Protein Family IF03042

Metagenome Isolate
150 Members
64 Samples
134 Scaffolds
257.69 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10003138|Ga0123353_1000313810
Length
290 aa
Sequence
LTEEIQETEVDSQGRRFPDNQALKLWNVCRRSSMIQIRTREEIEIIRENNLLVSATLAEVGKHVKPGVTTRMLDQIAEEYIRAHGAEPGFLGHRGFPATLCVSVNEQVVHGIPSDYVLKEGDVVSVDCGTIMKGFYGDSAYTFAVGQIAVPVAGLLQVTREALYKGVAQARAGNRVGDISAAVQEHVESHGFSVVRELVGHGLGRKMHESPEVPNFGLRGRGPLLREGMVICIEPMVNMGGKQVVFEKDGWTVRTKDRQPSAHYEFAVAVGKEGPDVLTDFTVIERAIN*

📊 Sample Types

Isolate 10.7%
Metagenome 89.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.4%
Unclassified 26.2%
Kalotermitidae 16.4%
Termopsidae 4.9%
Rhinotermitidae 4.9%
Passalidae 4.9%
Tenebrionidae 3.3%
Hodotermitidae 1.6%
Drosophilidae 1.6%
Formicidae 1.6%

🌳 Taxonomy

Archaea 0
Bacteria 145
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
2 2998907766 Penaeicola halotolerans LMIT005 Isolate
3 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
4 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
5 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
6 2791354849 Unclassified Chloroflexi Lab288P3bin29 Isolate Unclassified
7 2820227065 Unclassified Firmicutes Th196P4bin44 Isolate Unclassified
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
16 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
17 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
18 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
19 2593339125 Clostridium sp. 5 Isolate Termitidae
20 2820347164 Unclassified Firmicutes Nt197P3bin58 Isolate Unclassified
21 2820729191 Unclassified Chloroflexi Th196P4bin49 Isolate Unclassified
22 2820731983 Unclassified Chloroflexi Nt197P3bin126 Isolate Unclassified
23 2820740053 Unclassified Bacteroidetes Th196P3bin81 Isolate Unclassified
24 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
25 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
26 2820768849 Unclassified Bacteroidetes Lab288P3bin194 Isolate Unclassified
27 2820774381 Unclassified Bacteroidetes Lab288P1bin37 Isolate Unclassified
28 2820371985 Unclassified Firmicutes Nt197P3bin100 Isolate Unclassified
29 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2791354848 Unclassified Chloroflexi Emb289P3bin155 Isolate Unclassified
34 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
35 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
36 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
37 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
38 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
39 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
40 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
43 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
44 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
45 3300007106 Drosophila gut microbial communities from New York, USA - Drosophila falleni male 3 gut Metagenome Drosophilidae
46 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
47 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
48 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
49 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
50 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
51 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
52 2590828840 Clostridium sp. 2 Isolate Termitidae
53 2820238527 Unclassified Firmicutes Th196P3bin90 Isolate Unclassified
54 2820422691 Unclassified Firmicutes Lab288P3bin58 Isolate Unclassified
55 2820606014 Unclassified Firmicutes Emb289P1bin49 Isolate Unclassified
56 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
57 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
58 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
59 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
60 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
61 3300024582 Termite guts microbial communities from Mau, Uttar Pradesh, India - S1 Metagenome
62 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
63 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
64 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_273416 3300042611 Bacteria 5101
2 Ga0466732_102290 3300042656 Bacteria 1381
3 Ga0562375_0042 3300056856 Bacteria 527811
4 Ga0466694_124646 3300042594 Bacteria 1167
5 Ga0123356_10797964 3300010049 Bacteria 1115
6 Ga0123353_10000019 3300010167 Bacteria 185006
7 Ga0123353_10345727 3300010167 Bacteria 2244
8 Ga0466706_013322 3300042599 Bacteria 22899
9 Ga0466706_186042 3300042599 Bacteria 6626
10 Ga0466713_050362 3300042602 Bacteria 1200
11 Ga0466713_100727 3300042602 Bacteria 5067
12 Ga0466714_053981 3300042603 Bacteria 7171
13 Ga0466711_008894 3300042615 Bacteria 16611
14 Ga0466711_141717 3300042615 Bacteria 15726
15 Ga0466715_176752 3300042616 Bacteria 9889
16 IMNBL1DRAFT_c0005235 3300000062 Bacteria 7488
17 JGI24702J35022_10075285 3300002462 Bacteria 1823
18 Ga0104041_1000591 3300007106 Bacteria 3667
19 Ga0123354_10033520 3300010882 Bacteria 8039
20 Ga0466706_014133 3300042599 Bacteria 19194
21 Ga0466714_031947 3300042603 Bacteria 1211
22 Ga0466714_044856 3300042603 Bacteria 1339
23 Ga0466714_064677 3300042603 Bacteria 1203
24 Ga0466714_082590 3300042603 Bacteria 1963
25 Ga0466714_094091 3300042603 Bacteria 2687
26 Ga0466714_094171 3300042603 Bacteria 3500
27 Ga0466703_317271 3300042636 Bacteria 2425
28 Ga0466708_137425 3300042652 Bacteria 6732
29 Ga0466697_154536 3300042611 Bacteria 6155
30 Ga0466733_090216 3300042659 Bacteria 6126
31 Ga0466733_155816 3300042659 Bacteria 13838
32 Ga0466733_181532 3300042659 Bacteria 2205
33 Ga0466694_254155 3300042594 Bacteria 1308
34 Ga0466696_255812 3300042596 Bacteria 4067
35 Ga0466696_396970 3300042596 Bacteria 18436
36 Ga0123357_10023310 3300009784 Bacteria 8316
37 Ga0123356_10001427 3300010049 Bacteria 26432
38 Ga0123356_10015115 3300010049 Bacteria 7402
39 Ga0466700_197020 3300042600 Bacteria 1264
40 Ga0466713_052484 3300042602 Bacteria 51192
41 Ga0466714_063295 3300042603 Bacteria 11290
42 Ga0466722_035372 3300042609 Bacteria 7656
43 Ga0466715_327374 3300042616 Bacteria 3086
44 IMNBL1DRAFT_c0000511 3300000062 Bacteria 31936
45 Ga0103263_103070 3300007042 Bacteria 2019
46 Ga0466703_144740 3300042636 Bacteria 4361
47 Ga0466708_151421 3300042652 Bacteria 8733
48 Ga0466697_191671 3300042611 Bacteria 7258
49 Ga0466705_058835 3300042612 Bacteria 18299
50 Ga0466733_031543 3300042659 Bacteria 31583
51 Ga0466733_127261 3300042659 Bacteria 9314
52 Ga0265387_1000894 3300024582 Bacteria 4515
53 Ga0466693_043677 3300042592 Bacteria 1792
54 Ga0466693_202182 3300042592 Bacteria 1619
55 Ga0123353_10006555 3300010167 Bacteria 15522
56 Ga0123353_10666628 3300010167 Bacteria 1469
57 Ga0466713_049715 3300042602 Bacteria 11154
58 Ga0466714_103426 3300042603 Bacteria 1763
59 Ga0466714_114034 3300042603 Bacteria 2158
60 Ga0466721_160541 3300042608 Bacteria 27628
61 Ga0466722_261327 3300042609 Bacteria 19029
62 Ga0466698_082575 3300042610 Bacteria 1750
63 2227078583 2225789003 Bacteria 2090
64 2227480509 2225789004 Bacteria 4448
65 2227507944 2225789004 Bacteria 72999
66 IMNBL1DRAFT_c0026259 3300000062 Bacteria 2216
67 JGI24705J35276_12232563 3300002504 Bacteria 4385
68 Ga0072941_1428514 3300005201 Bacteria 2313
69 Ga0466735_043703 3300042624 Bacteria 36972
70 Ga0466735_114961 3300042624 Bacteria 12299
71 Ga0466733_003819 3300042659 Bacteria 23682
72 Ga0466733_176904 3300042659 Bacteria 3219
73 Ga0466657_191967 3300042582 Bacteria 1611
74 Ga0466691_018781 3300042593 Bacteria 22071
75 Ga0466694_199011 3300042594 Bacteria 2875
76 Ga0123356_10104018 3300010049 Bacteria 2729
77 Ga0123353_11049413 3300010167 Bacteria 1089
78 Ga0466714_021817 3300042603 Bacteria 7986
79 Ga0466714_057218 3300042603 Bacteria 1616
80 Ga0466714_093855 3300042603 Bacteria 1889
81 Ga0466710_029427 3300042613 Bacteria 4120
82 Ga0466715_426772 3300042616 Bacteria 11514
83 2227591268 2225789004 Bacteria 50477
84 JGI24702J35022_10000164 3300002462 Bacteria 34496
85 JGI24705J35276_12222384 3300002504 Bacteria 2417
86 Ga0466703_179134 3300042636 Bacteria 10416
87 Ga0466695_082200 3300042595 Bacteria 5554
88 Ga0123357_10107751 3300009784 Bacteria 3567
89 Ga0123355_10229205 3300009826 Bacteria 2656
90 Ga0123356_10004963 3300010049 Bacteria 13641
91 Ga0123353_10003138 3300010167 Bacteria 20743
92 Ga0466706_103986 3300042599 Bacteria 16586
93 Ga0466706_228754 3300042599 Bacteria 25710
94 Ga0466714_090728 3300042603 Bacteria 1000
95 Ga0466714_093767 3300042603 Bacteria 1391
96 Ga0466716_126809 3300042605 Bacteria 9806
97 Ga0466722_030131 3300042609 Bacteria 3000
98 Ga0466728_035321 3300042620 Bacteria 8591
99 JGI24702J35022_10001355 3300002462 Bacteria 15206
100 Ga0466703_094105 3300042636 Bacteria 1140
101 Ga0466704_246878 3300042643 Bacteria 1252
102 Ga0466705_146538 3300042612 Bacteria 158344
103 Ga0466732_324498 3300042656 Bacteria 5229
104 Ga0466733_058408 3300042659 Bacteria 3573
105 Ga0562376_6173 3300056857 Bacteria 5927
106 Ga0466692_120097 3300042591 Bacteria 76506
107 Ga0123355_10036198 3300009826 Bacteria 8026
108 Ga0123356_10007090 3300010049 Bacteria 11233
109 Ga0123353_10111816 3300010167 Unclassified 4399
110 Ga0466706_240769 3300042599 Unclassified 1496
111 Ga0466700_244408 3300042600 Bacteria 3137
112 Ga0466707_311653 3300042601 Bacteria 12538
113 Ga0466707_354355 3300042601 Bacteria 49155
114 Ga0466713_137191 3300042602 Bacteria 44160
115 Ga0466714_055399 3300042603 Bacteria 1848
116 Ga0466726_071080 3300042619 Bacteria 11944
117 Ga0466729_053410 3300042621 Bacteria 50114
118 JGI24702J35022_10012553 3300002462 Unclassified 4704
119 JGI24702J35022_10354625 3300002462 Bacteria 877
120 Ga0068305_10077824 3300005083 Bacteria 15891
121 Ga0466708_134998 3300042652 Bacteria 4614
122 Ga0466705_036550 3300042612 Bacteria 1769
123 Ga0466733_000945 3300042659 Bacteria 2328
124 Ga0265387_1000159 3300024582 Bacteria 12397
125 Ga0123356_10025301 3300010049 Bacteria 5581
126 Ga0123353_10054737 3300010167 Bacteria 6382
127 Ga0123354_10468491 3300010882 Bacteria 1006
128 Ga0466714_132072 3300042603 Bacteria 14433
129 Ga0466710_214328 3300042613 Bacteria 1000
130 Ga0466726_240361 3300042619 Bacteria 4991
131 Ga0466735_145556 3300042624 Bacteria 6985
132 Ga0466703_093625 3300042636 Unclassified 4650
133 Ga0466703_099949 3300042636 Unclassified 2057
134 Ga0466727_316709 3300042655 Bacteria 34486

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227480509 2227940501 236
2 3300042636 Ga0466703_144740 Ga0466703_144740_2023_2775 238
3 3300002462 JGI24702J35022_10354625 JGI24702J35022_103546251 242
4 3300042603 Ga0466714_044856 Ga0466714_044856_28_762 244
5 3300010049 Ga0123356_10015115 Ga0123356_100151153 246
6 3300042600 Ga0466700_197020 Ga0466700_197020_268_1011 247
7 3300042602 Ga0466713_050362 Ga0466713_050362_331_1074 247
8 iso_pr_bacteria 2820422691 2820424051 248
9 3300010167 Ga0123353_10054737 Ga0123353_100547377 249
10 3300042582 Ga0466657_191967 Ga0466657_191967_648_1397 249
11 3300042594 Ga0466694_124646 Ga0466694_124646_233_982 249
12 3300042602 Ga0466713_100727 Ga0466713_100727_83_832 249
13 iso_pr_bacteria 2590828840 2593258924 249
14 iso_pr_bacteria 2593339125 2595065629 249
15 iso_pr_bacteria 2791354848 2791708962 249
16 iso_pr_bacteria 2791354849 2791709944 249
17 iso_pr_bacteria 2820238527 2820239831 249
18 iso_pr_bacteria 2820731983 2820732397 249
19 3300010049 Ga0123356_10001427 Ga0123356_1000142720 250
20 3300010049 Ga0123356_10025301 Ga0123356_100253017 250
21 3300010049 Ga0123356_10104018 Ga0123356_101040184 250
22 3300010167 Ga0123353_10006555 Ga0123353_1000655512 250
23 3300010882 Ga0123354_10033520 Ga0123354_100335203 250
24 3300042609 Ga0466722_030131 Ga0466722_030131_1974_2726 250
25 iso_pr_bacteria 2820347164 2820348436 250
26 iso_pr_bacteria 2820371985 2820373170 250
27 3300042616 Ga0466715_426772 Ga0466715_426772_7059_7814 251
28 3300042636 Ga0466703_093625 Ga0466703_093625_3588_4370 251
29 3300007042 Ga0103263_103070 Ga0103263_1030702 252
30 3300010167 Ga0123353_10111816 Ga0123353_101118162 252
31 3300010167 Ga0123353_10345727 Ga0123353_103457272 252
32 3300042602 Ga0466713_052484 Ga0466713_052484_34102_34911 252
33 3300042612 Ga0466705_146538 Ga0466705_146538_37806_38564 252
34 2225789003 2227078583 2227445632 254
35 2225789004 2227507944 2227997722 254
36 3300042592 Ga0466693_202182 Ga0466693_202182_819_1583 254
37 3300042596 Ga0466696_396970 Ga0466696_396970_10309_11073 254
38 3300042615 Ga0466711_008894 Ga0466711_008894_6283_7047 254
39 3300042620 Ga0466728_035321 Ga0466728_035321_2650_3414 254
40 3300042624 Ga0466735_114961 Ga0466735_114961_3337_4101 254
41 3300042652 Ga0466708_134998 Ga0466708_134998_1663_2427 254
42 3300042652 Ga0466708_137425 Ga0466708_137425_4308_5072 254
43 iso_pr_bacteria 2820606014 2820606779 254
44 3300000062 IMNBL1DRAFT_c0026259 IMNBL1DRAFT_00262592 255
45 3300009826 Ga0123355_10036198 Ga0123355_100361984 255
46 3300009826 Ga0123355_10229205 Ga0123355_102292055 255
47 3300010167 Ga0123353_11049413 Ga0123353_110494131 255
48 3300024582 Ga0265387_1000159 Ga0265387_10001594 255
49 3300042600 Ga0466700_244408 Ga0466700_244408_313_1080 255
50 3300042603 Ga0466714_082590 Ga0466714_082590_1125_1892 255
51 3300042613 Ga0466710_214328 Ga0466710_214328_214_981 255
52 3300042636 Ga0466703_099949 Ga0466703_099949_414_1181 255
53 3300005201 Ga0072941_1428514 Ga0072941_14285142 256
54 3300042603 Ga0466714_090728 Ga0466714_090728_156_926 256
55 3300042609 Ga0466722_035372 Ga0466722_035372_5284_6054 256
56 3300042611 Ga0466697_191671 Ga0466697_191671_5911_6681 256
57 3300042612 Ga0466705_036550 Ga0466705_036550_961_1731 256
58 3300042643 Ga0466704_246878 Ga0466704_246878_197_967 256
59 iso_pr_bacteria 2820227065 2820228338 256
60 iso_pr_bacteria 2820729191 2820729978 256
61 3300002462 JGI24702J35022_10001355 JGI24702J35022_1000135520 257
62 3300002462 JGI24702J35022_10012553 JGI24702J35022_100125535 257
63 3300042592 Ga0466693_043677 Ga0466693_043677_611_1384 257
64 3300042609 Ga0466722_261327 Ga0466722_261327_15652_16425 257
65 3300042656 Ga0466732_102290 Ga0466732_102290_18_791 257
66 iso_pr_bacteria 2820740053 2820741224 257
67 iso_pr_bacteria 2820768849 2820769702 257
68 iso_pr_bacteria 2820774381 2820774669 257
69 iso_pr_bacteria 2998907766 2998910296 257
70 3300000062 IMNBL1DRAFT_c0000511 IMNBL1DRAFT_000051129 258
71 3300002462 JGI24702J35022_10000164 JGI24702J35022_1000016428 258
72 3300010049 Ga0123356_10007090 Ga0123356_1000709017 258
73 3300010167 Ga0123353_10000019 Ga0123353_1000001985 258
74 3300042591 Ga0466692_120097 Ga0466692_120097_6010_6786 258
75 3300042594 Ga0466694_199011 Ga0466694_199011_1602_2378 258
76 3300042599 Ga0466706_013322 Ga0466706_013322_17257_18033 258
77 3300042603 Ga0466714_063295 Ga0466714_063295_7796_8572 258
78 3300042603 Ga0466714_103426 Ga0466714_103426_890_1666 258
79 3300042610 Ga0466698_082575 Ga0466698_082575_273_1049 258
80 3300042659 Ga0466733_031543 Ga0466733_031543_12896_13672 258
81 3300042659 Ga0466733_127261 Ga0466733_127261_5505_6281 258
82 3300002504 JGI24705J35276_12222384 JGI24705J35276_122223842 259
83 3300010049 Ga0123356_10004963 Ga0123356_100049633 259
84 3300024582 Ga0265387_1000894 Ga0265387_10008942 259
85 3300042595 Ga0466695_082200 Ga0466695_082200_126_905 259
86 3300042603 Ga0466714_021817 Ga0466714_021817_1160_1939 259
87 3300042603 Ga0466714_064677 Ga0466714_064677_357_1136 259
88 3300042603 Ga0466714_093855 Ga0466714_093855_134_913 259
89 3300042603 Ga0466714_094171 Ga0466714_094171_1381_2160 259
90 3300042603 Ga0466714_132072 Ga0466714_132072_10536_11315 259
91 3300042621 Ga0466729_053410 Ga0466729_053410_10611_11390 259
92 3300042624 Ga0466735_043703 Ga0466735_043703_743_1522 259
93 3300042659 Ga0466733_000945 Ga0466733_000945_35_814 259
94 2225789004 2227591268 2228149928 260
95 3300042594 Ga0466694_254155 Ga0466694_254155_119_901 260
96 3300042599 Ga0466706_186042 Ga0466706_186042_2585_3367 260
97 3300042599 Ga0466706_240769 Ga0466706_240769_592_1374 260
98 3300042603 Ga0466714_031947 Ga0466714_031947_147_929 260
99 3300042603 Ga0466714_055399 Ga0466714_055399_402_1184 260
100 3300042603 Ga0466714_093767 Ga0466714_093767_94_876 260
101 3300042608 Ga0466721_160541 Ga0466721_160541_8139_8921 260
102 3300042611 Ga0466697_154536 Ga0466697_154536_4558_5340 260
103 3300042616 Ga0466715_176752 Ga0466715_176752_3974_4756 260
104 3300042616 Ga0466715_327374 Ga0466715_327374_614_1396 260
105 3300042652 Ga0466708_151421 Ga0466708_151421_5893_6675 260
106 3300042659 Ga0466733_003819 Ga0466733_003819_8233_9015 260
107 3300042659 Ga0466733_090216 Ga0466733_090216_3522_4304 260
108 3300042659 Ga0466733_181532 Ga0466733_181532_1140_1922 260
109 3300000062 IMNBL1DRAFT_c0005235 IMNBL1DRAFT_00052356 261
110 3300002462 JGI24702J35022_10075285 JGI24702J35022_100752851 261
111 3300009784 Ga0123357_10107751 Ga0123357_101077515 261
112 3300010882 Ga0123354_10468491 Ga0123354_104684911 261
113 3300042599 Ga0466706_014133 Ga0466706_014133_505_1290 261
114 3300042599 Ga0466706_103986 Ga0466706_103986_10384_11169 261
115 3300042603 Ga0466714_053981 Ga0466714_053981_3263_4048 261
116 3300042605 Ga0466716_126809 Ga0466716_126809_4385_5170 261
117 3300042615 Ga0466711_141717 Ga0466711_141717_8402_9226 261
118 3300042619 Ga0466726_240361 Ga0466726_240361_378_1163 261
119 3300042655 Ga0466727_316709 Ga0466727_316709_16065_16850 261
120 3300042656 Ga0466732_324498 Ga0466732_324498_2565_3350 261
121 3300042659 Ga0466733_058408 Ga0466733_058408_195_980 261
122 3300002504 JGI24705J35276_12232563 JGI24705J35276_122325632 262
123 3300042603 Ga0466714_057218 Ga0466714_057218_112_900 262
124 3300042603 Ga0466714_094091 Ga0466714_094091_1460_2248 262
125 3300042636 Ga0466703_094105 Ga0466703_094105_72_860 262
126 3300010167 Ga0123353_10666628 Ga0123353_106666283 263
127 3300042659 Ga0466733_155816 Ga0466733_155816_6203_6994 263
128 3300009784 Ga0123357_10023310 Ga0123357_100233102 264
129 3300042593 Ga0466691_018781 Ga0466691_018781_12127_12921 264
130 3300042602 Ga0466713_049715 Ga0466713_049715_3766_4560 264
131 3300042603 Ga0466714_114034 Ga0466714_114034_116_910 264
132 3300042611 Ga0466697_273416 Ga0466697_273416_132_926 264
133 3300042636 Ga0466703_179134 Ga0466703_179134_5237_6031 264
134 3300007106 Ga0104041_1000591 Ga0104041_10005913 265
135 3300042613 Ga0466710_029427 Ga0466710_029427_2831_3628 265
136 3300042619 Ga0466726_071080 Ga0466726_071080_463_1356 265
137 3300042624 Ga0466735_145556 Ga0466735_145556_3825_4622 265
138 3300005083 Ga0068305_10077824 Ga0068305_100778242 266
139 3300042612 Ga0466705_058835 Ga0466705_058835_5806_6606 266
140 3300042596 Ga0466696_255812 Ga0466696_255812_2280_3101 267
141 3300042636 Ga0466703_317271 Ga0466703_317271_720_1523 267
142 3300042599 Ga0466706_228754 Ga0466706_228754_14988_15797 269
143 3300042601 Ga0466707_354355 Ga0466707_354355_25069_25878 269
144 3300042602 Ga0466713_137191 Ga0466713_137191_3904_4713 269
145 3300042659 Ga0466733_176904 Ga0466733_176904_1257_2066 269
146 3300010049 Ga0123356_10797964 Ga0123356_107979641 271
147 3300056856 Ga0562375_0042 Ga0562375_0042_207443_208279 278
148 3300056857 Ga0562376_6173 Ga0562376_6173_4070_4906 278
149 3300042601 Ga0466707_311653 Ga0466707_311653_9353_10204 283
150 3300010167 Ga0123353_10003138 Ga0123353_1000313810 290

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00557 Peptidase_M24 Metallopeptidase family M24 45 247 0.9

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.93 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.