125 | 3300009826 | Bacteria | 4680 |
| 71 | Ga0123355_10754398 | 3300009826 | Bacteria | 1099 |
| 72 | Ga0123356_10035636 | 3300010049 | Bacteria | 4647 |
| 73 | Ga0123356_10123456 | 3300010049 | Bacteria | 2524 |
| 74 | Ga0123353_10023145 | 3300010167 | Bacteria | 9397 |
| 75 | Ga0123353_10064671 | 3300010167 | Bacteria | 5871 |
| 76 | Ga0123353_10179440 | 3300010167 | Bacteria | 3354 |
| 77 | Ga0123353_10197881 | 3300010167 | Bacteria | 3165 |
| 78 | Ga0123354_10450053 | 3300010882 | Bacteria | 1044 |
| 79 | JGI24703J35330_11748607 | 3300002501 | Bacteria | 21865 |
| 80 | Ga0466705_306648 | 3300042612 | Bacteria | 5175 |
| 81 | Ga0466706_150183 | 3300042599 | Unclassified | 15248 |
| 82 | Ga0466719_226791 | 3300042606 | Bacteria | 6608 |
| 83 | Ga0466721_177485 | 3300042608 | Bacteria | 16105 |
| 84 | Ga0466718_158317 | 3300042617 | Bacteria | 2187 |
| 85 | Ga0466731_060585 | 3300042622 | Bacteria | 2356 |
| 86 | Ga0123355_10000141 | 3300009826 | Bacteria | 86040 |
| 87 | Ga0123355_10003676 | 3300009826 | Bacteria | 22119 |
| 88 | Ga0123355_10004854 | 3300009826 | Bacteria | 19573 |
| 89 | Ga0123355_10115049 | 3300009826 | Bacteria | 4190 |
| 90 | Ga0123355_10476322 | 3300009826 | Bacteria | 1556 |
| 91 | Ga0123356_10289665 | 3300010049 | Bacteria | 1737 |
| 92 | Ga0123353_10000556 | 3300010167 | Bacteria | 45840 |
| 93 | Ga0123353_10026144 | 3300010167 | Bacteria | 8909 |
| 94 | Ga0123353_10049745 | 3300010167 | Bacteria | 6678 |
| 95 | Ga0123353_10160556 | 3300010167 | Bacteria | 3579 |
| 96 | Ga0466690_208398 | 3300042590 | Bacteria | 2919 |
| 97 | JGI24702J35022_10000169 | 3300002462 | Bacteria | 34308 |
| 98 | Ga0466713_147824 | 3300042602 | Bacteria | 2256 |
| 99 | Ga0466714_053800 | 3300042603 | Bacteria | 1450 |
| 100 | Ga0466721_250610 | 3300042608 | Unclassified | 2565 |
| 101 | Ga0466704_510194 | 3300042643 | Unclassified | 1330 |
| 102 | Ga0123355_10000114 | 3300009826 | Bacteria | 90963 |
| 103 | Ga0123355_10006192 | 3300009826 | Bacteria | 17669 |
| 104 | Ga0123355_10021263 | 3300009826 | Bacteria | 10383 |
| 105 | Ga0123355_10282616 | 3300009826 | Bacteria | 2289 |
| 106 | Ga0123355_10396500 | 3300009826 | Bacteria | 1784 |
| 107 | Ga0123355_10643757 | 3300009826 | Bacteria | 1240 |
| 108 | Ga0123356_10003321 | 3300010049 | Bacteria | 16883 |
| 109 | Ga0123356_10331366 | 3300010049 | Bacteria | 1639 |
| 110 | Ga0123356_10353910 | 3300010049 | Bacteria | 1593 |
| 111 | Ga0123356_10420553 | 3300010049 | Bacteria | 1478 |
| 112 | Ga0123353_10284804 | 3300010167 | Bacteria | 2535 |
| 113 | Ga0466693_046040 | 3300042592 | Bacteria | 2785 |
| 114 | IMNBL1DRAFT_c0013016 | 3300000062 | Bacteria | 3763 |
| 115 | JGI24695J34938_10000267 | 3300002450 | Bacteria | 50738 |
| 116 | JGI24702J35022_10005689 | 3300002462 | Bacteria | 7264 |
| 117 | JGI24702J35022_10010650 | 3300002462 | Bacteria | 5137 |
| 118 | Ga0466733_028126 | 3300042659 | Bacteria | 1739 |
| 119 | Ga0466714_105508 | 3300042603 | Bacteria | 1283 |
| 120 | Ga0466717_004852 | 3300042604 | Bacteria | 1446 |
| 121 | Ga0466717_215884 | 3300042604 | Bacteria | 3969 |
| 122 | Ga0466721_143896 | 3300042608 | Bacteria | 1455 |
| 123 | Ga0466722_136743 | 3300042609 | Bacteria | 57023 |
| 124 | Ga0466731_294200 | 3300042622 | Bacteria | 2210 |
| 125 | Ga0466704_025614 | 3300042643 | Bacteria | 9149 |
| 126 | Ga0123355_10002295 | 3300009826 | Bacteria | 27035 |
| 127 | Ga0123355_10093317 | 3300009826 | Bacteria | 4765 |
| 128 | Ga0123355_10098991 | 3300009826 | Bacteria | 4596 |
| 129 | Ga0123355_10288536 | 3300009826 | Bacteria | 2255 |
| 130 | Ga0123356_10102502 | 3300010049 | Bacteria | 2748 |
| 131 | Ga0123353_10009398 | 3300010167 | Bacteria | 13492 |
| 132 | JGI24695J34938_10000701 | 3300002450 | Bacteria | 31525 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042604 | Ga0466717_004852 | Ga0466717_004852_531_1328 | 265 |
| 2 | 3300042654 | Ga0466725_272926 | Ga0466725_272926_43_840 | 265 |
| 3 | iso_pr_bacteria | 2820329821 | 2820331662 | 265 |
| 4 | iso_pr_bacteria | 2820435670 | 2820438419 | 265 |
| 5 | iso_pr_bacteria | 2820654856 | 2820656959 | 265 |
| 6 | 3300009826 | Ga0123355_10000141 | Ga0123355_1000014142 | 266 |
| 7 | 3300009826 | Ga0123355_10001643 | Ga0123355_100016435 | 266 |
| 8 | 3300009826 | Ga0123355_10021263 | Ga0123355_100212637 | 266 |
| 9 | 3300009826 | Ga0123355_10161252 | Ga0123355_101612525 | 266 |
| 10 | 3300009826 | Ga0123355_10282616 | Ga0123355_102826162 | 266 |
| 11 | 3300009826 | Ga0123355_10408928 | Ga0123355_104089282 | 266 |
| 12 | 3300009826 | Ga0123355_10476322 | Ga0123355_104763222 | 266 |
| 13 | 3300009826 | Ga0123355_10712442 | Ga0123355_107124422 | 266 |
| 14 | 3300009826 | Ga0123355_10754398 | Ga0123355_107543981 | 266 |
| 15 | 3300042599 | Ga0466706_032296 | Ga0466706_032296_1062_1865 | 267 |
| 16 | 3300042599 | Ga0466706_150183 | Ga0466706_150183_5869_6672 | 267 |
| 17 | 3300042599 | Ga0466706_260991 | Ga0466706_260991_78_881 | 267 |
| 18 | 3300042659 | Ga0466733_070219 | Ga0466733_070219_2518_3321 | 267 |
| 19 | 3300010167 | Ga0123353_10019922 | Ga0123353_100199221 | 268 |
| 20 | 3300038395 | Ga0415639_001596 | Ga0415639_001596_7308_8114 | 268 |
| 21 | 3300010049 | Ga0123356_10035108 | Ga0123356_100351084 | 269 |
| 22 | 3300042617 | Ga0466718_018855 | Ga0466718_018855_546_1355 | 269 |
| 23 | iso_pr_bacteria | 2820702360 | 2820704569 | 269 |
| 24 | 3300009826 | Ga0123355_10003676 | Ga0123355_1000367614 | 270 |
| 25 | 3300009826 | Ga0123355_10019314 | Ga0123355_100193148 | 270 |
| 26 | 3300009826 | Ga0123355_10044014 | Ga0123355_100440147 | 270 |
| 27 | 3300009826 | Ga0123355_10093317 | Ga0123355_100933172 | 270 |
| 28 | 3300009826 | Ga0123355_10096125 | Ga0123355_100961254 | 270 |
| 29 | 3300009826 | Ga0123355_10118198 | Ga0123355_101181984 | 270 |
| 30 | 3300009826 | Ga0123355_10288536 | Ga0123355_102885362 | 270 |
| 31 | 3300009826 | Ga0123355_10090464 | Ga0123355_100904642 | 271 |
| 32 | 3300042643 | Ga0466704_025614 | Ga0466704_025614_8142_8960 | 272 |
| 33 | 3300009826 | Ga0123355_10347435 | Ga0123355_103474352 | 277 |
| 34 | 3300009826 | Ga0123355_10006192 | Ga0123355_100061928 | 279 |
| 35 | 3300009826 | Ga0123355_10004854 | Ga0123355_1000485410 | 306 |
| 36 | 3300009826 | Ga0123355_10115049 | Ga0123355_101150495 | 318 |
| 37 | 3300042617 | Ga0466718_121877 | Ga0466718_121877_341_1333 | 319 |
| 38 | iso_pr_bacteria | 2820825283 | 2820828387 | 320 |
| 39 | iso_pr_bacteria | 2873593402 | 2873594113 | 320 |
| 40 | 3300042608 | Ga0466721_143896 | Ga0466721_143896_373_1341 | 322 |
| 41 | 3300038395 | Ga0415639_153862 | Ga0415639_153862_194_1168 | 324 |
| 42 | 3300042592 | Ga0466693_046040 | Ga0466693_046040_1371_2345 | 324 |
| 43 | 3300042599 | Ga0466706_226117 | Ga0466706_226117_3112_4086 | 324 |
| 44 | 3300042603 | Ga0466714_032719 | Ga0466714_032719_1815_2789 | 324 |
| 45 | 3300042603 | Ga0466714_065722 | Ga0466714_065722_246_1220 | 324 |
| 46 | 3300042603 | Ga0466714_105508 | Ga0466714_105508_152_1126 | 324 |
| 47 | 3300042603 | Ga0466714_130616 | Ga0466714_130616_84_1058 | 324 |
| 48 | 3300042604 | Ga0466717_007877 | Ga0466717_007877_1773_2747 | 324 |
| 49 | 3300042604 | Ga0466717_210281 | Ga0466717_210281_124_1098 | 324 |
| 50 | 3300042604 | Ga0466717_215884 | Ga0466717_215884_1258_2232 | 324 |
| 51 | 3300042606 | Ga0466719_226791 | Ga0466719_226791_3726_4700 | 324 |
| 52 | 3300042606 | Ga0466719_484306 | Ga0466719_484306_592_1566 | 324 |
| 53 | 3300042608 | Ga0466721_102600 | Ga0466721_102600_566_1540 | 324 |
| 54 | 3300042608 | Ga0466721_177485 | Ga0466721_177485_404_1378 | 324 |
| 55 | 3300042608 | Ga0466721_250610 | Ga0466721_250610_270_1244 | 324 |
| 56 | 3300042609 | Ga0466722_136743 | Ga0466722_136743_19470_20444 | 324 |
| 57 | 3300042612 | Ga0466705_239567 | Ga0466705_239567_2185_3159 | 324 |
| 58 | 3300042612 | Ga0466705_306648 | Ga0466705_306648_2378_3352 | 324 |
| 59 | 3300042612 | Ga0466705_365220 | Ga0466705_365220_808_1782 | 324 |
| 60 | 3300042612 | Ga0466705_464923 | Ga0466705_464923_79424_80398 | 324 |
| 61 | 3300042615 | Ga0466711_233007 | Ga0466711_233007_338_1312 | 324 |
| 62 | 3300042616 | Ga0466715_429206 | Ga0466715_429206_26095_27069 | 324 |
| 63 | 3300042617 | Ga0466718_144245 | Ga0466718_144245_994_1968 | 324 |
| 64 | 3300042617 | Ga0466718_158317 | Ga0466718_158317_125_1099 | 324 |
| 65 | 3300042622 | Ga0466731_060585 | Ga0466731_060585_174_1148 | 324 |
| 66 | 3300042635 | Ga0466702_015081 | Ga0466702_015081_152_1126 | 324 |
| 67 | 3300042635 | Ga0466702_255697 | Ga0466702_255697_1923_2897 | 324 |
| 68 | 3300042636 | Ga0466703_145380 | Ga0466703_145380_5474_6448 | 324 |
| 69 | 3300042643 | Ga0466704_020045 | Ga0466704_020045_463_1437 | 324 |
| 70 | 3300042654 | Ga0466725_047440 | Ga0466725_047440_200_1174 | 324 |
| 71 | iso_pr_bacteria | 2585428085 | 2587833201 | 324 |
| 72 | iso_pr_bacteria | 2781125650 | 2781308219 | 324 |
| 73 | iso_pr_bacteria | 2820227065 | 2820228197 | 324 |
| 74 | iso_pr_bacteria | 2820229114 | 2820229540 | 324 |
| 75 | iso_pr_bacteria | 2820238527 | 2820239106 | 324 |
| 76 | iso_pr_bacteria | 2820246658 | 2820246771 | 324 |
| 77 | iso_pr_bacteria | 2820267566 | 2820268096 | 324 |
| 78 | iso_pr_bacteria | 2820282995 | 2820284428 | 324 |
| 79 | iso_pr_bacteria | 2820290662 | 2820291065 | 324 |
| 80 | iso_pr_bacteria | 2820336130 | 2820336818 | 324 |
| 81 | iso_pr_bacteria | 2820353569 | 2820356802 | 324 |
| 82 | iso_pr_bacteria | 2820371985 | 2820373045 | 324 |
| 83 | iso_pr_bacteria | 2820420508 | 2820422014 | 324 |
| 84 | iso_pr_bacteria | 2820547636 | 2820549847 | 324 |
| 85 | iso_pr_bacteria | 2820563109 | 2820564689 | 324 |
| 86 | iso_pr_bacteria | 2820576413 | 2820577542 | 324 |
| 87 | iso_pr_bacteria | 2820800812 | 2820801826 | 324 |
| 88 | iso_pr_bacteria | 2820854745 | 2820856448 | 324 |
| 89 | iso_pr_bacteria | 8018794549 | 8018797578 | 324 |
| 90 | 3300000062 | IMNBL1DRAFT_c0004267 | IMNBL1DRAFT_00042675 | 325 |
| 91 | 3300002450 | JGI24695J34938_10000267 | JGI24695J34938_1000026732 | 325 |
| 92 | 3300002450 | JGI24695J34938_10000701 | JGI24695J34938_1000070124 | 325 |
| 93 | 3300002462 | JGI24702J35022_10000169 | JGI24702J35022_100001696 | 325 |
| 94 | 3300002462 | JGI24702J35022_10001085 | JGI24702J35022_1000108511 | 325 |
| 95 | 3300002462 | JGI24702J35022_10005689 | JGI24702J35022_1000568913 | 325 |
| 96 | 3300002462 | JGI24702J35022_10010650 | JGI24702J35022_100106505 | 325 |
| 97 | 3300002504 | JGI24705J35276_12195354 | JGI24705J35276_121953542 | 325 |
| 98 | 3300002834 | JGI24696J40584_12942106 | JGI24696J40584_129421061 | 325 |
| 99 | 3300009826 | Ga0123355_10016922 | Ga0123355_100169222 | 325 |
| 100 | 3300009826 | Ga0123355_10369300 | Ga0123355_103693002 | 325 |
| 101 | 3300010049 | Ga0123356_10000942 | Ga0123356_100009422 | 325 |
| 102 | 3300010049 | Ga0123356_10003321 | Ga0123356_1000332111 | 325 |
| 103 | 3300010049 | Ga0123356_10035636 | Ga0123356_100356365 | 325 |
| 104 | 3300010049 | Ga0123356_10102502 | Ga0123356_101025022 | 325 |
| 105 | 3300010049 | Ga0123356_10331366 | Ga0123356_103313662 | 325 |
| 106 | 3300010049 | Ga0123356_10420553 | Ga0123356_104205532 | 325 |
| 107 | 3300010167 | Ga0123353_10000556 | Ga0123353_100005565 | 325 |
| 108 | 3300010167 | Ga0123353_10007132 | Ga0123353_100071328 | 325 |
| 109 | 3300010167 | Ga0123353_10026110 | Ga0123353_100261104 | 325 |
| 110 | 3300010167 | Ga0123353_10026144 | Ga0123353_1002614410 | 325 |
| 111 | 3300010167 | Ga0123353_10044079 | Ga0123353_100440796 | 325 |
| 112 | 3300010167 | Ga0123353_10064671 | Ga0123353_100646714 | 325 |
| 113 | 3300010167 | Ga0123353_10138870 | Ga0123353_101388703 | 325 |
| 114 | 3300010167 | Ga0123353_10147349 | Ga0123353_101473493 | 325 |
| 115 | 3300010167 | Ga0123353_10160556 | Ga0123353_101605563 | 325 |
| 116 | 3300010167 | Ga0123353_10197881 | Ga0123353_101978812 | 325 |
| 117 | 3300010167 | Ga0123353_10284804 | Ga0123353_102848042 | 325 |
| 118 | 3300010167 | Ga0123353_10391970 | Ga0123353_103919702 | 325 |
| 119 | 3300010167 | Ga0123353_10457479 | Ga0123353_104574791 | 325 |
| 120 | 3300010882 | Ga0123354_10041172 | Ga0123354_100411724 | 325 |
| 121 | 3300010882 | Ga0123354_10450053 | Ga0123354_104500531 | 325 |
| 122 | 3300042612 | Ga0466705_112134 | Ga0466705_112134_57885_58862 | 325 |
| 123 | 3300042620 | Ga0466728_274561 | Ga0466728_274561_15_992 | 325 |
| 124 | 3300042636 | Ga0466703_019738 | Ga0466703_019738_37453_38430 | 325 |
| 125 | 3300042659 | Ga0466733_028126 | Ga0466733_028126_595_1572 | 325 |
| 126 | iso_pr_bacteria | 2820348946 | 2820349064 | 325 |
| 127 | iso_pr_bacteria | 2820472365 | 2820472870 | 325 |
| 128 | iso_pr_bacteria | 2852337885 | 2852338820 | 325 |
| 129 | 3300000062 | IMNBL1DRAFT_c0013016 | IMNBL1DRAFT_00130162 | 326 |
| 130 | 3300009826 | Ga0123355_10000114 | Ga0123355_1000011414 | 326 |
| 131 | 3300009826 | Ga0123355_10000319 | Ga0123355_1000031912 | 326 |
| 132 | 3300009826 | Ga0123355_10098991 | Ga0123355_100989912 | 326 |
| 133 | 3300009826 | Ga0123355_10130052 | Ga0123355_101300523 | 326 |
| 134 | 3300009826 | Ga0123355_10252279 | Ga0123355_102522794 | 326 |
| 135 | 3300009826 | Ga0123355_10396500 | Ga0123355_103965002 | 326 |
| 136 | 3300009826 | Ga0123355_10643757 | Ga0123355_106437571 | 326 |
| 137 | 3300009826 | Ga0123355_10699536 | Ga0123355_106995361 | 326 |
| 138 | 3300010049 | Ga0123356_10289665 | Ga0123356_102896652 | 326 |
| 139 | 3300010049 | Ga0123356_10353910 | Ga0123356_103539102 | 326 |
| 140 | 3300010167 | Ga0123353_10023145 | Ga0123353_100231455 | 326 |
| 141 | 3300042593 | Ga0466691_008700 | Ga0466691_008700_2187_3167 | 326 |
| 142 | 3300009784 | Ga0123357_10037814 | Ga0123357_100378145 | 327 |
| 143 | 3300009826 | Ga0123355_10002295 | Ga0123355_100022953 | 327 |
| 144 | 3300010049 | Ga0123356_10017513 | Ga0123356_100175136 | 327 |
| 145 | 3300010049 | Ga0123356_10123456 | Ga0123356_101234562 | 327 |
| 146 | 3300010167 | Ga0123353_10251845 | Ga0123353_102518452 | 327 |
| 147 | 3300042610 | Ga0466698_127748 | Ga0466698_127748_522_1508 | 328 |
| 148 | 3300010167 | Ga0123353_10179440 | Ga0123353_101794402 | 330 |
| 149 | 3300042603 | Ga0466714_053800 | Ga0466714_053800_101_1093 | 330 |
| 150 | 3300010167 | Ga0123353_10487712 | Ga0123353_104877122 | 332 |
| 151 | 3300010167 | Ga0123353_10049745 | Ga0123353_100497456 | 333 |
| 152 | 3300042604 | Ga0466717_233913 | Ga0466717_233913_222_1229 | 335 |
| 153 | 3300010167 | Ga0123353_10119203 | Ga0123353_101192034 | 336 |
| 154 | 3300042590 | Ga0466690_208398 | Ga0466690_208398_431_1444 | 337 |
| 155 | 3300042643 | Ga0466704_510194 | Ga0466704_510194_226_1248 | 340 |
| 156 | 3300002501 | JGI24703J35330_11748607 | JGI24703J35330_1174860719 | 347 |
| 157 | 3300042652 | Ga0466708_385803 | Ga0466708_385803_539_1588 | 349 |
| 158 | 3300042622 | Ga0466731_294200 | Ga0466731_294200_1052_2125 | 357 |
| 159 | 3300042602 | Ga0466713_147824 | Ga0466713_147824_99_1178 | 359 |
| 160 | 3300010167 | Ga0123353_10009398 | Ga0123353_100093987 | 394 |
Functional Annotation
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.73 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.