Protein Family IF03041

Metagenome Isolate
200 Members
92 Samples
159 Scaffolds
303.41 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10003046|Ga0123353_100030467
Length
331 aa
Sequence
MPETTFCFLFKFFLLLAKDYVGGGRTFMKLGFVSAILEEYTFEQVVDFASESGIACVEMMSWPRGKSERRYAGVTHIDAEAMDKGKAEQINEYLAKKNVSISGIGYYPNPLDADLGQRALCIAHIKKCIKAAQMLGLSNMNTFIGKDPLRPISDNMEQFKKVWPDIVKFAEDHGVKIGIENCPMYFKDEWPGGKNLAASPKIWREMFSVIQSDHFGLNYDPSHLAWQRMDYIKPIYEFKAKLFHFHIKDAKLFQDRYDEVGIFAAPLDYHAPKLPGLGDIDWGKTVSALRDAGYDGAMVMEVEDRAFERTLEDKLRAIRLSKRFMNQYIL*

📊 Sample Types

Isolate 20.0%
Metagenome 80.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 24.2%
Blattidae 19.8%
Unclassified 17.6%
Kalotermitidae 15.4%
Tenebrionidae 6.6%
Termopsidae 3.3%
Rhinotermitidae 2.2%
Passalidae 2.2%
Noctuidae 2.2%
Drosophilidae 1.1%
Elmidae 1.1%
Penaeidae 1.1%
Hydrophilidae 1.1%
Hodotermitidae 1.1%
Scarabaeidae 1.1%

🌳 Taxonomy

Archaea 1
Bacteria 190
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940286528 Lachnospiraceae bacterium PFB1-21 Isolate Blattidae
2 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
3 2820455747 Unclassified Firmicutes Lab288P3bin160 Isolate Unclassified
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
7 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 2825804107 Enterococcus durans BDGP3 Isolate Drosophilidae
10 2940292506 Lachnoclostridium sp. PH5-23 Isolate Blattidae
11 2940343849 Breznakia sp. PH5-24 Isolate Blattidae
12 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
13 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
14 2820367663 Unclassified Firmicutes Nt197P3bin105 Isolate Unclassified
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
18 8018794549 Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 Isolate
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 2864836148 Arcicella rosea S00070 Isolate Elmidae
23 2940270707 Lachnoclostridium sp. PF1-13 Isolate Blattidae
24 2940339133 Breznakia sp. PF5-3 Isolate Blattidae
25 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
26 8082023105 Niallia sp. Man26 Isolate Penaeidae
27 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
28 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
29 2940277027 Lachnospiraceae bacterium PF1-21 Isolate Blattidae
30 2873595552 Erysipelothrix sp. HDW6C Isolate Hydrophilidae
31 2820639607 Unclassified Firmicutes Cu122P5bin9 Isolate Unclassified
32 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
33 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
34 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2820944107 Unclassified Actinobacteria Cu122P5bin14 Isolate Unclassified
41 2940236825 Breznakia sp. PM6-1 Isolate Blattidae
42 2940264388 Lachnospiraceae bacterium PFB1-17 Isolate Blattidae
43 2940267548 Lachnospiraceae bacterium PFB1-22 Isolate Blattidae
44 2940280053 Lachnospiraceae bacterium PF1-22 Isolate Blattidae
45 2940341480 Breznakia sp. PFB2-8 Isolate Blattidae
46 2944625312 Dysgonomonas sp. PF1-3 Isolate Blattidae
47 2820405014 Unclassified Firmicutes Lab288P4bin88 Isolate Unclassified
48 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
49 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
50 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
51 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
52 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
53 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
54 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
55 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
56 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
57 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
58 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
59 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
60 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
61 2940230426 Lachnospiraceae bacterium PH5-48 Isolate Blattidae
62 2940283334 Lachnospiraceae bacterium PF1-4 Isolate Blattidae
63 2940295490 Lachnospiraceae bacterium PH1-22 Isolate Blattidae
64 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
65 2820516196 Unclassified Firmicutes Lab288P1bin3 Isolate Unclassified
66 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
67 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
68 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
69 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
70 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
71 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
72 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
73 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
74 2940273867 Lachnoclostridium sp. PH1-16 Isolate Blattidae
75 2940289514 Lachnospiraceae bacterium PM6-15 Isolate Blattidae
76 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
77 2035265002 Agrotis sp. gut microbial communities from Texas A and M University, USA Metagenome Noctuidae
78 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
79 3300003097 Cutworm gut microbial communities from Hangzhou, China Metagenome Noctuidae
80 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
81 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
82 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
83 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
84 2940233634 Lachnoclostridium sp. PF5-10 Isolate Blattidae
85 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
86 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
87 2820309449 Unclassified Firmicutes Th196P1bin10 Isolate Unclassified
88 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
89 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
90 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
91 8002299145 Vagococcus allomyrinae BWB3-3 Isolate Scarabaeidae
92 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_293443 3300042612 Bacteria 4625
2 Ga0466733_108474 3300042659 Bacteria 4563
3 Ga0562379_0323 3300056790 Bacteria 117518
4 Ga0562378_2560 3300056814 Unclassified 14543
5 Ga0562377_0010 3300056842 Bacteria 1401665
6 Ga0562377_0041 3300056842 Bacteria 609183
7 Ga0466708_119795 3300042652 Bacteria 18227
8 Ga0466715_008622 3300042616 Bacteria 9831
9 Ga0466715_175019 3300042616 Unclassified 7933
10 Ga0466723_130013 3300042618 Bacteria 2066
11 Ga0466695_246621 3300042595 Bacteria 3438
12 Ga0466696_076156 3300042596 Bacteria 20915
13 Ga0123355_10128650 3300009826 Bacteria 3907
14 Ga0123355_10234201 3300009826 Bacteria 2616
15 Ga0123356_10313231 3300010049 Bacteria 1680
16 Ga0123353_10139940 3300010167 Unclassified 3877
17 Ga0123353_10404724 3300010167 Bacteria 2029
18 Ga0466701_092979 3300042598 Bacteria 1774
19 Ga0466714_061628 3300042603 Bacteria 29345
20 Ga0466716_222511 3300042605 Bacteria 4375
21 Ga0466705_098299 3300042612 Bacteria 6520
22 Ga0466733_107067 3300042659 Bacteria 43860
23 Ga0562379_0033 3300056790 Bacteria 743383
24 Ga0466703_272006 3300042636 Bacteria 1701
25 Ga0466704_076107 3300042643 Unclassified 3843
26 Ga0466704_362500 3300042643 Bacteria 3834
27 Ga0466727_149478 3300042655 Bacteria 2978
28 Ga0466715_024515 3300042616 Bacteria 15889
29 Ga0466715_129030 3300042616 Bacteria 4438
30 Ga0466718_088994 3300042617 Bacteria 1178
31 Ga0466726_098624 3300042619 Bacteria 32264
32 Ga0466726_404994 3300042619 Bacteria 1644
33 Ga0466728_183588 3300042620 Bacteria 6953
34 Ga0466728_236687 3300042620 Bacteria 11339
35 Ga0466694_111954 3300042594 Bacteria 8235
36 Ga0072940_1268126 3300005200 Unclassified 1352
37 Ga0123356_10574042 3300010049 Bacteria 1291
38 Ga0123353_10007702 3300010167 Bacteria 14608
39 Ga0123353_10353433 3300010167 Bacteria 2213
40 Ga0466707_314013 3300042601 Bacteria 14285
41 Ga0466707_364068 3300042601 Bacteria 9886
42 Ga0466713_007363 3300042602 Bacteria 11672
43 Ga0466713_039178 3300042602 Bacteria 205362
44 Ga0562374_0014 3300057007 Bacteria 1241908
45 Ga0466703_302847 3300042636 Bacteria 16002
46 Ga0466727_226270 3300042655 Bacteria 1436
47 Ga0466711_140291 3300042615 Bacteria 27899
48 Ga0466718_010200 3300042617 Bacteria 9628
49 Ga0466728_234779 3300042620 Bacteria 2915
50 Ga0466690_041578 3300042590 Bacteria 9187
51 Ga0466691_027764 3300042593 Bacteria 6016
52 Ga0466691_203709 3300042593 Bacteria 24198
53 Ga0466695_044954 3300042595 Bacteria 2485
54 IMNBL1DRAFT_c0001641 3300000062 Bacteria 16566
55 Ga0072940_1049518 3300005200 Bacteria 12056
56 Ga0123356_10051307 3300010049 Bacteria 3838
57 Ga0123353_10775737 3300010167 Bacteria 1329
58 Ga0123353_10860064 3300010167 Bacteria 1241
59 Ga0466707_395133 3300042601 Bacteria 1518
60 Ga0466722_016958 3300042609 Bacteria 2181
61 Ga0466705_368327 3300042612 Bacteria 17294
62 Ga0466733_083116 3300042659 Bacteria 4850
63 Ga0562379_0194 3300056790 Bacteria 174127
64 Ga0562375_0012 3300056856 Bacteria 1240899
65 Ga0466709_041875 3300042648 Bacteria 4516
66 Ga0466709_311200 3300042648 Bacteria 7765
67 Ga0466712_081722 3300042614 Bacteria 1114
68 Ga0466715_515570 3300042616 Bacteria 2020
69 Ga0466723_234117 3300042618 Bacteria 3664
70 Ga0415639_031639 3300038395 Bacteria 4685
71 Ga0466690_127566 3300042590 Bacteria 8224
72 IMNBL1DRAFT_c0000007 3300000062 Bacteria 246638
73 JGI24695J34938_10056338 3300002450 Bacteria 1695
74 Ga0074263_106450 3300005485 Bacteria 1773
75 Ga0123355_10228875 3300009826 Archaea 2659
76 Ga0123356_10082275 3300010049 Bacteria 3047
77 Ga0123353_10000374 3300010167 Bacteria 54815
78 Ga0123353_10001923 3300010167 Bacteria 25549
79 Ga0123353_10089441 3300010167 Bacteria 4958
80 Ga0123354_10032459 3300010882 Bacteria 8183
81 Ga0123354_10137462 3300010882 Bacteria 3046
82 Ga0466713_082072 3300042602 Bacteria 1436
83 Ga0466714_000138 3300042603 Bacteria 1151
84 Ga0466716_025791 3300042605 Bacteria 5373
85 Ga0562379_0317 3300056790 Bacteria 120244
86 Ga0562377_0036 3300056842 Bacteria 678424
87 Ga0562375_2329 3300056856 Bacteria 21548
88 Ga0466703_169987 3300042636 Bacteria 2503
89 Ga0466711_365704 3300042615 Bacteria 2962
90 Ga0466723_020909 3300042618 Bacteria 10671
91 Ga0466726_232815 3300042619 Bacteria 1005
92 JGI24702J35022_10025710 3300002462 Bacteria 3174
93 Ga0123355_10000032 3300009826 Bacteria 139664
94 Ga0123356_10013185 3300010049 Bacteria 7995
95 Ga0123356_10037901 3300010049 Bacteria 4495
96 Ga0123356_10050156 3300010049 Bacteria 3885
97 Ga0123353_10003046 3300010167 Bacteria 20988
98 Ga0123353_10004531 3300010167 Bacteria 17911
99 Ga0466706_094574 3300042599 Bacteria 33277
100 Ga0466719_024151 3300042606 Bacteria 1477
101 Ga0466722_152337 3300042609 Bacteria 12751
102 Ga0466708_048370 3300042652 Bacteria 4030
103 Ga0466708_107303 3300042652 Bacteria 25503
104 Ga0466705_508148 3300042612 Bacteria 5372
105 Ga0466726_173330 3300042619 Bacteria 1817
106 Ga0466728_237174 3300042620 Bacteria 1489
107 JGI24702J35022_10107006 3300002462 Bacteria 1536
108 Ga0052191_100342 3300003097 Bacteria 10709
109 Ga0052191_101225 3300003097 Bacteria 3314
110 Ga0123357_10000122 3300009784 Bacteria 66741
111 Ga0123355_10000268 3300009826 Bacteria 66458
112 Ga0123355_10080991 3300009826 Bacteria 5182
113 Ga0466713_088579 3300042602 Bacteria 2101
114 Ga0466713_121187 3300042602 Bacteria 9512
115 Ga0466698_321885 3300042610 Bacteria 1676
116 Ga0530661_000140 3300056564 Bacteria 64318
117 Ga0562375_0018 3300056856 Bacteria 940838
118 Ga0466734_007208 3300042623 Bacteria 1144
119 Ga0466735_074996 3300042624 Bacteria 2634
120 Ga0466735_103204 3300042624 Bacteria 1876
121 Ga0466703_091206 3300042636 Bacteria 37744
122 Ga0466709_020425 3300042648 Bacteria 99423
123 Ga0466691_011524 3300042593 Bacteria 12111
124 CwormDRAF_NODE_2287_len_10679_cov_87_198242 2035265002 Unclassified 10709
125 IMNBL1DRAFT_c0000644 3300000062 Bacteria 27937
126 IMNBL1DRAFT_c0061614 3300000062 Bacteria 1124
127 Ga0123357_10472405 3300009784 Bacteria 1067
128 Ga0123355_10014297 3300009826 Bacteria 12405
129 Ga0123353_10329045 3300010167 Bacteria 2314
130 Ga0123353_10447006 3300010167 Bacteria 1904
131 Ga0123353_10567755 3300010167 Unclassified 1632
132 Ga0466701_073996 3300042598 Bacteria 1370
133 Ga0466706_068078 3300042599 Bacteria 2194
134 Ga0466700_392221 3300042600 Unclassified 1116
135 Ga0466714_009771 3300042603 Bacteria 1255
136 Ga0466716_074320 3300042605 Bacteria 10416
137 Ga0466719_107175 3300042606 Bacteria 6529
138 Ga0466698_134458 3300042610 Bacteria 6269
139 Ga0466705_146056 3300042612 Bacteria 2091
140 Ga0466705_170303 3300042612 Bacteria 13943
141 Ga0562375_0014 3300056856 Bacteria 1185783
142 Ga0562375_0016 3300056856 Bacteria 998894
143 Ga0562375_0177 3300056856 Bacteria 187140
144 Ga0466709_200120 3300042648 Bacteria 3336
145 Ga0466727_294341 3300042655 Bacteria 4861
146 Ga0466705_438683 3300042612 Bacteria 3366
147 Ga0466711_087403 3300042615 Bacteria 1085
148 Ga0466711_088384 3300042615 Bacteria 9049
149 Ga0415639_065304 3300038395 Bacteria 2779
150 Ga0466692_160199 3300042591 Bacteria 4046
151 2227358567 2225789004 Bacteria 28292
152 2227555180 2225789004 Bacteria 14822
153 JGI24700J35501_10930907 3300002508 Bacteria 39556
154 Ga0123357_10002580 3300009784 Bacteria 20326
155 Ga0123357_10005804 3300009784 Bacteria 14873
156 Ga0466701_078414 3300042598 Bacteria 1901
157 Ga0466717_019087 3300042604 Unclassified 1294
158 Ga0466719_280252 3300042606 Bacteria 2124
159 Ga0466722_127709 3300042609 Bacteria 23228

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_232815 Ga0466726_232815_13_768 251
2 3300042619 Ga0466726_404994 Ga0466726_404994_19_810 263
3 iso_pr_bacteria 2820455747 2820456850 273
4 3300042610 Ga0466698_321885 Ga0466698_321885_40_876 278
5 3300042604 Ga0466717_019087 Ga0466717_019087_418_1278 286
6 3300042606 Ga0466719_107175 Ga0466719_107175_1944_2852 289
7 3300042602 Ga0466713_039178 Ga0466713_039178_154727_155647 290
8 3300042643 Ga0466704_362500 Ga0466704_362500_2490_3395 290
9 3300042612 Ga0466705_293443 Ga0466705_293443_202_1113 292
10 3300010167 Ga0123353_10329045 Ga0123353_103290452 300
11 3300042600 Ga0466700_392221 Ga0466700_392221_143_1048 301
12 3300042612 Ga0466705_368327 Ga0466705_368327_238_1143 301
13 3300009826 Ga0123355_10014297 Ga0123355_100142973 302
14 3300009826 Ga0123355_10128650 Ga0123355_101286504 302
15 3300010049 Ga0123356_10037901 Ga0123356_100379012 302
16 3300010049 Ga0123356_10574042 Ga0123356_105740422 302
17 3300010167 Ga0123353_10004531 Ga0123353_100045312 302
18 3300042655 Ga0466727_149478 Ga0466727_149478_1797_2705 302
19 2225789004 2227358567 2227806115 303
20 3300009826 Ga0123355_10234201 Ga0123355_102342013 303
21 3300038395 Ga0415639_065304 Ga0415639_065304_1373_2284 303
22 3300042590 Ga0466690_041578 Ga0466690_041578_2855_3766 303
23 3300042590 Ga0466690_127566 Ga0466690_127566_5843_6754 303
24 3300042593 Ga0466691_011524 Ga0466691_011524_3326_4237 303
25 3300042593 Ga0466691_027764 Ga0466691_027764_1031_1942 303
26 3300042593 Ga0466691_203709 Ga0466691_203709_4112_5023 303
27 3300042594 Ga0466694_111954 Ga0466694_111954_3095_4006 303
28 3300042595 Ga0466695_246621 Ga0466695_246621_2044_2955 303
29 3300042596 Ga0466696_076156 Ga0466696_076156_12133_13044 303
30 3300042598 Ga0466701_092979 Ga0466701_092979_801_1712 303
31 3300042602 Ga0466713_082072 Ga0466713_082072_376_1287 303
32 3300042605 Ga0466716_025791 Ga0466716_025791_149_1060 303
33 3300042605 Ga0466716_074320 Ga0466716_074320_7268_8179 303
34 3300042606 Ga0466719_024151 Ga0466719_024151_545_1456 303
35 3300042606 Ga0466719_280252 Ga0466719_280252_1078_1989 303
36 3300042609 Ga0466722_016958 Ga0466722_016958_1106_2017 303
37 3300042609 Ga0466722_127709 Ga0466722_127709_15193_16104 303
38 3300042609 Ga0466722_152337 Ga0466722_152337_784_1695 303
39 3300042610 Ga0466698_134458 Ga0466698_134458_278_1189 303
40 3300042612 Ga0466705_098299 Ga0466705_098299_2979_3890 303
41 3300042612 Ga0466705_170303 Ga0466705_170303_4574_5485 303
42 3300042612 Ga0466705_508148 Ga0466705_508148_218_1129 303
43 3300042614 Ga0466712_081722 Ga0466712_081722_84_995 303
44 3300042615 Ga0466711_087403 Ga0466711_087403_68_979 303
45 3300042615 Ga0466711_088384 Ga0466711_088384_2939_3850 303
46 3300042615 Ga0466711_140291 Ga0466711_140291_210_1121 303
47 3300042615 Ga0466711_365704 Ga0466711_365704_1615_2526 303
48 3300042616 Ga0466715_008622 Ga0466715_008622_3088_3999 303
49 3300042616 Ga0466715_024515 Ga0466715_024515_3600_4511 303
50 3300042616 Ga0466715_129030 Ga0466715_129030_2744_3655 303
51 3300042616 Ga0466715_175019 Ga0466715_175019_4992_5903 303
52 3300042616 Ga0466715_515570 Ga0466715_515570_27_938 303
53 3300042618 Ga0466723_020909 Ga0466723_020909_6427_7338 303
54 3300042618 Ga0466723_234117 Ga0466723_234117_695_1606 303
55 3300042619 Ga0466726_098624 Ga0466726_098624_17264_18175 303
56 3300042619 Ga0466726_173330 Ga0466726_173330_882_1793 303
57 3300042620 Ga0466728_183588 Ga0466728_183588_3975_4886 303
58 3300042620 Ga0466728_234779 Ga0466728_234779_1226_2137 303
59 3300042623 Ga0466734_007208 Ga0466734_007208_221_1132 303
60 3300042624 Ga0466735_074996 Ga0466735_074996_1303_2214 303
61 3300042624 Ga0466735_103204 Ga0466735_103204_448_1359 303
62 3300042636 Ga0466703_302847 Ga0466703_302847_8972_9883 303
63 3300042643 Ga0466704_076107 Ga0466704_076107_684_1595 303
64 3300042648 Ga0466709_041875 Ga0466709_041875_335_1246 303
65 3300042648 Ga0466709_200120 Ga0466709_200120_1579_2490 303
66 3300042648 Ga0466709_311200 Ga0466709_311200_789_1700 303
67 3300042652 Ga0466708_107303 Ga0466708_107303_18202_19113 303
68 3300042655 Ga0466727_226270 Ga0466727_226270_376_1287 303
69 3300042655 Ga0466727_294341 Ga0466727_294341_863_1774 303
70 3300042659 Ga0466733_108474 Ga0466733_108474_298_1209 303
71 3300056842 Ga0562377_0036 Ga0562377_0036_383217_384128 303
72 3300056856 Ga0562375_0012 Ga0562375_0012_1235676_1236587 303
73 3300056856 Ga0562375_0014 Ga0562375_0014_400688_401599 303
74 3300056856 Ga0562375_0016 Ga0562375_0016_740089_741000 303
75 3300056856 Ga0562375_0018 Ga0562375_0018_86913_87824 303
76 3300057007 Ga0562374_0014 Ga0562374_0014_693829_694740 303
77 iso_pr_bacteria 2772190978 2773730331 303
78 iso_pr_bacteria 2781125629 2781264945 303
79 iso_pr_bacteria 2781125630 2781266069 303
80 iso_pr_bacteria 2820367663 2820369035 303
81 iso_pr_bacteria 2820944107 2820944964 303
82 iso_pr_bacteria 2940236825 2940238045 303
83 iso_pr_bacteria 2940339133 2940339899 303
84 iso_pr_bacteria 2940341480 2940342083 303
85 iso_pr_bacteria 2940343849 2940344909 303
86 2035265002 CwormDRAF_NODE_2287_len_10679_cov_87_198242 CwormDRAFT_262590 304
87 2225789004 2227555180 2228087818 304
88 3300000062 IMNBL1DRAFT_c0000007 IMNBL1DRAFT_000000735 304
89 3300002462 JGI24702J35022_10107006 JGI24702J35022_101070062 304
90 3300003097 Ga0052191_101225 Ga0052191_1012252 304
91 3300005200 Ga0072940_1268126 Ga0072940_12681262 304
92 3300005485 Ga0074263_106450 Ga0074263_1064502 304
93 3300009784 Ga0123357_10472405 Ga0123357_104724052 304
94 3300009826 Ga0123355_10000032 Ga0123355_1000003273 304
95 3300009826 Ga0123355_10000268 Ga0123355_1000026861 304
96 3300009826 Ga0123355_10080991 Ga0123355_100809911 304
97 3300010167 Ga0123353_10000374 Ga0123353_100003742 304
98 3300010167 Ga0123353_10001923 Ga0123353_100019235 304
99 3300010167 Ga0123353_10775737 Ga0123353_107757371 304
100 3300042591 Ga0466692_160199 Ga0466692_160199_1086_2000 304
101 3300042595 Ga0466695_044954 Ga0466695_044954_872_1786 304
102 3300042598 Ga0466701_078414 Ga0466701_078414_161_1075 304
103 3300042599 Ga0466706_068078 Ga0466706_068078_951_1865 304
104 3300042601 Ga0466707_314013 Ga0466707_314013_12990_13904 304
105 3300042601 Ga0466707_395133 Ga0466707_395133_82_996 304
106 3300042602 Ga0466713_088579 Ga0466713_088579_833_1747 304
107 3300042602 Ga0466713_121187 Ga0466713_121187_1960_2874 304
108 3300042603 Ga0466714_000138 Ga0466714_000138_135_1049 304
109 3300042603 Ga0466714_009771 Ga0466714_009771_104_1018 304
110 3300042612 Ga0466705_146056 Ga0466705_146056_327_1241 304
111 3300042612 Ga0466705_438683 Ga0466705_438683_2235_3149 304
112 3300042617 Ga0466718_088994 Ga0466718_088994_176_1090 304
113 3300042618 Ga0466723_130013 Ga0466723_130013_567_1481 304
114 3300042620 Ga0466728_236687 Ga0466728_236687_647_1561 304
115 3300042620 Ga0466728_237174 Ga0466728_237174_227_1141 304
116 3300042636 Ga0466703_169987 Ga0466703_169987_294_1208 304
117 3300042636 Ga0466703_272006 Ga0466703_272006_142_1056 304
118 3300042648 Ga0466709_020425 Ga0466709_020425_46885_47799 304
119 3300042659 Ga0466733_107067 Ga0466733_107067_2045_2959 304
120 3300056790 Ga0562379_0194 Ga0562379_0194_103075_103989 304
121 3300056790 Ga0562379_0317 Ga0562379_0317_33423_34337 304
122 3300056790 Ga0562379_0317 Ga0562379_0317_74260_75174 304
123 3300056790 Ga0562379_0323 Ga0562379_0323_54914_55828 304
124 3300056814 Ga0562378_2560 Ga0562378_2560_1021_1935 304
125 3300056842 Ga0562377_0041 Ga0562377_0041_553369_554283 304
126 3300056856 Ga0562375_0177 Ga0562375_0177_160458_161372 304
127 3300056856 Ga0562375_2329 Ga0562375_2329_1644_2558 304
128 iso_pr_bacteria 2788499854 2788759603 304
129 iso_pr_bacteria 2820209022 2820210114 304
130 iso_pr_bacteria 2820211246 2820211726 304
131 iso_pr_bacteria 2820249082 2820249905 304
132 iso_pr_bacteria 2820405014 2820406701 304
133 iso_pr_bacteria 2820516196 2820516252 304
134 iso_pr_bacteria 2820639607 2820641522 304
135 iso_pr_bacteria 2825804107 2825806490 304
136 iso_pr_bacteria 2873595552 2873595810 304
137 iso_pr_bacteria 2940230426 2940231665 304
138 iso_pr_bacteria 2940233634 2940236061 304
139 iso_pr_bacteria 2940264388 2940267434 304
140 iso_pr_bacteria 2940267548 2940270596 304
141 iso_pr_bacteria 2940270707 2940273756 304
142 iso_pr_bacteria 2940273867 2940276914 304
143 iso_pr_bacteria 2940277027 2940279389 304
144 iso_pr_bacteria 2940280053 2940281437 304
145 iso_pr_bacteria 2940283334 2940284679 304
146 iso_pr_bacteria 2940286528 2940289219 304
147 iso_pr_bacteria 2940289514 2940292338 304
148 iso_pr_bacteria 2940292506 2940295340 304
149 iso_pr_bacteria 2940295490 2940298262 304
150 iso_pr_bacteria 2944625312 2944626713 304
151 iso_pr_bacteria 8002299145 8002299713 304
152 iso_pr_bacteria 8018794549 8018794896 304
153 iso_pr_bacteria 8018794549 8018795433 304
154 iso_pr_bacteria 8082023105 8082028594 304
155 3300000062 IMNBL1DRAFT_c0001641 IMNBL1DRAFT_00016419 305
156 3300002450 JGI24695J34938_10056338 JGI24695J34938_100563382 305
157 3300002462 JGI24702J35022_10025710 JGI24702J35022_100257104 305
158 3300003097 Ga0052191_100342 Ga0052191_1003428 305
159 3300005200 Ga0072940_1049518 Ga0072940_10495184 305
160 3300009784 Ga0123357_10000122 Ga0123357_1000012225 305
161 3300009784 Ga0123357_10005804 Ga0123357_100058047 305
162 3300010049 Ga0123356_10050156 Ga0123356_100501562 305
163 3300010049 Ga0123356_10313231 Ga0123356_103132313 305
164 3300010167 Ga0123353_10007702 Ga0123353_100077028 305
165 3300010167 Ga0123353_10089441 Ga0123353_100894413 305
166 3300010167 Ga0123353_10353433 Ga0123353_103534332 305
167 3300010167 Ga0123353_10447006 Ga0123353_104470062 305
168 3300010167 Ga0123353_10567755 Ga0123353_105677553 305
169 3300010167 Ga0123353_10860064 Ga0123353_108600642 305
170 3300010882 Ga0123354_10032459 Ga0123354_100324592 305
171 3300010882 Ga0123354_10137462 Ga0123354_101374624 305
172 3300042617 Ga0466718_010200 Ga0466718_010200_2195_3112 305
173 iso_pr_bacteria 2820309449 2820311734 305
174 3300002508 JGI24700J35501_10930907 JGI24700J35501_1093090711 306
175 3300038395 Ga0415639_031639 Ga0415639_031639_2114_3034 306
176 3300042599 Ga0466706_094574 Ga0466706_094574_12344_13264 306
177 3300042601 Ga0466707_364068 Ga0466707_364068_8355_9275 306
178 iso_pr_bacteria 2864836148 2864838094 306
179 3300000062 IMNBL1DRAFT_c0000644 IMNBL1DRAFT_00006442 307
180 3300000062 IMNBL1DRAFT_c0061614 IMNBL1DRAFT_00616141 307
181 3300010049 Ga0123356_10082275 Ga0123356_100822751 307
182 3300010167 Ga0123353_10139940 Ga0123353_101399403 307
183 3300010167 Ga0123353_10404724 Ga0123353_104047242 307
184 3300042603 Ga0466714_061628 Ga0466714_061628_357_1280 307
185 3300042605 Ga0466716_222511 Ga0466716_222511_1893_2816 307
186 3300042652 Ga0466708_048370 Ga0466708_048370_2614_3537 307
187 3300042652 Ga0466708_119795 Ga0466708_119795_13885_14808 307
188 3300009826 Ga0123355_10228875 Ga0123355_102288752 308
189 3300042598 Ga0466701_073996 Ga0466701_073996_313_1239 308
190 3300010049 Ga0123356_10051307 Ga0123356_100513073 309
191 3300042602 Ga0466713_007363 Ga0466713_007363_1126_2055 309
192 3300056790 Ga0562379_0033 Ga0562379_0033_381976_382908 310
193 iso_pr_bacteria 8082023105 8082025460 310
194 3300056842 Ga0562377_0010 Ga0562377_0010_993521_994462 313
195 3300042659 Ga0466733_083116 Ga0466733_083116_3711_4658 315
196 3300042636 Ga0466703_091206 Ga0466703_091206_11454_12404 316
197 3300010049 Ga0123356_10013185 Ga0123356_100131856 317
198 3300009784 Ga0123357_10002580 Ga0123357_1000258012 319
199 3300056564 Ga0530661_000140 Ga0530661_000140_63130_64110 326
200 3300010167 Ga0123353_10003046 Ga0123353_100030467 331

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 46 315 0.87

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.89 0.92 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.