Protein Family IF03052

Metagenome Isolate
146 Members
68 Samples
129 Scaffolds
394.95 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10006246|Ga0123353_1000624613
Length
436 aa
Sequence
MIITPGQSHPHLLNLQELNTEMSNFVHYITDTQIIPLLKGGCTMSEKMLFIDEALASLQESGLYNNIRAIESAQGAWLQIEGKKVLNMCSNNYLGLANHPRLVQAAKAAIDKYGVGPAAVRSIAGTQSIHEELDQEVAKFKHAEAALTLQGGFLANQAVIPSLVGKTDTILSDELNHASIIDGARLSSAKIKVFRHKDLAHLEELLQGPNDGRVLVITDGVFSMDGDIGDLDKIVELCEKYGAMSMVDDAHGEGVLGSHGRGIVDHFKLHGRCDVEIGTFSKAIGTVGGFVAGSAKLITYLKQRARPFLFSSALPAADVGATLEAFRLLQESDELVQKLWENARFFKQGMQDLGFDTGLSQTPITPVMIGEADVARQFSALLFTKGIFAMAIGFPTVPRGKARIRVMISASHSRGDLEFALEKFAAAGKEMELIS*

📊 Sample Types

Isolate 11.6%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 23.0%
Unclassified 18.0%
Termitidae 11.5%
Drosophilidae 8.2%
Termopsidae 6.6%
Armadillidiidae 6.6%
Formicidae 6.6%
Rhinotermitidae 4.9%
Stratiomyidae 3.3%
Hydrophilidae 1.6%
Passalidae 1.6%
Tenebrionidae 1.6%
Hodotermitidae 1.6%
Bombycidae 1.6%
Syrphidae 1.6%
Culicidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 128
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2898741527 Sphingobacterium sp. xlx-73 Isolate
2 2540341224 Williamsoniiplasma luminosum ATCC 49195 Isolate Unclassified
3 2545824514 Entomoplasma somnilux ATCC 49194 Isolate Unclassified
4 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
5 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
6 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 2873776654 Pedobacter sp. HDW13 Isolate Hydrophilidae
13 2540341223 Entomoplasma lucivorax ATCC 49196 Isolate Unclassified
14 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
18 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
19 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
20 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
21 3300007080 Ant gut microbial communities from Cephalotes clypeatus, Brazil Metagenome Formicidae
22 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
26 8030337018 Tissierella sp. Yu-01 Isolate Stratiomyidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
32 2772190892 Unclassified Elusimicrobia Lab288P3_bin37 Isolate Unclassified
33 2554235381 Spiroplasma syrphidicola EA-1 Isolate Syrphidae
34 3300012820 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG Metagenome Armadillidiidae
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
36 2896350215 Sphingobacterium sp. xlx-183 Isolate
37 3300007058 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 3 gut Metagenome Drosophilidae
38 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
39 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
40 3300012803 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG Metagenome
41 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
42 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
43 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
44 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 2896321640 Sphingobacterium sp. xlx-130 Isolate
47 2772190894 Unclassified Elusimicrobia Th196P4_bin33 Isolate Unclassified
48 2820451402 Unclassified Firmicutes Lab288P3bin174 Isolate Unclassified
49 2554235371 Spiroplasma chrysopicola DF-1 Isolate Unclassified
50 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
51 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
52 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
53 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2754412483 Unclassified Elusimicrobia Lab288P4bin38 Isolate Unclassified
58 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
59 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
60 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
61 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
62 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
63 2896330536 Sphingobacterium sp. xlx-96 Isolate
64 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
65 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
66 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
67 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
68 3300012832 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123353_10006246 3300010167 Bacteria 15840
2 Ga0160465_100043 3300012803 Bacteria 157730
3 Ga0466711_246643 3300042615 Bacteria 90615
4 Ga0466726_127071 3300042619 Unclassified 7076
5 Ga0466729_082100 3300042621 Bacteria 22893
6 Ga0160433_100059 3300012846 Bacteria 121476
7 Ga0160433_101000 3300012846 Bacteria 9162
8 Ga0466701_099620 3300042598 Bacteria 6158
9 Ga0466706_010392 3300042599 Bacteria 27140
10 Ga0466719_174688 3300042606 Unclassified 88641
11 Ga0466703_250320 3300042636 Bacteria 592480
12 Ga0466709_147662 3300042648 Bacteria 13278
13 Ga0466724_46127 3300042649 Unclassified 1920
14 Ga0466708_300777 3300042652 Bacteria 4806
15 Ga0068302_10007084 3300005071 Unclassified 8647
16 Ga0068305_10000012 3300005083 Bacteria 51331
17 Ga0068305_10000195 3300005083 Bacteria 118813
18 Ga0068305_10004980 3300005083 Bacteria 28780
19 Ga0104048_1168691 3300007143 Bacteria 3124
20 Ga0123357_10002132 3300009784 Bacteria 21798
21 Ga0123353_10333209 3300010167 Bacteria 2296
22 Ga0466711_227825 3300042615 Bacteria 191336
23 Ga0466711_420694 3300042615 Bacteria 7586
24 Ga0466715_226060 3300042616 Bacteria 48516
25 Ga0466723_276603 3300042618 Bacteria 34293
26 Ga0466723_331045 3300042618 Bacteria 47901
27 Ga0160458_100038 3300012832 Bacteria 185944
28 Ga0160455_100182 3300012837 Bacteria 62069
29 Ga0160433_100918 3300012846 Unclassified 9894
30 Ga0466691_094912 3300042593 Bacteria 7898
31 Ga0466696_047871 3300042596 Bacteria 4290
32 Ga0466716_110108 3300042605 Bacteria 10788
33 Ga0466703_158285 3300042636 Bacteria 84792
34 Ga0466727_067151 3300042655 Bacteria 68251
35 Ga0102735_1006094 3300007080 Bacteria 1534
36 Ga0466705_147979 3300042612 Bacteria 167577
37 Ga0466705_208486 3300042612 Bacteria 71494
38 Ga0466705_237340 3300042612 Bacteria 2419
39 Ga0466705_260526 3300042612 Bacteria 19969
40 Ga0466726_021843 3300042619 Bacteria 19287
41 Ga0466726_024804 3300042619 Bacteria 9331
42 Ga0160455_100334 3300012837 Bacteria 28393
43 Ga0466690_154797 3300042590 Unclassified 7527
44 Ga0466719_127211 3300042606 Bacteria 279481
45 Ga0466703_178972 3300042636 Unclassified 135766
46 Ga0466704_138143 3300042643 Bacteria 11080
47 Ga0466704_370727 3300042643 Bacteria 76606
48 Ga0466727_084042 3300042655 Bacteria 2501
49 IMNBGM34_c001231 3300000036 Bacteria 4742
50 Ga0102740_1000096 3300007140 Bacteria 21903
51 Ga0466715_456889 3300042616 Bacteria 238254
52 Ga0466657_076401 3300042582 Bacteria 4123
53 Ga0466690_320410 3300042590 Bacteria 2067
54 Ga0466691_120862 3300042593 Unclassified 10979
55 Ga0466713_044417 3300042602 Bacteria 52236
56 Ga0466714_114479 3300042603 Bacteria 31091
57 Ga0466716_067235 3300042605 Unclassified 6342
58 Ga0466719_255900 3300042606 Bacteria 9766
59 Ga0466729_258677 3300042621 Bacteria 2630
60 Ga0466704_042699 3300042643 Unclassified 5088
61 Ga0466724_60582 3300042649 Bacteria 15643
62 Ga0466727_171176 3300042655 Bacteria 4661
63 Ga0104045_1004595 3300007085 Bacteria 2486
64 Ga0466705_073622 3300042612 Bacteria 20606
65 Ga0466723_208657 3300042618 Bacteria 23133
66 Ga0466726_065940 3300042619 Bacteria 154230
67 Ga0466726_345134 3300042619 Bacteria 52575
68 Ga0466726_387678 3300042619 Bacteria 397429
69 Ga0466728_001522 3300042620 Bacteria 31939
70 Ga0466728_033444 3300042620 Bacteria 4662
71 Ga0466728_346008 3300042620 Bacteria 130078
72 Ga0160456_100058 3300012820 Bacteria 167928
73 Ga0466690_012079 3300042590 Bacteria 1877
74 Ga0466690_373341 3300042590 Bacteria 47139
75 Ga0466704_012171 3300042643 Bacteria 3401
76 Ga0466727_063582 3300042655 Bacteria 93834
77 Ga0466727_150924 3300042655 Bacteria 116830
78 Ga0104043_1000407 3300007058 Unclassified 2165
79 Ga0104045_1074804 3300007085 Bacteria 2454
80 Ga0104019_1005211 3300007150 Unclassified 4323
81 Ga0466715_253178 3300042616 Bacteria 66046
82 Ga0466715_381748 3300042616 Bacteria 14771
83 Ga0466715_636825 3300042616 Unclassified 7861
84 Ga0466723_133842 3300042618 Bacteria 68745
85 Ga0466723_259748 3300042618 Bacteria 40517
86 Ga0466726_230469 3300042619 Bacteria 1742
87 Ga0160431_103309 3300012828 Bacteria 3372
88 Ga0160445_100493 3300012847 Bacteria 19557
89 Ga0466690_269035 3300042590 Bacteria 23958
90 Ga0466691_137223 3300042593 Unclassified 5864
91 Ga0466696_330331 3300042596 Bacteria 41193
92 Ga0466713_005286 3300042602 Bacteria 50542
93 Ga0466722_193176 3300042609 Bacteria 4628
94 Ga0466704_488680 3300042643 Bacteria 17243
95 CVPL010W_10008400 3300002931 Bacteria 9775
96 Ga0068305_10000184 3300005083 Bacteria 99663
97 Ga0562378_0348 3300056814 Bacteria 90098
98 Ga0160466_100046 3300012809 Bacteria 160488
99 Ga0466711_117944 3300042615 Bacteria 215972
100 Ga0466715_347031 3300042616 Bacteria 23088
101 Ga0466715_623834 3300042616 Bacteria 48519
102 Ga0466728_357480 3300042620 Bacteria 11417
103 Ga0466729_174394 3300042621 Unclassified 1254
104 Ga0466690_010270 3300042590 Bacteria 16820
105 Ga0466707_408636 3300042601 Bacteria 5154
106 Ga0466716_228486 3300042605 Bacteria 6613
107 Ga0466731_348255 3300042622 Bacteria 3778
108 Ga0466704_230037 3300042643 Unclassified 3061
109 Ga0466704_598763 3300042643 Bacteria 17001
110 Ga0068302_10010414 3300005071 Bacteria 9615
111 Ga0068302_10040106 3300005071 Bacteria 4624
112 Ga0068305_10000253 3300005083 Bacteria 49207
113 Ga0104019_1191683 3300007150 Bacteria 1755
114 Ga0466705_257501 3300042612 Bacteria 57239
115 Ga0123357_10048053 3300009784 Bacteria 5783
116 Ga0123353_10001611 3300010167 Bacteria 27817
117 Ga0466711_035040 3300042615 Bacteria 61430
118 Ga0466711_044341 3300042615 Bacteria 37002
119 Ga0466715_642600 3300042616 Unclassified 2866
120 Ga0466723_070343 3300042618 Bacteria 9465
121 Ga0466729_100036 3300042621 Bacteria 6661
122 Ga0466692_029697 3300042591 Bacteria 4817
123 Ga0466706_031300 3300042599 Bacteria 209681
124 Ga0466719_527379 3300042606 Bacteria 121423
125 Ga0466735_075060 3300042624 Bacteria 5381
126 Ga0466704_097093 3300042643 Unclassified 8821
127 Ga0466727_245898 3300042655 Bacteria 31197
128 Ga0102734_1006998 3300007129 Bacteria 2541
129 Ga0104050_1001591 3300007153 Bacteria 8076

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300007150 Ga0104019_1005211 Ga0104019_10052114 356
2 3300042621 Ga0466729_100036 Ga0466729_100036_55_1125 356
3 3300007058 Ga0104043_1000407 Ga0104043_10004071 364
4 3300042609 Ga0466722_193176 Ga0466722_193176_3453_4550 365
5 3300000036 IMNBGM34_c001231 IMNBGM34_0012314 370
6 3300007080 Ga0102735_1006094 Ga0102735_10060941 377
7 3300009784 Ga0123357_10002132 Ga0123357_100021325 378
8 3300002931 CVPL010W_10008400 CVPL010W_100084003 379
9 3300007129 Ga0102734_1006998 Ga0102734_10069983 379
10 3300007140 Ga0102740_1000096 Ga0102740_10000963 379
11 3300007085 Ga0104045_1004595 Ga0104045_10045954 384
12 3300012832 Ga0160458_100038 Ga0160458_10003822 387
13 3300007150 Ga0104019_1191683 Ga0104019_11916832 388
14 iso_pr_bacteria 2820451402 2820451676 392
15 3300010167 Ga0123353_10333209 Ga0123353_103332092 393
16 3300056814 Ga0562378_0348 Ga0562378_0348_73038_74219 393
17 iso_pr_bacteria 2540341224 2540962476 393
18 3300042601 Ga0466707_408636 Ga0466707_408636_20_1204 394
19 3300042612 Ga0466705_208486 Ga0466705_208486_39533_40717 394
20 3300042615 Ga0466711_035040 Ga0466711_035040_20089_21273 394
21 3300042615 Ga0466711_227825 Ga0466711_227825_115380_116564 394
22 3300042619 Ga0466726_127071 Ga0466726_127071_364_1548 394
23 3300042620 Ga0466728_001522 Ga0466728_001522_30601_31785 394
24 3300042643 Ga0466704_012171 Ga0466704_012171_713_1897 394
25 3300042643 Ga0466704_598763 Ga0466704_598763_13066_14250 394
26 3300042652 Ga0466708_300777 Ga0466708_300777_190_1374 394
27 3300005071 Ga0068302_10040106 Ga0068302_100401063 395
28 3300009784 Ga0123357_10048053 Ga0123357_100480533 395
29 3300042590 Ga0466690_010270 Ga0466690_010270_6216_7403 395
30 3300042590 Ga0466690_012079 Ga0466690_012079_411_1598 395
31 3300042590 Ga0466690_154797 Ga0466690_154797_3403_4590 395
32 3300042590 Ga0466690_269035 Ga0466690_269035_16795_17982 395
33 3300042590 Ga0466690_320410 Ga0466690_320410_69_1256 395
34 3300042590 Ga0466690_373341 Ga0466690_373341_25391_26578 395
35 3300042591 Ga0466692_029697 Ga0466692_029697_1627_2814 395
36 3300042593 Ga0466691_094912 Ga0466691_094912_1213_2400 395
37 3300042593 Ga0466691_120862 Ga0466691_120862_6952_8139 395
38 3300042593 Ga0466691_137223 Ga0466691_137223_3151_4338 395
39 3300042596 Ga0466696_047871 Ga0466696_047871_2316_3503 395
40 3300042596 Ga0466696_330331 Ga0466696_330331_22581_23768 395
41 3300042599 Ga0466706_010392 Ga0466706_010392_6677_7864 395
42 3300042602 Ga0466713_005286 Ga0466713_005286_44315_45502 395
43 3300042602 Ga0466713_044417 Ga0466713_044417_200_1387 395
44 3300042603 Ga0466714_114479 Ga0466714_114479_13495_14682 395
45 3300042605 Ga0466716_067235 Ga0466716_067235_474_1661 395
46 3300042605 Ga0466716_228486 Ga0466716_228486_474_1661 395
47 3300042606 Ga0466719_127211 Ga0466719_127211_1853_3040 395
48 3300042606 Ga0466719_174688 Ga0466719_174688_53253_54440 395
49 3300042606 Ga0466719_255900 Ga0466719_255900_1982_3169 395
50 3300042606 Ga0466719_527379 Ga0466719_527379_53927_55114 395
51 3300042612 Ga0466705_073622 Ga0466705_073622_16513_17700 395
52 3300042612 Ga0466705_237340 Ga0466705_237340_1220_2407 395
53 3300042612 Ga0466705_260526 Ga0466705_260526_7836_9023 395
54 3300042615 Ga0466711_044341 Ga0466711_044341_23611_24798 395
55 3300042615 Ga0466711_117944 Ga0466711_117944_157693_158880 395
56 3300042615 Ga0466711_246643 Ga0466711_246643_71958_73145 395
57 3300042615 Ga0466711_420694 Ga0466711_420694_3729_4916 395
58 3300042616 Ga0466715_226060 Ga0466715_226060_5504_6691 395
59 3300042616 Ga0466715_253178 Ga0466715_253178_24361_25548 395
60 3300042616 Ga0466715_347031 Ga0466715_347031_5486_6673 395
61 3300042616 Ga0466715_381748 Ga0466715_381748_2241_3428 395
62 3300042616 Ga0466715_456889 Ga0466715_456889_68654_69841 395
63 3300042616 Ga0466715_623834 Ga0466715_623834_40425_41612 395
64 3300042616 Ga0466715_636825 Ga0466715_636825_1499_2686 395
65 3300042616 Ga0466715_642600 Ga0466715_642600_1502_2689 395
66 3300042618 Ga0466723_070343 Ga0466723_070343_2144_3331 395
67 3300042618 Ga0466723_133842 Ga0466723_133842_11382_12569 395
68 3300042618 Ga0466723_208657 Ga0466723_208657_17117_18304 395
69 3300042618 Ga0466723_259748 Ga0466723_259748_4667_5854 395
70 3300042618 Ga0466723_276603 Ga0466723_276603_15768_16955 395
71 3300042618 Ga0466723_331045 Ga0466723_331045_41223_42410 395
72 3300042619 Ga0466726_021843 Ga0466726_021843_14923_16110 395
73 3300042619 Ga0466726_024804 Ga0466726_024804_2851_4038 395
74 3300042619 Ga0466726_065940 Ga0466726_065940_35923_37110 395
75 3300042619 Ga0466726_230469 Ga0466726_230469_399_1586 395
76 3300042619 Ga0466726_387678 Ga0466726_387678_292336_293523 395
77 3300042620 Ga0466728_033444 Ga0466728_033444_1869_3056 395
78 3300042620 Ga0466728_346008 Ga0466728_346008_13312_14499 395
79 3300042620 Ga0466728_357480 Ga0466728_357480_5059_6246 395
80 3300042621 Ga0466729_082100 Ga0466729_082100_21130_22317 395
81 3300042621 Ga0466729_174394 Ga0466729_174394_34_1221 395
82 3300042621 Ga0466729_258677 Ga0466729_258677_807_1994 395
83 3300042624 Ga0466735_075060 Ga0466735_075060_47_1234 395
84 3300042636 Ga0466703_158285 Ga0466703_158285_31024_32211 395
85 3300042636 Ga0466703_178972 Ga0466703_178972_71707_72894 395
86 3300042636 Ga0466703_250320 Ga0466703_250320_65351_66538 395
87 3300042643 Ga0466704_042699 Ga0466704_042699_1119_2306 395
88 3300042643 Ga0466704_097093 Ga0466704_097093_5977_7164 395
89 3300042643 Ga0466704_138143 Ga0466704_138143_5592_6779 395
90 3300042643 Ga0466704_370727 Ga0466704_370727_50291_51478 395
91 3300042643 Ga0466704_488680 Ga0466704_488680_1389_2576 395
92 3300042648 Ga0466709_147662 Ga0466709_147662_10823_12010 395
93 3300042655 Ga0466727_067151 Ga0466727_067151_9784_10971 395
94 3300042655 Ga0466727_084042 Ga0466727_084042_929_2116 395
95 3300042655 Ga0466727_150924 Ga0466727_150924_95583_96770 395
96 3300042655 Ga0466727_171176 Ga0466727_171176_2272_3459 395
97 3300042655 Ga0466727_245898 Ga0466727_245898_9813_11000 395
98 iso_pr_bacteria 2540341223 2540961662 395
99 iso_pr_bacteria 2545824514 2545872395 395
100 iso_pr_bacteria 2754412483 2755217590 395
101 iso_pr_bacteria 2772190892 2773436502 395
102 iso_pr_bacteria 2772190894 2773440261 395
103 iso_pr_bacteria 8030337018 8030338409 395
104 3300005071 Ga0068302_10007084 Ga0068302_1000708412 396
105 3300005071 Ga0068302_10010414 Ga0068302_100104143 396
106 3300005083 Ga0068305_10000012 Ga0068305_100000123 396
107 3300005083 Ga0068305_10000184 Ga0068305_1000018485 396
108 3300005083 Ga0068305_10000195 Ga0068305_1000019551 396
109 3300005083 Ga0068305_10000253 Ga0068305_100002533 396
110 3300005083 Ga0068305_10004980 Ga0068305_1000498015 396
111 3300010167 Ga0123353_10001611 Ga0123353_100016117 396
112 3300042599 Ga0466706_031300 Ga0466706_031300_101932_103122 396
113 3300042605 Ga0466716_110108 Ga0466716_110108_4652_5842 396
114 iso_pr_bacteria 8030343600 8030345543 396
115 iso_pr_bacteria 2554235371 2555765679 398
116 iso_pr_bacteria 2554235381 2555814684 398
117 3300042598 Ga0466701_099620 Ga0466701_099620_464_1663 399
118 3300042649 Ga0466724_46127 Ga0466724_46127_143_1342 399
119 3300042649 Ga0466724_60582 Ga0466724_60582_14376_15575 399
120 3300007153 Ga0104050_1001591 Ga0104050_10015916 400
121 3300012803 Ga0160465_100043 Ga0160465_100043134 400
122 3300012809 Ga0160466_100046 Ga0160466_1000465 400
123 3300012837 Ga0160455_100182 Ga0160455_10018215 401
124 3300012846 Ga0160433_100059 Ga0160433_10005976 401
125 3300042619 Ga0466726_345134 Ga0466726_345134_29599_30804 401
126 3300042655 Ga0466727_063582 Ga0466727_063582_68137_69342 401
127 iso_pr_bacteria 2873776654 2873776914 401
128 3300012820 Ga0160456_100058 Ga0160456_10005894 402
129 3300012828 Ga0160431_103309 Ga0160431_1033094 402
130 3300012837 Ga0160455_100334 Ga0160455_1003346 402
131 3300012846 Ga0160433_100918 Ga0160433_1009184 402
132 3300012846 Ga0160433_101000 Ga0160433_1010001 402
133 3300012847 Ga0160445_100493 Ga0160445_10049314 402
134 3300007085 Ga0104045_1074804 Ga0104045_10748042 403
135 3300007143 Ga0104048_1168691 Ga0104048_11686913 404
136 3300042582 Ga0466657_076401 Ga0466657_076401_221_1435 404
137 iso_pr_bacteria 2579779088 2582236483 404
138 iso_pr_bacteria 2896321640 2896325112 404
139 iso_pr_bacteria 2896330536 2896333553 404
140 iso_pr_bacteria 2896350215 2896353117 404
141 iso_pr_bacteria 2898741527 2898744695 404
142 3300042622 Ga0466731_348255 Ga0466731_348255_1445_2665 406
143 3300042612 Ga0466705_257501 Ga0466705_257501_13598_14821 407
144 3300042643 Ga0466704_230037 Ga0466704_230037_436_1659 407
145 3300042612 Ga0466705_147979 Ga0466705_147979_32009_33256 415
146 3300010167 Ga0123353_10006246 Ga0123353_1000624613 436

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00155 Aminotran_1_2 Aminotransferase class I and II 83 423 0.95
PF00266 Aminotran_5 Aminotransferase class-V 126 250 0.85

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.