Protein Family IF03030

Metagenome Metatranscriptome Isolate
125 Members
71 Samples
109 Scaffolds
259.26 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10000970|Ga0123353_1000097010
Length
295 aa
Sequence
MPIAALKSVLAYGKIIKIFLQIWYVTKLFLYFCRPKKIVMQSFQKLLGIMDELRAKCPWDSKQTFDSLRYLTIEETYELSDAIIDKKYIDISKELGDLLLHIVFYAKIGEEENLFNIETVIEGICEKLIRRHPHIFGEVHVNSVDEVKGNWEKIKLKEGSKSVLGGVPNSLPAMVKAYRIQEKARGVGFDWENTEQVWEKVQEELSEFNRERSLNSEKMEDEFGDILFALINYARFININPEDALEKTNRKFIQRFNFIEKKAKEMDKPLSEMSLYEIEGLWQQAKCVNMVHYT*

📊 Sample Types

Isolate 12.8%
Metagenome 86.4%
MAG 0.0%
Metatranscriptome 0.8%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.4%
Unclassified 18.2%
Kalotermitidae 12.1%
Formicidae 9.1%
Armadillidiidae 7.6%
Drosophilidae 6.1%
Passalidae 1.5%
Rhinotermitidae 1.5%
Daphniidae 1.5%
Elmidae 1.5%
Bombycidae 1.5%
Termopsidae 1.5%
Hodotermitidae 1.5%

🌳 Taxonomy

Archaea 1
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820735654 Unclassified Bacteroidetes Th196P4bin9 Isolate Unclassified
2 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
5 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
6 3300012841 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E1 MG Metagenome Armadillidiidae
7 3300012847 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG Metagenome Armadillidiidae
8 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
9 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
10 2896321640 Sphingobacterium sp. xlx-130 Isolate
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
15 3300007085 Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut Metagenome Drosophilidae
16 2590828803 Pedobacter glucosidilyticus DD6b Isolate Daphniidae
17 2820741847 Unclassified Bacteroidetes Th196P3bin71 Isolate Unclassified
18 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
19 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
20 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
21 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
22 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
23 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
29 3300012846 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG Metagenome Armadillidiidae
30 2820750388 Unclassified Bacteroidetes Nt197P3bin50 Isolate Unclassified
31 2820783511 Unclassified Bacteroidetes Emb289P3bin108 Isolate Unclassified
32 2898741527 Sphingobacterium sp. xlx-73 Isolate
33 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
34 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
35 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
36 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 3300007042 Ant gut microbial communities from Cephalotes pusillus, Brazil Metagenome Formicidae
39 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
40 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
41 2896350215 Sphingobacterium sp. xlx-183 Isolate
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
44 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
45 3300007150 Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut Metagenome Drosophilidae
46 2864836148 Arcicella rosea S00070 Isolate Elmidae
47 2896330536 Sphingobacterium sp. xlx-96 Isolate
48 3300007140 Ant gut microbial communities from Cephalotes pallens, Brazil Metagenome Formicidae
49 3300007143 Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut Metagenome Drosophilidae
50 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
51 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae
52 2579779088 Sphingobacterium paucimobilis HER1398 Isolate Bombycidae
53 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
54 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
55 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
56 3300007733 Gill chamber microbial communities of deep-sea hydrothermal vent shrimp from South Atlantic Ocean Metagenome
57 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
58 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
59 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
60 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
61 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
62 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
63 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
64 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
65 3300002931 Ant worker gut metagenome for colony PL010 Metagenome Formicidae
66 3300007153 Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut Metagenome Drosophilidae
67 3300007190 Ant gut microbial communities from Cephalotes umbraculatus, Peru Metagenome Formicidae
68 3300007192 Ant gut microbial communities from Cephalotes persimplex, Brazil Metagenome Formicidae
69 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
70 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
71 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10005344 3300010049 Bacteria 13093
2 Ga0123356_11406288 3300010049 Unclassified 858
3 Ga0123354_10491188 3300010882 Bacteria 964
4 JGI24702J35022_10014868 3300002462 Bacteria 4287
5 Ga0068305_10087821 3300005083 Bacteria 7893
6 Ga0102734_1001033 3300007129 Bacteria 12981
7 Ga0466710_009503 3300042613 Bacteria 4149
8 Ga0466728_059165 3300042620 Bacteria 4779
9 Ga0466731_422518 3300042622 Bacteria 9244
10 Ga0466703_003699 3300042636 Bacteria 2660
11 Ga0466707_351705 3300042601 Bacteria 2336
12 Ga0466713_059293 3300042602 Bacteria 25779
13 Ga0466717_138833 3300042604 Archaea 1185
14 Ga0466722_167806 3300042609 Bacteria 4258
15 Ga0123353_10340566 3300010167 Bacteria 2265
16 Ga0160444_100029 3300012841 Bacteria 247585
17 Ga0466657_398260 3300042582 Bacteria 14596
18 Ga0466694_061481 3300042594 Bacteria 40983
19 Ga0466694_187261 3300042594 Bacteria 3374
20 Ga0123357_10228474 3300009784 Bacteria 2046
21 Ga0123356_10462380 3300010049 Bacteria 1419
22 Ga0123356_10557794 3300010049 Bacteria 1307
23 Ga0123353_10005456 3300010167 Bacteria 16705
24 Ga0123353_10836714 3300010167 Bacteria 1264
25 Ga0123354_10112532 3300010882 Bacteria 3583
26 Ga0123354_10180315 3300010882 Unclassified 2414
27 IMNBL1DRAFT_c0055812 3300000062 Bacteria 1215
28 Ga0104045_1082208 3300007085 Bacteria 1070
29 Ga0160433_112596 3300012846 Bacteria 1063
30 Ga0466715_282265 3300042616 Bacteria 5359
31 Ga0466701_040490 3300042598 Bacteria 26650
32 Ga0466701_070524 3300042598 Bacteria 2855
33 Ga0466713_048311 3300042602 Bacteria 71291
34 Ga0466722_149797 3300042609 Bacteria 3799
35 Ga0466732_187289 3300042656 Bacteria 8588
36 Ga0123356_10001463 3300010049 Bacteria 26026
37 IMNBL1DRAFT_c0033881 3300000062 Bacteria 1824
38 JGI24695J34938_10009726 3300002450 Bacteria 5326
39 JGI24696J40584_12832720 3300002834 Bacteria 934
40 Ga0104048_1003348 3300007143 Bacteria 6272
41 Ga0160445_100451 3300012847 Bacteria 21357
42 Ga0466701_015025 3300042598 Bacteria 1676
43 Ga0466724_30485 3300042649 Bacteria 5981
44 Ga0466724_56165 3300042649 Bacteria 3545
45 Ga0466713_096519 3300042602 Bacteria 5095
46 Ga0466722_245526 3300042609 Bacteria 18049
47 Ga0466733_067741 3300042659 Bacteria 8494
48 Ga0123353_10000970 3300010167 Bacteria 35107
49 Ga0123353_10082174 3300010167 Bacteria 5182
50 Ga0123353_10483148 3300010167 Bacteria 1812
51 Ga0123353_10841123 3300010167 Bacteria 1260
52 Ga0104048_1022177 3300007143 Bacteria 9845
53 Ga0103267_1000559 3300007190 Bacteria 11944
54 Ga0160444_102408 3300012841 Unclassified 2891
55 Ga0160443_100077 3300012848 Bacteria 175780
56 Ga0255786_1040200 3300022815 Bacteria 1407
57 Ga0466693_074493 3300042592 Bacteria 1307
58 Ga0466694_025681 3300042594 Bacteria 6210
59 Ga0466735_211536 3300042624 Bacteria 3484
60 Ga0466730_030722 3300042625 Bacteria 1135247
61 Ga0466701_086544 3300042598 Bacteria 103634
62 Ga0466706_183423 3300042599 Bacteria 13844
63 Ga0466713_036964 3300042602 Bacteria 29926
64 Ga0466720_023256 3300042607 Bacteria 2268
65 Ga0466698_204559 3300042610 Bacteria 4613
66 Ga0123353_10001157 3300010167 Bacteria 32209
67 Ga0123353_10057013 3300010167 Bacteria 6255
68 IMNBL1DRAFT_c0012331 3300000062 Bacteria 3915
69 JGI24702J35022_10004721 3300002462 Bacteria 8066
70 JGI24705J35276_12124342 3300002504 Bacteria 1082
71 CVPL010W_10000188 3300002931 Bacteria 54171
72 Ga0104048_1026468 3300007143 Unclassified 2715
73 Ga0103267_1000554 3300007190 Bacteria 18912
74 Ga0160445_100437 3300012847 Bacteria 21840
75 Ga0466710_447233 3300042613 Bacteria 15547
76 Ga0466715_610873 3300042616 Bacteria 1499
77 Ga0466724_34635 3300042649 Bacteria 4564
78 Ga0466724_47776 3300042649 Bacteria 343411
79 Ga0466708_040388 3300042652 Bacteria 5342
80 Ga0466697_123228 3300042611 Bacteria 1309
81 Ga0466697_165412 3300042611 Bacteria 1766
82 Ga0123353_10007052 3300010167 Bacteria 15115
83 JGI24696J40584_12961016 3300002834 Bacteria 10006
84 Ga0104045_1006675 3300007085 Unclassified 7601
85 Ga0102740_1000395 3300007140 Bacteria 12079
86 Ga0104019_1007309 3300007150 Bacteria 7221
87 Ga0104050_1000131 3300007153 Bacteria 7229
88 Ga0103268_1000197 3300007192 Bacteria 19849
89 Ga0160457_1003096 3300012858 Bacteria 3038
90 Ga0466693_374630 3300042592 Bacteria 2824
91 Ga0466710_182123 3300042613 Bacteria 1452
92 Ga0466710_223092 3300042613 Bacteria 1596
93 Ga0466711_431887 3300042615 Bacteria 12612
94 Ga0466723_083927 3300042618 Bacteria 3744
95 Ga0466701_019509 3300042598 Bacteria 3212
96 Ga0466722_122971 3300042609 Bacteria 1409
97 Ga0123356_10026071 3300010049 Bacteria 5495
98 Ga0123353_11040846 3300010167 Bacteria 1095
99 Ga0123354_10005583 3300010882 Bacteria 18345
100 Ga0123354_10238205 3300010882 Bacteria 1880
101 Ga0103263_103562 3300007042 Bacteria 1850
102 Ga0104050_1002559 3300007153 Bacteria 2210
103 Ga0104050_1027380 3300007153 Unclassified 1793
104 Ga0105524_106074 3300007733 Bacteria 1353
105 Ga0466691_111772 3300042593 Bacteria 94015
106 Ga0466695_365501 3300042595 Bacteria 1282
107 Ga0466696_298181 3300042596 Bacteria 4924
108 Ga0466701_032205 3300042598 Bacteria 2965
109 Ga0466707_128851 3300042601 Bacteria 14806

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010167 Ga0123353_11040846 Ga0123353_110408462 226
2 3300010049 Ga0123356_10026071 Ga0123356_100260714 237
3 3300042598 Ga0466701_015025 Ga0466701_015025_49_810 238
4 3300002450 JGI24695J34938_10009726 JGI24695J34938_100097265 239
5 3300042592 Ga0466693_074493 Ga0466693_074493_567_1286 239
6 3300002834 JGI24696J40584_12961016 JGI24696J40584_129610167 240
7 3300002834 JGI24696J40584_12832720 JGI24696J40584_128327202 241
8 3300042594 Ga0466694_025681 Ga0466694_025681_1542_2267 241
9 3300007192 Ga0103268_1000197 Ga0103268_100019714 242
10 3300010882 Ga0123354_10238205 Ga0123354_102382052 243
11 3300007190 Ga0103267_1000559 Ga0103267_100055911 244
12 3300007085 Ga0104045_1082208 Ga0104045_10822082 245
13 3300010882 Ga0123354_10180315 Ga0123354_101803153 246
14 3300042613 Ga0466710_009503 Ga0466710_009503_1174_1965 246
15 3300042602 Ga0466713_059293 Ga0466713_059293_12053_12799 248
16 3300042604 Ga0466717_138833 Ga0466717_138833_92_841 249
17 3300010167 Ga0123353_10001157 Ga0123353_1000115730 250
18 3300042649 Ga0466724_34635 Ga0466724_34635_2879_3634 251
19 iso_pr_bacteria 2820783511 2820783890 251
20 3300010049 Ga0123356_10001463 Ga0123356_100014634 252
21 3300042594 Ga0466694_061481 Ga0466694_061481_12022_12780 252
22 iso_pr_bacteria 2820797595 2820799357 252
23 3300010167 Ga0123353_10007052 Ga0123353_100070526 253
24 3300010167 Ga0123353_10841123 Ga0123353_108411231 253
25 3300042595 Ga0466695_365501 Ga0466695_365501_509_1270 253
26 3300042598 Ga0466701_070524 Ga0466701_070524_474_1235 253
27 3300042598 Ga0466701_086544 Ga0466701_086544_63009_63770 253
28 3300042610 Ga0466698_204559 Ga0466698_204559_308_1069 253
29 3300042613 Ga0466710_182123 Ga0466710_182123_128_889 253
30 3300042649 Ga0466724_56165 Ga0466724_56165_1777_2538 253
31 iso_pr_bacteria 2820735654 2820736414 253
32 3300002462 JGI24702J35022_10004721 JGI24702J35022_100047214 254
33 3300010049 Ga0123356_10005344 Ga0123356_100053442 254
34 3300010167 Ga0123353_10836714 Ga0123353_108367141 254
35 3300042607 Ga0466720_023256 Ga0466720_023256_503_1267 254
36 3300042613 Ga0466710_447233 Ga0466710_447233_3673_4437 254
37 iso_pr_bacteria 2820753519 2820754977 254
38 iso_pr_bacteria 2820755292 2820755378 254
39 3300010049 Ga0123356_11406288 Ga0123356_114062881 255
40 3300010882 Ga0123354_10005583 Ga0123354_1000558314 255
41 3300010167 Ga0123353_10005456 Ga0123353_1000545611 256
42 3300042594 Ga0466694_187261 Ga0466694_187261_477_1247 256
43 3300042598 Ga0466701_019509 Ga0466701_019509_551_1321 256
44 3300042599 Ga0466706_183423 Ga0466706_183423_940_1710 256
45 3300042611 Ga0466697_123228 Ga0466697_123228_264_1034 256
46 3300005083 Ga0068305_10087821 Ga0068305_100878213 257
47 3300010049 Ga0123356_10462380 Ga0123356_104623801 257
48 3300010882 Ga0123354_10112532 Ga0123354_101125323 257
49 3300042613 Ga0466710_223092 Ga0466710_223092_122_895 257
50 3300042625 Ga0466730_030722 Ga0466730_030722_579688_580500 257
51 3300042649 Ga0466724_30485 Ga0466724_30485_5019_5831 257
52 iso_pr_bacteria 2820750388 2820750550 257
53 iso_pr_bacteria 2820792843 2820793667 257
54 iso_pr_bacteria 2820795054 2820796801 257
55 3300000062 IMNBL1DRAFT_c0012331 IMNBL1DRAFT_00123312 258
56 3300002504 JGI24705J35276_12124342 JGI24705J35276_121243421 258
57 3300007085 Ga0104045_1006675 Ga0104045_10066753 258
58 3300042598 Ga0466701_032205 Ga0466701_032205_500_1276 258
59 3300042602 Ga0466713_036964 Ga0466713_036964_3606_4382 258
60 3300042622 Ga0466731_422518 Ga0466731_422518_2060_2836 258
61 3300007143 Ga0104048_1026468 Ga0104048_10264682 259
62 3300010167 Ga0123353_10082174 Ga0123353_100821745 259
63 3300010167 Ga0123353_10340566 Ga0123353_103405662 259
64 3300042582 Ga0466657_398260 Ga0466657_398260_6976_7755 259
65 3300042592 Ga0466693_374630 Ga0466693_374630_1689_2468 259
66 3300042616 Ga0466715_282265 Ga0466715_282265_283_1062 259
67 3300007190 Ga0103267_1000554 Ga0103267_100055410 260
68 3300010167 Ga0123353_10483148 Ga0123353_104831482 260
69 3300042602 Ga0466713_096519 Ga0466713_096519_3696_4478 260
70 3300042656 Ga0466732_187289 Ga0466732_187289_1174_1956 260
71 iso_pr_bacteria 2820741847 2820743292 260
72 3300000062 IMNBL1DRAFT_c0055812 IMNBL1DRAFT_00558121 261
73 3300009784 Ga0123357_10228474 Ga0123357_102284742 261
74 3300010049 Ga0123356_10557794 Ga0123356_105577942 261
75 3300022815 Ga0255786_1040200 Ga0255786_10402003 261
76 3300042596 Ga0466696_298181 Ga0466696_298181_3662_4447 261
77 3300042609 Ga0466722_149797 Ga0466722_149797_2058_2843 261
78 3300042609 Ga0466722_245526 Ga0466722_245526_15050_15835 261
79 3300042618 Ga0466723_083927 Ga0466723_083927_1403_2188 261
80 3300042652 Ga0466708_040388 Ga0466708_040388_3569_4354 261
81 3300010882 Ga0123354_10491188 Ga0123354_104911882 262
82 3300042601 Ga0466707_128851 Ga0466707_128851_12013_12801 262
83 3300042601 Ga0466707_351705 Ga0466707_351705_987_1775 262
84 3300042602 Ga0466713_048311 Ga0466713_048311_6166_7011 262
85 3300042624 Ga0466735_211536 Ga0466735_211536_645_1433 262
86 3300042616 Ga0466715_610873 Ga0466715_610873_690_1481 263
87 3300042620 Ga0466728_059165 Ga0466728_059165_3869_4660 263
88 3300042659 Ga0466733_067741 Ga0466733_067741_5816_6607 263
89 3300002462 JGI24702J35022_10014868 JGI24702J35022_100148684 264
90 3300042649 Ga0466724_47776 Ga0466724_47776_327869_328681 264
91 3300042593 Ga0466691_111772 Ga0466691_111772_63726_64523 265
92 3300042598 Ga0466701_040490 Ga0466701_040490_22155_22952 265
93 iso_pr_bacteria 2590828803 2592927315 265
94 3300002931 CVPL010W_10000188 CVPL010W_100001887 266
95 3300010167 Ga0123353_10057013 Ga0123353_100570131 266
96 3300042609 Ga0466722_122971 Ga0466722_122971_386_1186 266
97 3300042615 Ga0466711_431887 Ga0466711_431887_3006_3809 267
98 3300007129 Ga0102734_1001033 Ga0102734_100103315 268
99 3300007143 Ga0104048_1022177 Ga0104048_10221776 268
100 3300007150 Ga0104019_1007309 Ga0104019_10073096 268
101 3300007153 Ga0104050_1027380 Ga0104050_10273802 268
102 3300012848 Ga0160443_100077 Ga0160443_10007711 268
103 iso_pr_bacteria 2864836148 2864837025 268
104 3300007153 Ga0104050_1002559 Ga0104050_10025593 269
105 3300012841 Ga0160444_100029 Ga0160444_100029122 269
106 3300012841 Ga0160444_102408 Ga0160444_1024083 269
107 3300012846 Ga0160433_112596 Ga0160433_1125962 269
108 3300012847 Ga0160445_100437 Ga0160445_1004374 269
109 3300012847 Ga0160445_100451 Ga0160445_10045117 269
110 3300012858 Ga0160457_1003096 Ga0160457_10030962 269
111 iso_pr_bacteria 2579779088 2582237793 269
112 iso_pr_bacteria 2896321640 2896325185 269
113 iso_pr_bacteria 2896330536 2896331765 269
114 iso_pr_bacteria 2896350215 2896351075 269
115 iso_pr_bacteria 2898741527 2898742098 269
116 3300007143 Ga0104048_1003348 Ga0104048_10033484 270
117 3300000062 IMNBL1DRAFT_c0033881 IMNBL1DRAFT_00338812 273
118 3300007153 Ga0104050_1000131 Ga0104050_10001315 273
119 3300007140 Ga0102740_1000395 Ga0102740_10003952 274
120 3300042611 Ga0466697_165412 Ga0466697_165412_436_1263 275
121 3300042609 Ga0466722_167806 Ga0466722_167806_976_1812 278
122 3300042636 Ga0466703_003699 Ga0466703_003699_1182_2039 285
123 3300007733 Ga0105524_106074 Ga0105524_1060741 288
124 3300007042 Ga0103263_103562 Ga0103263_1035622 292
125 3300010167 Ga0123353_10000970 Ga0123353_1000097010 295

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF03819 MazG MazG nucleotide pyrophosphohydrolase domain 63 136 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.72 0.77 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.