Protein Family IF03007
Metagenome
Metatranscriptome
Isolate
180
Members
83
Samples
156
Scaffolds
180.2
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_10000004|Ga0123353_10000004275
- Length
- 216 aa
- Sequence
- MQHVQKSNQKSGLKFLYGIGMLFPSKGESMDYTLLKTEAESKTAATIEVLKTEYAGLRTGRASVHLLDGVRVEVYGSEMPINQVATVSTPEAQVISVSVWDLSNAGAVEKAIRDSGLGLNPMSAGGVIRINLPPLTEERRRELVKVAGKYAEEAKISMRNIRQDLMGKIKRAETDKVISEDDRKRFEEDLQKVFDARALEVDSIAKQKETDIMSV*
Sample Types
Isolate
13.3%
Metagenome
85.6%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.5%
Unclassified
25.0%
Kalotermitidae
16.2%
Rhinotermitidae
3.8%
Termopsidae
3.8%
Aphididae
2.5%
Elmidae
2.5%
Hodotermitidae
1.2%
Monophlebidae
1.2%
Nephropidae
1.2%
Taxonomy
Archaea
0
Bacteria
174
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820058318 | Unclassified Proteobacteria Nt197P4bin33 | Isolate | Unclassified |
| 2 | 2820100407 | Unclassified Proteobacteria Lab288P1bin48 | Isolate | Unclassified |
| 3 | 2820136564 | Unclassified Proteobacteria Emb289P3bin18 | Isolate | Unclassified |
| 4 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 5 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 6 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 7 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 10 | 2820079308 | Unclassified Proteobacteria Lab288P4bin43 | Isolate | Unclassified |
| 11 | 2820151121 | Unclassified Proteobacteria Cu122P5bin52 | Isolate | Unclassified |
| 12 | 2820931684 | Unclassified Actinobacteria Emb289P1bin89 | Isolate | Unclassified |
| 13 | 648861007 | Candidatus Regiella insecticola LSR1 | Isolate | Aphididae |
| 14 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 15 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2820074476 | Unclassified Proteobacteria Nt197P3bin125 | Isolate | Unclassified |
| 18 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300009453 | Microbial communities of aphids from Cornus sp. in New Haven, CT, USA - Anoecia fulviabdominalis seqcov | Metagenome | |
| 24 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2507262005 | Candidatus Regiella insecticola R5.15 | Isolate | Aphididae |
| 34 | 2820097052 | Unclassified Proteobacteria Lab288P3bin109 | Isolate | Unclassified |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2556921622 | Terasakiella pusilla DSM 6293 | Isolate | Unclassified |
| 45 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 46 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 47 | 2820142992 | Unclassified Proteobacteria Emb289P3bin113 | Isolate | Unclassified |
| 48 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 49 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 50 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 53 | 2820150510 | Unclassified Proteobacteria Emb289P1bin35 | Isolate | Unclassified |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 56 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 57 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 58 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 59 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 60 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 61 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 62 | 2585427656 | Endosymbiont of Llaveia axin axin | Isolate | Monophlebidae |
| 63 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 64 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 65 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 66 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 67 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 68 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 69 | 2820096063 | Unclassified Proteobacteria Lab288P3bin136 | Isolate | Unclassified |
| 70 | 2820097968 | Unclassified Proteobacteria Lab288P3bin104 | Isolate | Unclassified |
| 71 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 72 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 73 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 74 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 75 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 76 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 77 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 78 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 79 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 80 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 81 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 82 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 83 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_050150 | 3300042612 | Bacteria | 30586 |
| 2 | Ga0466706_154161 | 3300042599 | Bacteria | 7369 |
| 3 | Ga0466706_275392 | 3300042599 | Bacteria | 84446 |
| 4 | Ga0466717_086676 | 3300042604 | Bacteria | 2468 |
| 5 | Ga0466698_314947 | 3300042610 | Bacteria | 1487 |
| 6 | JGI24695J34938_10171135 | 3300002450 | Bacteria | 896 |
| 7 | JGI24705J35276_12189294 | 3300002504 | Bacteria | 1450 |
| 8 | JGI24705J35276_12230772 | 3300002504 | Bacteria | 3730 |
| 9 | Ga0072941_1024088 | 3300005201 | Bacteria | 4106 |
| 10 | Ga0466731_326072 | 3300042622 | Bacteria | 1233 |
| 11 | Ga0466735_171595 | 3300042624 | Unclassified | 1393 |
| 12 | Ga0466708_031998 | 3300042652 | Bacteria | 7393 |
| 13 | Ga0466715_630959 | 3300042616 | Bacteria | 20029 |
| 14 | Ga0466723_048435 | 3300042618 | Bacteria | 9184 |
| 15 | Ga0466723_367953 | 3300042618 | Bacteria | 11886 |
| 16 | Ga0466726_231672 | 3300042619 | Bacteria | 1823 |
| 17 | Ga0466729_150801 | 3300042621 | Bacteria | 2246 |
| 18 | Ga0466690_146940 | 3300042590 | Bacteria | 2199 |
| 19 | Ga0466693_250798 | 3300042592 | Bacteria | 2015 |
| 20 | Ga0466694_285899 | 3300042594 | Bacteria | 5973 |
| 21 | Ga0123356_10051025 | 3300010049 | Bacteria | 3848 |
| 22 | Ga0123353_10547838 | 3300010167 | Bacteria | 1669 |
| 23 | Ga0466733_001489 | 3300042659 | Bacteria | 2255 |
| 24 | Ga0466700_067519 | 3300042600 | Bacteria | 2150 |
| 25 | Ga0466700_473617 | 3300042600 | Bacteria | 2193 |
| 26 | Ga0466700_474126 | 3300042600 | Bacteria | 1960 |
| 27 | JGI24695J34938_10000014 | 3300002450 | Bacteria | 120713 |
| 28 | JGI24702J35022_10021977 | 3300002462 | Bacteria | 3458 |
| 29 | Ga0068305_10021107 | 3300005083 | Bacteria | 4755 |
| 30 | Ga0466709_017382 | 3300042648 | Bacteria | 1440 |
| 31 | Ga0466711_015326 | 3300042615 | Bacteria | 42635 |
| 32 | Ga0466711_295646 | 3300042615 | Bacteria | 1483 |
| 33 | Ga0466711_431851 | 3300042615 | Bacteria | 1855 |
| 34 | Ga0466715_023724 | 3300042616 | Bacteria | 15101 |
| 35 | Ga0466718_104761 | 3300042617 | Bacteria | 4368 |
| 36 | Ga0123357_10415884 | 3300009784 | Bacteria | 1206 |
| 37 | Ga0123355_10038977 | 3300009826 | Bacteria | 7728 |
| 38 | Ga0123355_10378335 | 3300009826 | Bacteria | 1848 |
| 39 | Ga0123356_10000237 | 3300010049 | Bacteria | 63854 |
| 40 | Ga0123353_10000004 | 3300010167 | Bacteria | 312735 |
| 41 | Ga0123353_10499265 | 3300010167 | Bacteria | 1773 |
| 42 | Ga0123353_10768294 | 3300010167 | Bacteria | 1337 |
| 43 | Ga0466697_182316 | 3300042611 | Bacteria | 1120 |
| 44 | Ga0466713_144458 | 3300042602 | Bacteria | 1290 |
| 45 | Ga0466716_090160 | 3300042605 | Bacteria | 16455 |
| 46 | Ga0466698_029494 | 3300042610 | Bacteria | 1260 |
| 47 | JGI24695J34938_10173579 | 3300002450 | Bacteria | 890 |
| 48 | Ga0466734_035630 | 3300042623 | Bacteria | 2640 |
| 49 | Ga0466703_189115 | 3300042636 | Bacteria | 11684 |
| 50 | Ga0466708_061526 | 3300042652 | Bacteria | 8191 |
| 51 | Ga0466708_412250 | 3300042652 | Bacteria | 2768 |
| 52 | Ga0466727_296708 | 3300042655 | Bacteria | 5303 |
| 53 | Ga0466718_067235 | 3300042617 | Bacteria | 2241 |
| 54 | Ga0466729_026616 | 3300042621 | Bacteria | 1420 |
| 55 | Ga0255786_1005069 | 3300022815 | Bacteria | 1058 |
| 56 | Ga0466694_086586 | 3300042594 | Bacteria | 46405 |
| 57 | Ga0123355_10080118 | 3300009826 | Bacteria | 5214 |
| 58 | Ga0123356_10019392 | 3300010049 | Bacteria | 6446 |
| 59 | Ga0123356_10897515 | 3300010049 | Bacteria | 1057 |
| 60 | Ga0123353_10001706 | 3300010167 | Bacteria | 26978 |
| 61 | Ga0123353_10360530 | 3300010167 | Bacteria | 2185 |
| 62 | Ga0123353_10366502 | 3300010167 | Bacteria | 2162 |
| 63 | Ga0123353_10831347 | 3300010167 | Bacteria | 1269 |
| 64 | Ga0123354_10245959 | 3300010882 | Bacteria | 1827 |
| 65 | Ga0466705_128209 | 3300042612 | Bacteria | 1143 |
| 66 | Ga0466713_093647 | 3300042602 | Bacteria | 104622 |
| 67 | Ga0466719_511323 | 3300042606 | Bacteria | 12327 |
| 68 | Ga0466720_061640 | 3300042607 | Bacteria | 1550 |
| 69 | JGI24698J34947_10000688 | 3300002449 | Bacteria | 16494 |
| 70 | Ga0074263_114303 | 3300005485 | Bacteria | 2367 |
| 71 | Ga0127656_100082 | 3300009453 | Bacteria | 50010 |
| 72 | Ga0466735_001005 | 3300042624 | Unclassified | 1344 |
| 73 | Ga0466735_067542 | 3300042624 | Bacteria | 16235 |
| 74 | Ga0466709_133636 | 3300042648 | Bacteria | 1661 |
| 75 | Ga0466709_366140 | 3300042648 | Bacteria | 2587 |
| 76 | Ga0466708_174299 | 3300042652 | Bacteria | 1201 |
| 77 | Ga0466727_152273 | 3300042655 | Bacteria | 1135 |
| 78 | Ga0466727_264571 | 3300042655 | Bacteria | 1216 |
| 79 | Ga0466715_081506 | 3300042616 | Bacteria | 4543 |
| 80 | Ga0466715_527367 | 3300042616 | Bacteria | 5458 |
| 81 | Ga0466715_583960 | 3300042616 | Bacteria | 1706 |
| 82 | Ga0466726_396707 | 3300042619 | Bacteria | 3069 |
| 83 | Ga0415639_051006 | 3300038395 | Bacteria | 11106 |
| 84 | Ga0415639_096342 | 3300038395 | Bacteria | 4503 |
| 85 | Ga0466690_019853 | 3300042590 | Bacteria | 17279 |
| 86 | Ga0466695_105176 | 3300042595 | Bacteria | 2043 |
| 87 | Ga0123355_10000558 | 3300009826 | Bacteria | 49958 |
| 88 | Ga0123353_10013486 | 3300010167 | Bacteria | 11711 |
| 89 | Ga0466705_144397 | 3300042612 | Bacteria | 1078 |
| 90 | Ga0466733_019758 | 3300042659 | Bacteria | 3306 |
| 91 | Ga0466701_084308 | 3300042598 | Unclassified | 2039 |
| 92 | Ga0466700_175724 | 3300042600 | Bacteria | 1616 |
| 93 | Ga0466721_368920 | 3300042608 | Bacteria | 1189 |
| 94 | JGI24696J40584_12923548 | 3300002834 | Bacteria | 1377 |
| 95 | Ga0466730_008953 | 3300042625 | Bacteria | 1555 |
| 96 | Ga0466708_138923 | 3300042652 | Bacteria | 2691 |
| 97 | Ga0466708_218841 | 3300042652 | Bacteria | 22149 |
| 98 | Ga0466723_010014 | 3300042618 | Bacteria | 1040 |
| 99 | Ga0255786_1041105 | 3300022815 | Bacteria | 650 |
| 100 | Ga0264413_152493 | 3300024493 | Bacteria | 3216 |
| 101 | Ga0456237_0019633 | 3300041968 | Bacteria | 939 |
| 102 | Ga0466694_275963 | 3300042594 | Bacteria | 2255 |
| 103 | Ga0466699_127381 | 3300042597 | Bacteria | 84968 |
| 104 | Ga0123357_10069458 | 3300009784 | Unclassified | 4682 |
| 105 | Ga0123357_10310642 | 3300009784 | Bacteria | 1575 |
| 106 | Ga0123353_10756830 | 3300010167 | Bacteria | 1351 |
| 107 | Ga0123354_10713795 | 3300010882 | Bacteria | 697 |
| 108 | Ga0466705_178621 | 3300042612 | Bacteria | 90956 |
| 109 | Ga0466714_113340 | 3300042603 | Bacteria | 3061 |
| 110 | Ga0466698_468250 | 3300042610 | Bacteria | 1622 |
| 111 | JGI24698J34947_10000823 | 3300002449 | Bacteria | 15496 |
| 112 | Ga0072940_1443507 | 3300005200 | Bacteria | 2189 |
| 113 | Ga0466704_294115 | 3300042643 | Bacteria | 35639 |
| 114 | Ga0466718_065758 | 3300042617 | Bacteria | 194574 |
| 115 | Ga0123357_10006578 | 3300009784 | Bacteria | 14219 |
| 116 | Ga0123357_10080338 | 3300009784 | Bacteria | 4289 |
| 117 | Ga0123357_10300890 | 3300009784 | Bacteria | 1620 |
| 118 | Ga0123356_10136618 | 3300010049 | Bacteria | 2411 |
| 119 | Ga0123353_10068960 | 3300010167 | Bacteria | 5680 |
| 120 | Ga0123353_10137335 | 3300010167 | Bacteria | 3920 |
| 121 | Ga0123353_10180188 | 3300010167 | Bacteria | 3346 |
| 122 | Ga0466705_007285 | 3300042612 | Bacteria | 90107 |
| 123 | Ga0466705_385171 | 3300042612 | Bacteria | 1872 |
| 124 | Ga0466700_116701 | 3300042600 | Bacteria | 1876 |
| 125 | Ga0466722_264504 | 3300042609 | Bacteria | 2876 |
| 126 | Ga0466704_212168 | 3300042643 | Bacteria | 11742 |
| 127 | Ga0466708_009999 | 3300042652 | Bacteria | 25991 |
| 128 | Ga0466708_063506 | 3300042652 | Bacteria | 7049 |
| 129 | Ga0466725_324249 | 3300042654 | Bacteria | 1830 |
| 130 | Ga0466712_194668 | 3300042614 | Bacteria | 3028 |
| 131 | Ga0466711_097458 | 3300042615 | Bacteria | 3881 |
| 132 | Ga0466711_453011 | 3300042615 | Unclassified | 3069 |
| 133 | Ga0466715_396848 | 3300042616 | Bacteria | 2819 |
| 134 | Ga0123356_10023477 | 3300010049 | Bacteria | 5802 |
| 135 | Ga0123356_10110952 | 3300010049 | Bacteria | 2649 |
| 136 | Ga0123356_10276281 | 3300010049 | Bacteria | 1772 |
| 137 | Ga0123356_10973923 | 3300010049 | Bacteria | 1019 |
| 138 | Ga0123353_11499415 | 3300010167 | Bacteria | 859 |
| 139 | Ga0123354_10280800 | 3300010882 | Bacteria | 1617 |
| 140 | Ga0466700_170210 | 3300042600 | Bacteria | 1245 |
| 141 | Ga0466716_183580 | 3300042605 | Bacteria | 27730 |
| 142 | Ga0466719_030736 | 3300042606 | Bacteria | 2054 |
| 143 | Ga0466698_082695 | 3300042610 | Bacteria | 1521 |
| 144 | JGI24695J34938_10048789 | 3300002450 | Unclassified | 1864 |
| 145 | Ga0068305_10001191 | 3300005083 | Bacteria | 2006 |
| 146 | Ga0466731_359257 | 3300042622 | Bacteria | 7460 |
| 147 | Ga0466702_241505 | 3300042635 | Bacteria | 1995 |
| 148 | Ga0466723_014898 | 3300042618 | Bacteria | 1638 |
| 149 | Ga0466728_449689 | 3300042620 | Bacteria | 48197 |
| 150 | Ga0466729_094139 | 3300042621 | Bacteria | 1821 |
| 151 | Ga0415639_023870 | 3300038395 | Bacteria | 1952 |
| 152 | Ga0466690_130000 | 3300042590 | Bacteria | 1133 |
| 153 | Ga0466695_137746 | 3300042595 | Bacteria | 2317 |
| 154 | Ga0466695_176370 | 3300042595 | Bacteria | 2104 |
| 155 | Ga0466696_063750 | 3300042596 | Bacteria | 11754 |
| 156 | Ga0123353_10347645 | 3300010167 | Bacteria | 2236 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300002450 | JGI24695J34938_10171135 | JGI24695J34938_101711352 | 155 |
| 2 | 3300009826 | Ga0123355_10000558 | Ga0123355_1000055841 | 155 |
| 3 | 3300042621 | Ga0466729_026616 | Ga0466729_026616_430_984 | 155 |
| 4 | 3300042595 | Ga0466695_105176 | Ga0466695_105176_119_673 | 156 |
| 5 | 3300041968 | Ga0456237_0019633 | Ga0456237_0019633_139_693 | 157 |
| 6 | 3300042612 | Ga0466705_128209 | Ga0466705_128209_386_946 | 157 |
| 7 | 3300009453 | Ga0127656_100082 | Ga0127656_10008217 | 158 |
| 8 | 3300042594 | Ga0466694_275963 | Ga0466694_275963_739_1299 | 158 |
| 9 | 3300042635 | Ga0466702_241505 | Ga0466702_241505_1298_1852 | 158 |
| 10 | 3300005485 | Ga0074263_114303 | Ga0074263_1143032 | 159 |
| 11 | 3300010049 | Ga0123356_10136618 | Ga0123356_101366182 | 159 |
| 12 | 3300022815 | Ga0255786_1041105 | Ga0255786_10411051 | 159 |
| 13 | 3300042600 | Ga0466700_116701 | Ga0466700_116701_357_917 | 159 |
| 14 | 3300042610 | Ga0466698_314947 | Ga0466698_314947_522_1076 | 159 |
| 15 | 3300042615 | Ga0466711_015326 | Ga0466711_015326_25829_26383 | 159 |
| 16 | 3300002450 | JGI24695J34938_10000014 | JGI24695J34938_1000001479 | 161 |
| 17 | 3300005083 | Ga0068305_10021107 | Ga0068305_100211075 | 161 |
| 18 | 3300042609 | Ga0466722_264504 | Ga0466722_264504_2252_2809 | 162 |
| 19 | 3300042622 | Ga0466731_359257 | Ga0466731_359257_524_1084 | 162 |
| 20 | 3300002449 | JGI24698J34947_10000823 | JGI24698J34947_100008233 | 164 |
| 21 | 3300002462 | JGI24702J35022_10021977 | JGI24702J35022_100219774 | 164 |
| 22 | 3300042620 | Ga0466728_449689 | Ga0466728_449689_36344_36886 | 164 |
| 23 | 3300010167 | Ga0123353_10360530 | Ga0123353_103605303 | 165 |
| 24 | 3300042600 | Ga0466700_474126 | Ga0466700_474126_1024_1578 | 165 |
| 25 | 3300042652 | Ga0466708_031998 | Ga0466708_031998_2591_3112 | 165 |
| 26 | 3300042595 | Ga0466695_176370 | Ga0466695_176370_939_1499 | 166 |
| 27 | 3300042602 | Ga0466713_093647 | Ga0466713_093647_83248_83808 | 166 |
| 28 | 3300042605 | Ga0466716_183580 | Ga0466716_183580_13014_13574 | 166 |
| 29 | 3300042612 | Ga0466705_385171 | Ga0466705_385171_627_1181 | 166 |
| 30 | 3300042615 | Ga0466711_453011 | Ga0466711_453011_2118_2678 | 166 |
| 31 | 3300042618 | Ga0466723_010014 | Ga0466723_010014_188_742 | 166 |
| 32 | 3300042652 | Ga0466708_061526 | Ga0466708_061526_6835_7395 | 166 |
| 33 | 3300002834 | JGI24696J40584_12923548 | JGI24696J40584_129235482 | 167 |
| 34 | 3300042590 | Ga0466690_019853 | Ga0466690_019853_9452_10006 | 167 |
| 35 | 3300042615 | Ga0466711_295646 | Ga0466711_295646_227_787 | 167 |
| 36 | 3300042622 | Ga0466731_326072 | Ga0466731_326072_572_1126 | 167 |
| 37 | 3300010167 | Ga0123353_10137335 | Ga0123353_101373352 | 169 |
| 38 | 3300024493 | Ga0264413_152493 | Ga0264413_1524932 | 169 |
| 39 | 3300042602 | Ga0466713_144458 | Ga0466713_144458_18_572 | 170 |
| 40 | 3300010882 | Ga0123354_10245959 | Ga0123354_102459593 | 173 |
| 41 | 3300042606 | Ga0466719_030736 | Ga0466719_030736_1467_1988 | 173 |
| 42 | 3300042594 | Ga0466694_086586 | Ga0466694_086586_23015_23575 | 174 |
| 43 | 3300042618 | Ga0466723_014898 | Ga0466723_014898_979_1542 | 174 |
| 44 | 3300010167 | Ga0123353_10499265 | Ga0123353_104992652 | 175 |
| 45 | 3300042652 | Ga0466708_412250 | Ga0466708_412250_1188_1742 | 175 |
| 46 | 3300042594 | Ga0466694_285899 | Ga0466694_285899_1301_1855 | 176 |
| 47 | 3300042595 | Ga0466695_137746 | Ga0466695_137746_416_976 | 176 |
| 48 | 3300042643 | Ga0466704_294115 | Ga0466704_294115_658_1218 | 176 |
| 49 | 3300042655 | Ga0466727_296708 | Ga0466727_296708_2238_2792 | 176 |
| 50 | 3300042659 | Ga0466733_001489 | Ga0466733_001489_802_1362 | 176 |
| 51 | 3300042600 | Ga0466700_170210 | Ga0466700_170210_624_1184 | 177 |
| 52 | 3300042621 | Ga0466729_150801 | Ga0466729_150801_810_1364 | 177 |
| 53 | 3300002504 | JGI24705J35276_12189294 | JGI24705J35276_121892942 | 178 |
| 54 | 3300042648 | Ga0466709_366140 | Ga0466709_366140_396_950 | 178 |
| 55 | 3300042617 | Ga0466718_104761 | Ga0466718_104761_1347_1907 | 179 |
| 56 | 3300042636 | Ga0466703_189115 | Ga0466703_189115_8073_8612 | 179 |
| 57 | 3300042612 | Ga0466705_050150 | Ga0466705_050150_27483_28031 | 182 |
| 58 | 3300005200 | Ga0072940_1443507 | Ga0072940_14435072 | 183 |
| 59 | 3300038395 | Ga0415639_023870 | Ga0415639_023870_632_1186 | 184 |
| 60 | 3300038395 | Ga0415639_051006 | Ga0415639_051006_10534_11088 | 184 |
| 61 | 3300038395 | Ga0415639_096342 | Ga0415639_096342_2947_3501 | 184 |
| 62 | 3300042596 | Ga0466696_063750 | Ga0466696_063750_3631_4185 | 184 |
| 63 | 3300042600 | Ga0466700_067519 | Ga0466700_067519_596_1150 | 184 |
| 64 | 3300042600 | Ga0466700_175724 | Ga0466700_175724_325_879 | 184 |
| 65 | 3300042605 | Ga0466716_090160 | Ga0466716_090160_10039_10593 | 184 |
| 66 | 3300042606 | Ga0466719_511323 | Ga0466719_511323_3919_4473 | 184 |
| 67 | 3300042608 | Ga0466721_368920 | Ga0466721_368920_472_1026 | 184 |
| 68 | 3300042610 | Ga0466698_082695 | Ga0466698_082695_90_644 | 184 |
| 69 | 3300042615 | Ga0466711_097458 | Ga0466711_097458_391_945 | 184 |
| 70 | 3300042615 | Ga0466711_431851 | Ga0466711_431851_191_745 | 184 |
| 71 | 3300042616 | Ga0466715_023724 | Ga0466715_023724_11388_11942 | 184 |
| 72 | 3300042616 | Ga0466715_527367 | Ga0466715_527367_569_1123 | 184 |
| 73 | 3300042616 | Ga0466715_583960 | Ga0466715_583960_687_1241 | 184 |
| 74 | 3300042616 | Ga0466715_630959 | Ga0466715_630959_10847_11401 | 184 |
| 75 | 3300042618 | Ga0466723_048435 | Ga0466723_048435_1076_1630 | 184 |
| 76 | 3300042618 | Ga0466723_367953 | Ga0466723_367953_7037_7591 | 184 |
| 77 | 3300042619 | Ga0466726_231672 | Ga0466726_231672_892_1446 | 184 |
| 78 | 3300042619 | Ga0466726_396707 | Ga0466726_396707_1006_1560 | 184 |
| 79 | 3300042621 | Ga0466729_094139 | Ga0466729_094139_162_716 | 184 |
| 80 | 3300042624 | Ga0466735_001005 | Ga0466735_001005_501_1055 | 184 |
| 81 | 3300042624 | Ga0466735_067542 | Ga0466735_067542_293_847 | 184 |
| 82 | 3300042624 | Ga0466735_171595 | Ga0466735_171595_587_1141 | 184 |
| 83 | 3300042648 | Ga0466709_017382 | Ga0466709_017382_503_1057 | 184 |
| 84 | 3300042652 | Ga0466708_009999 | Ga0466708_009999_18635_19189 | 184 |
| 85 | 3300042652 | Ga0466708_063506 | Ga0466708_063506_2606_3160 | 184 |
| 86 | 3300042652 | Ga0466708_174299 | Ga0466708_174299_136_690 | 184 |
| 87 | 3300042652 | Ga0466708_218841 | Ga0466708_218841_4025_4579 | 184 |
| 88 | 3300042654 | Ga0466725_324249 | Ga0466725_324249_381_935 | 184 |
| 89 | 3300042655 | Ga0466727_152273 | Ga0466727_152273_282_836 | 184 |
| 90 | 3300042655 | Ga0466727_264571 | Ga0466727_264571_269_823 | 184 |
| 91 | 3300042659 | Ga0466733_019758 | Ga0466733_019758_642_1196 | 184 |
| 92 | iso_pr_bacteria | 2585427656 | 2586083697 | 184 |
| 93 | iso_pr_bacteria | 2781125655 | 2781317010 | 184 |
| 94 | iso_pr_bacteria | 2781125694 | 2781437423 | 184 |
| 95 | iso_pr_bacteria | 650716099 | 650878874 | 184 |
| 96 | 3300002450 | JGI24695J34938_10173579 | JGI24695J34938_101735792 | 185 |
| 97 | 3300005083 | Ga0068305_10001191 | Ga0068305_100011911 | 185 |
| 98 | 3300009784 | Ga0123357_10415884 | Ga0123357_104158841 | 185 |
| 99 | 3300009826 | Ga0123355_10378335 | Ga0123355_103783352 | 185 |
| 100 | 3300010049 | Ga0123356_10897515 | Ga0123356_108975152 | 185 |
| 101 | 3300010167 | Ga0123353_10068960 | Ga0123353_100689603 | 185 |
| 102 | 3300010167 | Ga0123353_10180188 | Ga0123353_101801882 | 185 |
| 103 | 3300010167 | Ga0123353_10347645 | Ga0123353_103476453 | 185 |
| 104 | 3300010167 | Ga0123353_10547838 | Ga0123353_105478383 | 185 |
| 105 | 3300010167 | Ga0123353_10756830 | Ga0123353_107568302 | 185 |
| 106 | 3300010167 | Ga0123353_10768294 | Ga0123353_107682942 | 185 |
| 107 | 3300010167 | Ga0123353_10831347 | Ga0123353_108313472 | 185 |
| 108 | 3300010882 | Ga0123354_10713795 | Ga0123354_107137951 | 185 |
| 109 | 3300042612 | Ga0466705_178621 | Ga0466705_178621_68882_69439 | 185 |
| 110 | 3300042614 | Ga0466712_194668 | Ga0466712_194668_1494_2093 | 185 |
| 111 | 3300042652 | Ga0466708_138923 | Ga0466708_138923_1126_1683 | 185 |
| 112 | iso_pr_bacteria | 2507262005 | 2507288084 | 185 |
| 113 | iso_pr_bacteria | 2864801025 | 2864802838 | 185 |
| 114 | iso_pr_bacteria | 2864895409 | 2864896671 | 185 |
| 115 | iso_pr_bacteria | 648861007 | 648922138 | 185 |
| 116 | iso_pr_bacteria | 8043041867 | 8043043062 | 185 |
| 117 | 3300002450 | JGI24695J34938_10048789 | JGI24695J34938_100487892 | 186 |
| 118 | 3300042590 | Ga0466690_146940 | Ga0466690_146940_1421_1981 | 186 |
| 119 | 3300042592 | Ga0466693_250798 | Ga0466693_250798_927_1487 | 186 |
| 120 | 3300042597 | Ga0466699_127381 | Ga0466699_127381_70885_71445 | 186 |
| 121 | 3300042598 | Ga0466701_084308 | Ga0466701_084308_503_1063 | 186 |
| 122 | 3300042599 | Ga0466706_275392 | Ga0466706_275392_64345_64905 | 186 |
| 123 | 3300042600 | Ga0466700_473617 | Ga0466700_473617_1388_1948 | 186 |
| 124 | 3300042603 | Ga0466714_113340 | Ga0466714_113340_2414_2974 | 186 |
| 125 | 3300042604 | Ga0466717_086676 | Ga0466717_086676_1401_1961 | 186 |
| 126 | 3300042607 | Ga0466720_061640 | Ga0466720_061640_637_1197 | 186 |
| 127 | 3300042610 | Ga0466698_029494 | Ga0466698_029494_320_880 | 186 |
| 128 | 3300042610 | Ga0466698_468250 | Ga0466698_468250_923_1483 | 186 |
| 129 | 3300042611 | Ga0466697_182316 | Ga0466697_182316_249_809 | 186 |
| 130 | 3300042612 | Ga0466705_007285 | Ga0466705_007285_32716_33276 | 186 |
| 131 | 3300042612 | Ga0466705_144397 | Ga0466705_144397_479_1039 | 186 |
| 132 | 3300042616 | Ga0466715_081506 | Ga0466715_081506_3918_4478 | 186 |
| 133 | 3300042617 | Ga0466718_067235 | Ga0466718_067235_1481_2041 | 186 |
| 134 | 3300042623 | Ga0466734_035630 | Ga0466734_035630_1870_2430 | 186 |
| 135 | 3300042625 | Ga0466730_008953 | Ga0466730_008953_554_1114 | 186 |
| 136 | 3300042648 | Ga0466709_133636 | Ga0466709_133636_508_1068 | 186 |
| 137 | iso_pr_bacteria | 2820044805 | 2820046306 | 186 |
| 138 | iso_pr_bacteria | 2820058318 | 2820058812 | 186 |
| 139 | iso_pr_bacteria | 2820074476 | 2820075378 | 186 |
| 140 | iso_pr_bacteria | 2820079308 | 2820079352 | 186 |
| 141 | iso_pr_bacteria | 2820096063 | 2820096985 | 186 |
| 142 | iso_pr_bacteria | 2820097052 | 2820097715 | 186 |
| 143 | iso_pr_bacteria | 2820097968 | 2820098796 | 186 |
| 144 | iso_pr_bacteria | 2820100407 | 2820100638 | 186 |
| 145 | iso_pr_bacteria | 2820136564 | 2820137081 | 186 |
| 146 | iso_pr_bacteria | 2820150510 | 2820150674 | 186 |
| 147 | iso_pr_bacteria | 2820151121 | 2820151748 | 186 |
| 148 | 3300002504 | JGI24705J35276_12230772 | JGI24705J35276_122307724 | 187 |
| 149 | 3300005201 | Ga0072941_1024088 | Ga0072941_10240882 | 187 |
| 150 | 3300009784 | Ga0123357_10006578 | Ga0123357_100065782 | 187 |
| 151 | 3300009784 | Ga0123357_10069458 | Ga0123357_100694583 | 187 |
| 152 | 3300009784 | Ga0123357_10080338 | Ga0123357_100803384 | 187 |
| 153 | 3300009784 | Ga0123357_10300890 | Ga0123357_103008902 | 187 |
| 154 | 3300009784 | Ga0123357_10310642 | Ga0123357_103106422 | 187 |
| 155 | 3300009826 | Ga0123355_10038977 | Ga0123355_100389778 | 187 |
| 156 | 3300010049 | Ga0123356_10000237 | Ga0123356_1000023740 | 187 |
| 157 | 3300010049 | Ga0123356_10276281 | Ga0123356_102762813 | 187 |
| 158 | 3300010167 | Ga0123353_10013486 | Ga0123353_1001348611 | 187 |
| 159 | 3300010167 | Ga0123353_10366502 | Ga0123353_103665022 | 187 |
| 160 | 3300010167 | Ga0123353_11499415 | Ga0123353_114994151 | 187 |
| 161 | 3300010882 | Ga0123354_10280800 | Ga0123354_102808002 | 187 |
| 162 | iso_pr_bacteria | 2781125632 | 2781271655 | 187 |
| 163 | 3300010049 | Ga0123356_10973923 | Ga0123356_109739232 | 188 |
| 164 | 3300042590 | Ga0466690_130000 | Ga0466690_130000_209_775 | 188 |
| 165 | 3300042617 | Ga0466718_065758 | Ga0466718_065758_156826_157392 | 188 |
| 166 | 3300010049 | Ga0123356_10023477 | Ga0123356_100234774 | 189 |
| 167 | iso_pr_bacteria | 2556921622 | 2558100262 | 189 |
| 168 | iso_pr_bacteria | 2820931684 | 2820932011 | 190 |
| 169 | 3300010049 | Ga0123356_10051025 | Ga0123356_100510254 | 191 |
| 170 | 3300010167 | Ga0123353_10001706 | Ga0123353_100017067 | 191 |
| 171 | 3300022815 | Ga0255786_1005069 | Ga0255786_10050692 | 191 |
| 172 | iso_pr_bacteria | 2820142992 | 2820146143 | 191 |
| 173 | 3300002449 | JGI24698J34947_10000688 | JGI24698J34947_1000068814 | 192 |
| 174 | 3300009826 | Ga0123355_10080118 | Ga0123355_100801188 | 192 |
| 175 | 3300010049 | Ga0123356_10019392 | Ga0123356_100193926 | 192 |
| 176 | 3300010049 | Ga0123356_10110952 | Ga0123356_101109524 | 192 |
| 177 | 3300042643 | Ga0466704_212168 | Ga0466704_212168_8799_9377 | 192 |
| 178 | 3300042616 | Ga0466715_396848 | Ga0466715_396848_1065_1664 | 199 |
| 179 | 3300042599 | Ga0466706_154161 | Ga0466706_154161_5230_5862 | 210 |
| 180 | 3300010167 | Ga0123353_10000004 | Ga0123353_10000004275 | 216 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01765 | RRF | Ribosome recycling factor | 50 | 213 | 0.99 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.65 | 0.72 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.