Protein Family IF03007

Metagenome Metatranscriptome Isolate
180 Members
83 Samples
156 Scaffolds
180.2 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10000004|Ga0123353_10000004275
Length
216 aa
Sequence
MQHVQKSNQKSGLKFLYGIGMLFPSKGESMDYTLLKTEAESKTAATIEVLKTEYAGLRTGRASVHLLDGVRVEVYGSEMPINQVATVSTPEAQVISVSVWDLSNAGAVEKAIRDSGLGLNPMSAGGVIRINLPPLTEERRRELVKVAGKYAEEAKISMRNIRQDLMGKIKRAETDKVISEDDRKRFEEDLQKVFDARALEVDSIAKQKETDIMSV*

πŸ“Š Sample Types

Isolate 13.3%
Metagenome 85.6%
MAG 0.0%
Metatranscriptome 1.1%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 42.5%
Unclassified 25.0%
Kalotermitidae 16.2%
Rhinotermitidae 3.8%
Termopsidae 3.8%
Aphididae 2.5%
Elmidae 2.5%
Hodotermitidae 1.2%
Monophlebidae 1.2%
Nephropidae 1.2%

🌳 Taxonomy

Archaea 0
Bacteria 174
Eukaryota 0
Viruses 0
Unclassified 6

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820058318 Unclassified Proteobacteria Nt197P4bin33 Isolate Unclassified
2 2820100407 Unclassified Proteobacteria Lab288P1bin48 Isolate Unclassified
3 2820136564 Unclassified Proteobacteria Emb289P3bin18 Isolate Unclassified
4 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
5 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
6 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
7 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
10 2820079308 Unclassified Proteobacteria Lab288P4bin43 Isolate Unclassified
11 2820151121 Unclassified Proteobacteria Cu122P5bin52 Isolate Unclassified
12 2820931684 Unclassified Actinobacteria Emb289P1bin89 Isolate Unclassified
13 648861007 Candidatus Regiella insecticola LSR1 Isolate Aphididae
14 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
15 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
16 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
17 2820074476 Unclassified Proteobacteria Nt197P3bin125 Isolate Unclassified
18 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
19 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
20 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300009453 Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov Metagenome
24 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
25 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
26 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
29 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
30 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
31 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
32 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
33 2507262005 Candidatus Regiella insecticola R5.15 Isolate Aphididae
34 2820097052 Unclassified Proteobacteria Lab288P3bin109 Isolate Unclassified
35 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
36 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
37 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
38 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
39 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
40 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
41 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
42 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
43 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
44 2556921622 Terasakiella pusilla DSM 6293 Isolate Unclassified
45 2781125694 Treponema sp. Th196P3bin120 Isolate Unclassified
46 2820044805 Unclassified Proteobacteria Th196P4bin15 Isolate Unclassified
47 2820142992 Unclassified Proteobacteria Emb289P3bin113 Isolate Unclassified
48 2864895409 Bacillus aerius S00152 Isolate Elmidae
49 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
50 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
51 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
52 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
53 2820150510 Unclassified Proteobacteria Emb289P1bin35 Isolate Unclassified
54 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
55 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
56 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
57 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
58 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
59 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
60 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
61 2781125655 Treponema sp. Emb289P1bin105 Isolate Unclassified
62 2585427656 Endosymbiont of Llaveia axin axin Isolate Monophlebidae
63 2864801025 Bacillus aerius S00042 Isolate Elmidae
64 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
65 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
66 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
67 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
68 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
69 2820096063 Unclassified Proteobacteria Lab288P3bin136 Isolate Unclassified
70 2820097968 Unclassified Proteobacteria Lab288P3bin104 Isolate Unclassified
71 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
72 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
73 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
74 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
75 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
76 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
77 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
78 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
79 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
80 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
81 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
82 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
83 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_050150 3300042612 Bacteria 30586
2 Ga0466706_154161 3300042599 Bacteria 7369
3 Ga0466706_275392 3300042599 Bacteria 84446
4 Ga0466717_086676 3300042604 Bacteria 2468
5 Ga0466698_314947 3300042610 Bacteria 1487
6 JGI24695J34938_10171135 3300002450 Bacteria 896
7 JGI24705J35276_12189294 3300002504 Bacteria 1450
8 JGI24705J35276_12230772 3300002504 Bacteria 3730
9 Ga0072941_1024088 3300005201 Bacteria 4106
10 Ga0466731_326072 3300042622 Bacteria 1233
11 Ga0466735_171595 3300042624 Unclassified 1393
12 Ga0466708_031998 3300042652 Bacteria 7393
13 Ga0466715_630959 3300042616 Bacteria 20029
14 Ga0466723_048435 3300042618 Bacteria 9184
15 Ga0466723_367953 3300042618 Bacteria 11886
16 Ga0466726_231672 3300042619 Bacteria 1823
17 Ga0466729_150801 3300042621 Bacteria 2246
18 Ga0466690_146940 3300042590 Bacteria 2199
19 Ga0466693_250798 3300042592 Bacteria 2015
20 Ga0466694_285899 3300042594 Bacteria 5973
21 Ga0123356_10051025 3300010049 Bacteria 3848
22 Ga0123353_10547838 3300010167 Bacteria 1669
23 Ga0466733_001489 3300042659 Bacteria 2255
24 Ga0466700_067519 3300042600 Bacteria 2150
25 Ga0466700_473617 3300042600 Bacteria 2193
26 Ga0466700_474126 3300042600 Bacteria 1960
27 JGI24695J34938_10000014 3300002450 Bacteria 120713
28 JGI24702J35022_10021977 3300002462 Bacteria 3458
29 Ga0068305_10021107 3300005083 Bacteria 4755
30 Ga0466709_017382 3300042648 Bacteria 1440
31 Ga0466711_015326 3300042615 Bacteria 42635
32 Ga0466711_295646 3300042615 Bacteria 1483
33 Ga0466711_431851 3300042615 Bacteria 1855
34 Ga0466715_023724 3300042616 Bacteria 15101
35 Ga0466718_104761 3300042617 Bacteria 4368
36 Ga0123357_10415884 3300009784 Bacteria 1206
37 Ga0123355_10038977 3300009826 Bacteria 7728
38 Ga0123355_10378335 3300009826 Bacteria 1848
39 Ga0123356_10000237 3300010049 Bacteria 63854
40 Ga0123353_10000004 3300010167 Bacteria 312735
41 Ga0123353_10499265 3300010167 Bacteria 1773
42 Ga0123353_10768294 3300010167 Bacteria 1337
43 Ga0466697_182316 3300042611 Bacteria 1120
44 Ga0466713_144458 3300042602 Bacteria 1290
45 Ga0466716_090160 3300042605 Bacteria 16455
46 Ga0466698_029494 3300042610 Bacteria 1260
47 JGI24695J34938_10173579 3300002450 Bacteria 890
48 Ga0466734_035630 3300042623 Bacteria 2640
49 Ga0466703_189115 3300042636 Bacteria 11684
50 Ga0466708_061526 3300042652 Bacteria 8191
51 Ga0466708_412250 3300042652 Bacteria 2768
52 Ga0466727_296708 3300042655 Bacteria 5303
53 Ga0466718_067235 3300042617 Bacteria 2241
54 Ga0466729_026616 3300042621 Bacteria 1420
55 Ga0255786_1005069 3300022815 Bacteria 1058
56 Ga0466694_086586 3300042594 Bacteria 46405
57 Ga0123355_10080118 3300009826 Bacteria 5214
58 Ga0123356_10019392 3300010049 Bacteria 6446
59 Ga0123356_10897515 3300010049 Bacteria 1057
60 Ga0123353_10001706 3300010167 Bacteria 26978
61 Ga0123353_10360530 3300010167 Bacteria 2185
62 Ga0123353_10366502 3300010167 Bacteria 2162
63 Ga0123353_10831347 3300010167 Bacteria 1269
64 Ga0123354_10245959 3300010882 Bacteria 1827
65 Ga0466705_128209 3300042612 Bacteria 1143
66 Ga0466713_093647 3300042602 Bacteria 104622
67 Ga0466719_511323 3300042606 Bacteria 12327
68 Ga0466720_061640 3300042607 Bacteria 1550
69 JGI24698J34947_10000688 3300002449 Bacteria 16494
70 Ga0074263_114303 3300005485 Bacteria 2367
71 Ga0127656_100082 3300009453 Bacteria 50010
72 Ga0466735_001005 3300042624 Unclassified 1344
73 Ga0466735_067542 3300042624 Bacteria 16235
74 Ga0466709_133636 3300042648 Bacteria 1661
75 Ga0466709_366140 3300042648 Bacteria 2587
76 Ga0466708_174299 3300042652 Bacteria 1201
77 Ga0466727_152273 3300042655 Bacteria 1135
78 Ga0466727_264571 3300042655 Bacteria 1216
79 Ga0466715_081506 3300042616 Bacteria 4543
80 Ga0466715_527367 3300042616 Bacteria 5458
81 Ga0466715_583960 3300042616 Bacteria 1706
82 Ga0466726_396707 3300042619 Bacteria 3069
83 Ga0415639_051006 3300038395 Bacteria 11106
84 Ga0415639_096342 3300038395 Bacteria 4503
85 Ga0466690_019853 3300042590 Bacteria 17279
86 Ga0466695_105176 3300042595 Bacteria 2043
87 Ga0123355_10000558 3300009826 Bacteria 49958
88 Ga0123353_10013486 3300010167 Bacteria 11711
89 Ga0466705_144397 3300042612 Bacteria 1078
90 Ga0466733_019758 3300042659 Bacteria 3306
91 Ga0466701_084308 3300042598 Unclassified 2039
92 Ga0466700_175724 3300042600 Bacteria 1616
93 Ga0466721_368920 3300042608 Bacteria 1189
94 JGI24696J40584_12923548 3300002834 Bacteria 1377
95 Ga0466730_008953 3300042625 Bacteria 1555
96 Ga0466708_138923 3300042652 Bacteria 2691
97 Ga0466708_218841 3300042652 Bacteria 22149
98 Ga0466723_010014 3300042618 Bacteria 1040
99 Ga0255786_1041105 3300022815 Bacteria 650
100 Ga0264413_152493 3300024493 Bacteria 3216
101 Ga0456237_0019633 3300041968 Bacteria 939
102 Ga0466694_275963 3300042594 Bacteria 2255
103 Ga0466699_127381 3300042597 Bacteria 84968
104 Ga0123357_10069458 3300009784 Unclassified 4682
105 Ga0123357_10310642 3300009784 Bacteria 1575
106 Ga0123353_10756830 3300010167 Bacteria 1351
107 Ga0123354_10713795 3300010882 Bacteria 697
108 Ga0466705_178621 3300042612 Bacteria 90956
109 Ga0466714_113340 3300042603 Bacteria 3061
110 Ga0466698_468250 3300042610 Bacteria 1622
111 JGI24698J34947_10000823 3300002449 Bacteria 15496
112 Ga0072940_1443507 3300005200 Bacteria 2189
113 Ga0466704_294115 3300042643 Bacteria 35639
114 Ga0466718_065758 3300042617 Bacteria 194574
115 Ga0123357_10006578 3300009784 Bacteria 14219
116 Ga0123357_10080338 3300009784 Bacteria 4289
117 Ga0123357_10300890 3300009784 Bacteria 1620
118 Ga0123356_10136618 3300010049 Bacteria 2411
119 Ga0123353_10068960 3300010167 Bacteria 5680
120 Ga0123353_10137335 3300010167 Bacteria 3920
121 Ga0123353_10180188 3300010167 Bacteria 3346
122 Ga0466705_007285 3300042612 Bacteria 90107
123 Ga0466705_385171 3300042612 Bacteria 1872
124 Ga0466700_116701 3300042600 Bacteria 1876
125 Ga0466722_264504 3300042609 Bacteria 2876
126 Ga0466704_212168 3300042643 Bacteria 11742
127 Ga0466708_009999 3300042652 Bacteria 25991
128 Ga0466708_063506 3300042652 Bacteria 7049
129 Ga0466725_324249 3300042654 Bacteria 1830
130 Ga0466712_194668 3300042614 Bacteria 3028
131 Ga0466711_097458 3300042615 Bacteria 3881
132 Ga0466711_453011 3300042615 Unclassified 3069
133 Ga0466715_396848 3300042616 Bacteria 2819
134 Ga0123356_10023477 3300010049 Bacteria 5802
135 Ga0123356_10110952 3300010049 Bacteria 2649
136 Ga0123356_10276281 3300010049 Bacteria 1772
137 Ga0123356_10973923 3300010049 Bacteria 1019
138 Ga0123353_11499415 3300010167 Bacteria 859
139 Ga0123354_10280800 3300010882 Bacteria 1617
140 Ga0466700_170210 3300042600 Bacteria 1245
141 Ga0466716_183580 3300042605 Bacteria 27730
142 Ga0466719_030736 3300042606 Bacteria 2054
143 Ga0466698_082695 3300042610 Bacteria 1521
144 JGI24695J34938_10048789 3300002450 Unclassified 1864
145 Ga0068305_10001191 3300005083 Bacteria 2006
146 Ga0466731_359257 3300042622 Bacteria 7460
147 Ga0466702_241505 3300042635 Bacteria 1995
148 Ga0466723_014898 3300042618 Bacteria 1638
149 Ga0466728_449689 3300042620 Bacteria 48197
150 Ga0466729_094139 3300042621 Bacteria 1821
151 Ga0415639_023870 3300038395 Bacteria 1952
152 Ga0466690_130000 3300042590 Bacteria 1133
153 Ga0466695_137746 3300042595 Bacteria 2317
154 Ga0466695_176370 3300042595 Bacteria 2104
155 Ga0466696_063750 3300042596 Bacteria 11754
156 Ga0123353_10347645 3300010167 Bacteria 2236

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002450 JGI24695J34938_10171135 JGI24695J34938_101711352 155
2 3300009826 Ga0123355_10000558 Ga0123355_1000055841 155
3 3300042621 Ga0466729_026616 Ga0466729_026616_430_984 155
4 3300042595 Ga0466695_105176 Ga0466695_105176_119_673 156
5 3300041968 Ga0456237_0019633 Ga0456237_0019633_139_693 157
6 3300042612 Ga0466705_128209 Ga0466705_128209_386_946 157
7 3300009453 Ga0127656_100082 Ga0127656_10008217 158
8 3300042594 Ga0466694_275963 Ga0466694_275963_739_1299 158
9 3300042635 Ga0466702_241505 Ga0466702_241505_1298_1852 158
10 3300005485 Ga0074263_114303 Ga0074263_1143032 159
11 3300010049 Ga0123356_10136618 Ga0123356_101366182 159
12 3300022815 Ga0255786_1041105 Ga0255786_10411051 159
13 3300042600 Ga0466700_116701 Ga0466700_116701_357_917 159
14 3300042610 Ga0466698_314947 Ga0466698_314947_522_1076 159
15 3300042615 Ga0466711_015326 Ga0466711_015326_25829_26383 159
16 3300002450 JGI24695J34938_10000014 JGI24695J34938_1000001479 161
17 3300005083 Ga0068305_10021107 Ga0068305_100211075 161
18 3300042609 Ga0466722_264504 Ga0466722_264504_2252_2809 162
19 3300042622 Ga0466731_359257 Ga0466731_359257_524_1084 162
20 3300002449 JGI24698J34947_10000823 JGI24698J34947_100008233 164
21 3300002462 JGI24702J35022_10021977 JGI24702J35022_100219774 164
22 3300042620 Ga0466728_449689 Ga0466728_449689_36344_36886 164
23 3300010167 Ga0123353_10360530 Ga0123353_103605303 165
24 3300042600 Ga0466700_474126 Ga0466700_474126_1024_1578 165
25 3300042652 Ga0466708_031998 Ga0466708_031998_2591_3112 165
26 3300042595 Ga0466695_176370 Ga0466695_176370_939_1499 166
27 3300042602 Ga0466713_093647 Ga0466713_093647_83248_83808 166
28 3300042605 Ga0466716_183580 Ga0466716_183580_13014_13574 166
29 3300042612 Ga0466705_385171 Ga0466705_385171_627_1181 166
30 3300042615 Ga0466711_453011 Ga0466711_453011_2118_2678 166
31 3300042618 Ga0466723_010014 Ga0466723_010014_188_742 166
32 3300042652 Ga0466708_061526 Ga0466708_061526_6835_7395 166
33 3300002834 JGI24696J40584_12923548 JGI24696J40584_129235482 167
34 3300042590 Ga0466690_019853 Ga0466690_019853_9452_10006 167
35 3300042615 Ga0466711_295646 Ga0466711_295646_227_787 167
36 3300042622 Ga0466731_326072 Ga0466731_326072_572_1126 167
37 3300010167 Ga0123353_10137335 Ga0123353_101373352 169
38 3300024493 Ga0264413_152493 Ga0264413_1524932 169
39 3300042602 Ga0466713_144458 Ga0466713_144458_18_572 170
40 3300010882 Ga0123354_10245959 Ga0123354_102459593 173
41 3300042606 Ga0466719_030736 Ga0466719_030736_1467_1988 173
42 3300042594 Ga0466694_086586 Ga0466694_086586_23015_23575 174
43 3300042618 Ga0466723_014898 Ga0466723_014898_979_1542 174
44 3300010167 Ga0123353_10499265 Ga0123353_104992652 175
45 3300042652 Ga0466708_412250 Ga0466708_412250_1188_1742 175
46 3300042594 Ga0466694_285899 Ga0466694_285899_1301_1855 176
47 3300042595 Ga0466695_137746 Ga0466695_137746_416_976 176
48 3300042643 Ga0466704_294115 Ga0466704_294115_658_1218 176
49 3300042655 Ga0466727_296708 Ga0466727_296708_2238_2792 176
50 3300042659 Ga0466733_001489 Ga0466733_001489_802_1362 176
51 3300042600 Ga0466700_170210 Ga0466700_170210_624_1184 177
52 3300042621 Ga0466729_150801 Ga0466729_150801_810_1364 177
53 3300002504 JGI24705J35276_12189294 JGI24705J35276_121892942 178
54 3300042648 Ga0466709_366140 Ga0466709_366140_396_950 178
55 3300042617 Ga0466718_104761 Ga0466718_104761_1347_1907 179
56 3300042636 Ga0466703_189115 Ga0466703_189115_8073_8612 179
57 3300042612 Ga0466705_050150 Ga0466705_050150_27483_28031 182
58 3300005200 Ga0072940_1443507 Ga0072940_14435072 183
59 3300038395 Ga0415639_023870 Ga0415639_023870_632_1186 184
60 3300038395 Ga0415639_051006 Ga0415639_051006_10534_11088 184
61 3300038395 Ga0415639_096342 Ga0415639_096342_2947_3501 184
62 3300042596 Ga0466696_063750 Ga0466696_063750_3631_4185 184
63 3300042600 Ga0466700_067519 Ga0466700_067519_596_1150 184
64 3300042600 Ga0466700_175724 Ga0466700_175724_325_879 184
65 3300042605 Ga0466716_090160 Ga0466716_090160_10039_10593 184
66 3300042606 Ga0466719_511323 Ga0466719_511323_3919_4473 184
67 3300042608 Ga0466721_368920 Ga0466721_368920_472_1026 184
68 3300042610 Ga0466698_082695 Ga0466698_082695_90_644 184
69 3300042615 Ga0466711_097458 Ga0466711_097458_391_945 184
70 3300042615 Ga0466711_431851 Ga0466711_431851_191_745 184
71 3300042616 Ga0466715_023724 Ga0466715_023724_11388_11942 184
72 3300042616 Ga0466715_527367 Ga0466715_527367_569_1123 184
73 3300042616 Ga0466715_583960 Ga0466715_583960_687_1241 184
74 3300042616 Ga0466715_630959 Ga0466715_630959_10847_11401 184
75 3300042618 Ga0466723_048435 Ga0466723_048435_1076_1630 184
76 3300042618 Ga0466723_367953 Ga0466723_367953_7037_7591 184
77 3300042619 Ga0466726_231672 Ga0466726_231672_892_1446 184
78 3300042619 Ga0466726_396707 Ga0466726_396707_1006_1560 184
79 3300042621 Ga0466729_094139 Ga0466729_094139_162_716 184
80 3300042624 Ga0466735_001005 Ga0466735_001005_501_1055 184
81 3300042624 Ga0466735_067542 Ga0466735_067542_293_847 184
82 3300042624 Ga0466735_171595 Ga0466735_171595_587_1141 184
83 3300042648 Ga0466709_017382 Ga0466709_017382_503_1057 184
84 3300042652 Ga0466708_009999 Ga0466708_009999_18635_19189 184
85 3300042652 Ga0466708_063506 Ga0466708_063506_2606_3160 184
86 3300042652 Ga0466708_174299 Ga0466708_174299_136_690 184
87 3300042652 Ga0466708_218841 Ga0466708_218841_4025_4579 184
88 3300042654 Ga0466725_324249 Ga0466725_324249_381_935 184
89 3300042655 Ga0466727_152273 Ga0466727_152273_282_836 184
90 3300042655 Ga0466727_264571 Ga0466727_264571_269_823 184
91 3300042659 Ga0466733_019758 Ga0466733_019758_642_1196 184
92 iso_pr_bacteria 2585427656 2586083697 184
93 iso_pr_bacteria 2781125655 2781317010 184
94 iso_pr_bacteria 2781125694 2781437423 184
95 iso_pr_bacteria 650716099 650878874 184
96 3300002450 JGI24695J34938_10173579 JGI24695J34938_101735792 185
97 3300005083 Ga0068305_10001191 Ga0068305_100011911 185
98 3300009784 Ga0123357_10415884 Ga0123357_104158841 185
99 3300009826 Ga0123355_10378335 Ga0123355_103783352 185
100 3300010049 Ga0123356_10897515 Ga0123356_108975152 185
101 3300010167 Ga0123353_10068960 Ga0123353_100689603 185
102 3300010167 Ga0123353_10180188 Ga0123353_101801882 185
103 3300010167 Ga0123353_10347645 Ga0123353_103476453 185
104 3300010167 Ga0123353_10547838 Ga0123353_105478383 185
105 3300010167 Ga0123353_10756830 Ga0123353_107568302 185
106 3300010167 Ga0123353_10768294 Ga0123353_107682942 185
107 3300010167 Ga0123353_10831347 Ga0123353_108313472 185
108 3300010882 Ga0123354_10713795 Ga0123354_107137951 185
109 3300042612 Ga0466705_178621 Ga0466705_178621_68882_69439 185
110 3300042614 Ga0466712_194668 Ga0466712_194668_1494_2093 185
111 3300042652 Ga0466708_138923 Ga0466708_138923_1126_1683 185
112 iso_pr_bacteria 2507262005 2507288084 185
113 iso_pr_bacteria 2864801025 2864802838 185
114 iso_pr_bacteria 2864895409 2864896671 185
115 iso_pr_bacteria 648861007 648922138 185
116 iso_pr_bacteria 8043041867 8043043062 185
117 3300002450 JGI24695J34938_10048789 JGI24695J34938_100487892 186
118 3300042590 Ga0466690_146940 Ga0466690_146940_1421_1981 186
119 3300042592 Ga0466693_250798 Ga0466693_250798_927_1487 186
120 3300042597 Ga0466699_127381 Ga0466699_127381_70885_71445 186
121 3300042598 Ga0466701_084308 Ga0466701_084308_503_1063 186
122 3300042599 Ga0466706_275392 Ga0466706_275392_64345_64905 186
123 3300042600 Ga0466700_473617 Ga0466700_473617_1388_1948 186
124 3300042603 Ga0466714_113340 Ga0466714_113340_2414_2974 186
125 3300042604 Ga0466717_086676 Ga0466717_086676_1401_1961 186
126 3300042607 Ga0466720_061640 Ga0466720_061640_637_1197 186
127 3300042610 Ga0466698_029494 Ga0466698_029494_320_880 186
128 3300042610 Ga0466698_468250 Ga0466698_468250_923_1483 186
129 3300042611 Ga0466697_182316 Ga0466697_182316_249_809 186
130 3300042612 Ga0466705_007285 Ga0466705_007285_32716_33276 186
131 3300042612 Ga0466705_144397 Ga0466705_144397_479_1039 186
132 3300042616 Ga0466715_081506 Ga0466715_081506_3918_4478 186
133 3300042617 Ga0466718_067235 Ga0466718_067235_1481_2041 186
134 3300042623 Ga0466734_035630 Ga0466734_035630_1870_2430 186
135 3300042625 Ga0466730_008953 Ga0466730_008953_554_1114 186
136 3300042648 Ga0466709_133636 Ga0466709_133636_508_1068 186
137 iso_pr_bacteria 2820044805 2820046306 186
138 iso_pr_bacteria 2820058318 2820058812 186
139 iso_pr_bacteria 2820074476 2820075378 186
140 iso_pr_bacteria 2820079308 2820079352 186
141 iso_pr_bacteria 2820096063 2820096985 186
142 iso_pr_bacteria 2820097052 2820097715 186
143 iso_pr_bacteria 2820097968 2820098796 186
144 iso_pr_bacteria 2820100407 2820100638 186
145 iso_pr_bacteria 2820136564 2820137081 186
146 iso_pr_bacteria 2820150510 2820150674 186
147 iso_pr_bacteria 2820151121 2820151748 186
148 3300002504 JGI24705J35276_12230772 JGI24705J35276_122307724 187
149 3300005201 Ga0072941_1024088 Ga0072941_10240882 187
150 3300009784 Ga0123357_10006578 Ga0123357_100065782 187
151 3300009784 Ga0123357_10069458 Ga0123357_100694583 187
152 3300009784 Ga0123357_10080338 Ga0123357_100803384 187
153 3300009784 Ga0123357_10300890 Ga0123357_103008902 187
154 3300009784 Ga0123357_10310642 Ga0123357_103106422 187
155 3300009826 Ga0123355_10038977 Ga0123355_100389778 187
156 3300010049 Ga0123356_10000237 Ga0123356_1000023740 187
157 3300010049 Ga0123356_10276281 Ga0123356_102762813 187
158 3300010167 Ga0123353_10013486 Ga0123353_1001348611 187
159 3300010167 Ga0123353_10366502 Ga0123353_103665022 187
160 3300010167 Ga0123353_11499415 Ga0123353_114994151 187
161 3300010882 Ga0123354_10280800 Ga0123354_102808002 187
162 iso_pr_bacteria 2781125632 2781271655 187
163 3300010049 Ga0123356_10973923 Ga0123356_109739232 188
164 3300042590 Ga0466690_130000 Ga0466690_130000_209_775 188
165 3300042617 Ga0466718_065758 Ga0466718_065758_156826_157392 188
166 3300010049 Ga0123356_10023477 Ga0123356_100234774 189
167 iso_pr_bacteria 2556921622 2558100262 189
168 iso_pr_bacteria 2820931684 2820932011 190
169 3300010049 Ga0123356_10051025 Ga0123356_100510254 191
170 3300010167 Ga0123353_10001706 Ga0123353_100017067 191
171 3300022815 Ga0255786_1005069 Ga0255786_10050692 191
172 iso_pr_bacteria 2820142992 2820146143 191
173 3300002449 JGI24698J34947_10000688 JGI24698J34947_1000068814 192
174 3300009826 Ga0123355_10080118 Ga0123355_100801188 192
175 3300010049 Ga0123356_10019392 Ga0123356_100193926 192
176 3300010049 Ga0123356_10110952 Ga0123356_101109524 192
177 3300042643 Ga0466704_212168 Ga0466704_212168_8799_9377 192
178 3300042616 Ga0466715_396848 Ga0466715_396848_1065_1664 199
179 3300042599 Ga0466706_154161 Ga0466706_154161_5230_5862 210
180 3300010167 Ga0123353_10000004 Ga0123353_10000004275 216

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01765 RRF Ribosome recycling factor 50 213 0.99

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.65 0.72 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.