Protein Family IF02999
Metagenome
Metatranscriptome
Isolate
393
Members
314
Samples
156
Scaffolds
61.24
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_13129336|Ga0123356_131293362
- Length
- 73 aa
- Sequence
- LDYLLESREEIMAKKSKIESWKKGSKFKARNYSRCERCGRPHGVLKKFGLCRICFRELAYKGQIPGVKKSSW*
Sample Types
Isolate
60.3%
Metagenome
38.4%
MAG
0.0%
Metatranscriptome
1.3%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
30.4%
Termitidae
14.3%
Apidae
12.6%
Blattidae
8.5%
Scarabaeidae
4.1%
Drosophilidae
3.1%
Halictidae
3.1%
Tenebrionidae
2.7%
Elmidae
2.4%
Culicidae
2.4%
Kalotermitidae
1.7%
Pyralidae
1.7%
Formicidae
1.4%
Termopsidae
1.0%
Bombycidae
1.0%
Rhinotermitidae
1.0%
Noctuidae
1.0%
Passalidae
0.7%
Hydrophilidae
0.7%
Acrididae
0.3%
Curculionidae
0.3%
Pentatomidae
0.3%
Portunidae
0.3%
Penaeidae
0.3%
Ocypodidae
0.3%
Gomphidae
0.3%
Nephropidae
0.3%
Dytiscidae
0.3%
Calliphoridae
0.3%
Vespidae
0.3%
Hodotermitidae
0.3%
Armadillidiidae
0.3%
Cerambycidae
0.3%
Siricidae
0.3%
Euphausiidae
0.3%
Libellulidae
0.3%
Eresidae
0.3%
Taxonomy
Archaea
0
Bacteria
355
Eukaryota
0
Viruses
0
Unclassified
38
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114537524 | Enterococcus sp. 12C11_DIV0727 12C11_DIV0727 | Isolate | |
| 2 | 2515154100 | Streptomyces sp. MspMP-M5 | Isolate | Unclassified |
| 3 | 2515154104 | Streptomyces sp. KhCrAH-244 | Isolate | Unclassified |
| 4 | 2595698199 | Melissococcus plutonius 60 | Isolate | Apidae |
| 5 | 2681812870 | Oerskovia enterophila DFA-19 | Isolate | Unclassified |
| 6 | 2684622911 | Lactobacillus kullabergensis Lb_186 | Isolate | Unclassified |
| 7 | 2684622914 | Lactobacillus helsinborgensis Lb_183 | Isolate | Unclassified |
| 8 | 2758568507 | Lactobacillus bombicola ESL0237 | Isolate | Unclassified |
| 9 | 2758568508 | Lactobacillus bombicola ESL0236 | Isolate | Unclassified |
| 10 | 2758568512 | Lactobacillus helsingborgensis ESL0262 | Isolate | Unclassified |
| 11 | 2820714932 | Unclassified Fibrobacteres Nc150P4bin10 | Isolate | Unclassified |
| 12 | 2968368220 | Lactobacillus bombicola OCC3 | Isolate | Apidae |
| 13 | 2971062614 | Lactobacillus bombicola BI-4G | Isolate | Apidae |
| 14 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 15 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 16 | 3300005319 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea female 2 gut | Metagenome | Drosophilidae |
| 17 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 18 | 2035265001 | Acrididae gut microbial communities from Texas A and M University, USA - Sample 321 | Metagenome | Acrididae |
| 19 | 3004719924 | Lactobacillus sp. W8174 | Isolate | Apidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 647000328 | Streptomyces sp. ACT-1 XylebKG-1 | Isolate | Curculionidae |
| 25 | 8001918023 | Bombilactobacillus bombi XV6 | Isolate | Apidae |
| 26 | 8002304686 | Apilactobacillus kunkeei UASWS1867-NN5 | Isolate | Apidae |
| 27 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 28 | 8007237282 | Enterococcus sp. DIV0212c | Isolate | |
| 29 | 8017458139 | Lactobacillus johnsonii CRL1647 | Isolate | Apidae |
| 30 | 8018794549 | Enterococcus sp. 6D12_DIV0197 6D12_DIV0197 | Isolate | |
| 31 | 8018798118 | Enterococcus sp. 7D2_DIV0200 7D2_DIV0200 | Isolate | |
| 32 | 8053361298 | Streptomyces formicae 1H-GS9 | Isolate | Unclassified |
| 33 | 8061039349 | Bacillus thuringiensis sv. galleriae BGSC 4G4 | Isolate | Bombycidae |
| 34 | 8066802609 | Apilactobacillus timberlakei HV_09 | Isolate | Halictidae |
| 35 | 2825804107 | Enterococcus durans BDGP3 | Isolate | Drosophilidae |
| 36 | 2848356102 | Xylanimonas allomyrinae 2JSPR-7 | Isolate | Scarabaeidae |
| 37 | 2850695442 | Lactococcus allomyrinae 1JSPR-7 | Isolate | Scarabaeidae |
| 38 | 2855361764 | Lysinibacillus fusiformis Juneja | Isolate | Drosophilidae |
| 39 | 2864909992 | Bacillus velezensis S00166 | Isolate | Elmidae |
| 40 | 2881902429 | Companilactobacillus metriopterae JCM 31635 | Isolate | Unclassified |
| 41 | 2896955351 | Streptomyces sp. GF20 | Isolate | Termitidae |
| 42 | 2940343849 | Breznakia sp. PH5-24 | Isolate | Blattidae |
| 43 | 2940352027 | Breznakia sp. PH1-1 | Isolate | Blattidae |
| 44 | 2940400224 | Paenibacillus sp. PastM-2 | Isolate | Blattidae |
| 45 | 2958885890 | Lactobacillus sp. ESL0234 | Isolate | Apidae |
| 46 | 2961465228 | Lactobacillus sp. ESL0233 | Isolate | Apidae |
| 47 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 48 | 8114555646 | Enterococcus sp. DIV1094 | Isolate | |
| 49 | 8118997823 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 50 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 51 | 2585428141 | Pilibacter termitis ATCC BAA-1030 | Isolate | Rhinotermitidae |
| 52 | 2595698190 | Melissococcus plutonius 21.1 | Isolate | Apidae |
| 53 | 2627853628 | Melissococcus plutonius 82 | Isolate | Apidae |
| 54 | 2758568504 | Lactobacillus bombicola ESL0245 | Isolate | Unclassified |
| 55 | 2758568515 | Lactobacillus melliventris ESL0259 | Isolate | Unclassified |
| 56 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 57 | 2775507073 | Enterococcus sp. CR-Ec1 | Isolate | Unclassified |
| 58 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 59 | 2818991478 | Micromonospora palomenae DSM 102131 | Isolate | Pentatomidae |
| 60 | 2969145278 | Bacillus cereus 29 | Isolate | Portunidae |
| 61 | 3006461590 | Streptomyces sp. RB5 | Isolate | Termitidae |
| 62 | 3006667155 | Streptomyces sp. SID9727 | Isolate | |
| 63 | 3300007224 | Drosophila gut microbial communities from New York, USA - Drosophila melanogaster male 3 gut | Metagenome | Unclassified |
| 64 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 65 | 3300012806 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E1 MG | Metagenome | |
| 66 | 3300012809 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG | Metagenome | |
| 67 | 3300012812 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E11 MG | Metagenome | Culicidae |
| 68 | 3300012832 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E6 MG | Metagenome | Culicidae |
| 69 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 70 | 8061100935 | Bacillus thuringiensis sv. japonensis 62 | Isolate | |
| 71 | 8064008355 | Heyndrickxia oleronia | Isolate | Unclassified |
| 72 | 8082023105 | Niallia sp. Man26 | Isolate | Penaeidae |
| 73 | 2820809073 | Unclassified Actinobacteria Nt197P3bin55 | Isolate | Unclassified |
| 74 | 2852337885 | Paenibacillus protaetiae FW100M-2 | Isolate | Scarabaeidae |
| 75 | 2864816158 | Priestia aryabhattai S00060 | Isolate | Elmidae |
| 76 | 2864981449 | Sporosarcina sp. S00266 | Isolate | Elmidae |
| 77 | 2884351759 | Cellulosimicrobium sp. BI34T | Isolate | Pyralidae |
| 78 | 2900368070 | Nocardia aurantia RB56 | Isolate | Termitidae |
| 79 | 2940339133 | Breznakia sp. PF5-3 | Isolate | Blattidae |
| 80 | 2940361758 | Breznakia sp. PFB1-14 | Isolate | Blattidae |
| 81 | 2940380068 | Paenibacillus sp. PastH-2 | Isolate | Blattidae |
| 82 | 2940413413 | Paenibacillus sp. PastH-3 | Isolate | Blattidae |
| 83 | 2505679068 | Isoptericola variabilis 225 | Isolate | Unclassified |
| 84 | 2595698194 | Melissococcus plutonius 90.0 | Isolate | Apidae |
| 85 | 2595698195 | Melissococcus plutonius 119 | Isolate | Apidae |
| 86 | 2645727721 | Lactobacillus helsingborgensis Bma5 | Isolate | Unclassified |
| 87 | 2758568505 | Lactobacillus bombicola ESL0225 | Isolate | Unclassified |
| 88 | 2758568514 | Lactobacillus kullabergensis ESL0261 | Isolate | Unclassified |
| 89 | 2767802234 | Cytobacillus kochii BDGP4 | Isolate | Drosophilidae |
| 90 | 2978778678 | Bacillus cereus 25 | Isolate | Ocypodidae |
| 91 | 2979949929 | Lactobacillus sp. ESL0263 | Isolate | Apidae |
| 92 | 2997944163 | Streptococcus penaeicida CAIM 1838 | Isolate | Unclassified |
| 93 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 94 | 3300012834 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG | Metagenome | |
| 95 | 3300012857 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG | Metagenome | Culicidae |
| 96 | 3300021227 | Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA | Metatranscriptome | Termitidae |
| 97 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 98 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 99 | 8007223943 | Enterococcus sp. MSG2901 | Isolate | |
| 100 | 8012112996 | Staphylococcus muscae ATCC 49910 | Isolate | |
| 101 | 8017536074 | Lactobacillus sp. ESL0261 | Isolate | Apidae |
| 102 | 8018750880 | Enterococcus sp. 12E11_DIV0728 12E11_DIV0728 | Isolate | |
| 103 | 8018802046 | Enterococcus sp. 7E2_DIV0204 7E2_DIV0204 | Isolate | Gomphidae |
| 104 | 8043041867 | Bacillus pumilus Ha06YP001 | Isolate | Nephropidae |
| 105 | 8066795793 | Apilactobacillus timberlakei HV_10 | Isolate | Halictidae |
| 106 | 8066799369 | Apilactobacillus timberlakei HV_02 | Isolate | Halictidae |
| 107 | 8077783556 | Streptomyces sp. PLM4 | Isolate | Formicidae |
| 108 | 2820926697 | Unclassified Actinobacteria Emb289P3bin125 | Isolate | Unclassified |
| 109 | 2822450720 | Bacillus toyonensis AFS052650 | Isolate | Scarabaeidae |
| 110 | 2864782175 | Bacillus toyonensis S00025 | Isolate | Elmidae |
| 111 | 2873584433 | Vagococcus coleopterorum HDW17A | Isolate | Dytiscidae |
| 112 | 2873586004 | Sanguibacter sp. HDW7 | Isolate | Hydrophilidae |
| 113 | 2878857142 | Lactococcus lactis DmW198 | Isolate | Drosophilidae |
| 114 | 2936628749 | Apilactobacillus quenuiae HV_6 | Isolate | Halictidae |
| 115 | 2940368928 | Breznakia sp. PFB2-30 | Isolate | Blattidae |
| 116 | 2940406939 | Paenibacillus sp. PastM-3 | Isolate | Blattidae |
| 117 | 2956930723 | Bombilactobacillus bombi LV-8.1 | Isolate | Apidae |
| 118 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 119 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 120 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 121 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 122 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 123 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 124 | 2209111004 | Macrotermes natalensis queen gut microbiome | Metagenome | Termitidae |
| 125 | 2504756063 | Isoptericola variabilis J5 | Isolate | Unclassified |
| 126 | 2595698193 | Melissococcus plutonius B5 | Isolate | Apidae |
| 127 | 2595698196 | Melissococcus plutonius 49.3 | Isolate | Apidae |
| 128 | 2648501322 | Streptomyces sp. SA3_actF | Isolate | Unclassified |
| 129 | 2734481968 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 130 | 2758568501 | Lactobacillus bombicola ESL0228 | Isolate | Unclassified |
| 131 | 2758568502 | Lactobacillus bombicola ESL0247 | Isolate | Unclassified |
| 132 | 2758568503 | Lactobacillus bombicola ESL0246 | Isolate | Unclassified |
| 133 | 2758568511 | Lactobacillus apis ESL0263 | Isolate | Unclassified |
| 134 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 135 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 136 | 3300007153 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 3 gut | Metagenome | Drosophilidae |
| 137 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 138 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 139 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 140 | 2820416776 | Unclassified Firmicutes Lab288P3bin9 | Isolate | Unclassified |
| 141 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 142 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 143 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 144 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 145 | 3300056857 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) | Metagenome | Tenebrionidae |
| 146 | 8004832522 | Lactobacillus sp. ESL0236 | Isolate | Apidae |
| 147 | 8018754795 | Enterococcus sp. 12F9_DIV0723 12F9_DIV0723 | Isolate | |
| 148 | 8038268975 | Enterococcus mundtii EM01 | Isolate | Bombycidae |
| 149 | 8046957834 | Streptomyces coacervatus JCM 17138 | Isolate | Unclassified |
| 150 | 8066794103 | Apilactobacillus timberlakei HV_25 | Isolate | Halictidae |
| 151 | 2820901319 | Unclassified Actinobacteria Emb289P4bin58 | Isolate | Unclassified |
| 152 | 2827179085 | Paenibacillus alvei DSM 29 | Isolate | Apidae |
| 153 | 2851410423 | Lactobacillus helsingborgensis ESL0183 | Isolate | Apidae |
| 154 | 2852123468 | Lysinibacillus sphaericus KCCM 35418 | Isolate | Unclassified |
| 155 | 2852431164 | Brevibacillus laterosporus BON707 | Isolate | Calliphoridae |
| 156 | 2864985977 | Staphylococcus hominis S00278 | Isolate | Elmidae |
| 157 | 2881375749 | Vagococcus entomophilus DSM 24756 | Isolate | Vespidae |
| 158 | 2900354037 | Nocardia macrotermitis RB20 | Isolate | Termitidae |
| 159 | 2940218408 | Enterococcus sp. PF1-24 | Isolate | Blattidae |
| 160 | 2940236825 | Breznakia sp. PM6-1 | Isolate | Blattidae |
| 161 | 2940341480 | Breznakia sp. PFB2-8 | Isolate | Blattidae |
| 162 | 2940356891 | Breznakia sp. PFB1-11 | Isolate | Blattidae |
| 163 | 2940364193 | Breznakia sp. PFB1-19 | Isolate | Blattidae |
| 164 | 2940419646 | Paenibacillus sp. PastF-4 | Isolate | Blattidae |
| 165 | 2963634138 | Unclassified Bacilli bacterium PM5-3 | Isolate | Blattidae |
| 166 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 167 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 168 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 169 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 170 | 2547132081 | Streptomyces sp. S4 | Isolate | Formicidae |
| 171 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 172 | 2684622912 | Lactobacillus apis Lb_185 | Isolate | Unclassified |
| 173 | 2684622913 | Lactobacillus melliventris Lb_184 | Isolate | Unclassified |
| 174 | 2758568506 | Lactobacillus bombicola ESL0230 | Isolate | Unclassified |
| 175 | 2758568513 | Lactobacillus melliventris ESL0260 | Isolate | Unclassified |
| 176 | 2758568558 | Lactobacillus melliventris ESL0393 | Isolate | Unclassified |
| 177 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 178 | 2788499854 | Breznakia blatticola DSM 28867 | Isolate | Unclassified |
| 179 | 2799112220 | Lactobacillus sp. ESL0411 | Isolate | Unclassified |
| 180 | 2814123166 | Lactobacillus apis LMG 26964 | Isolate | Apidae |
| 181 | 2820236043 | Unclassified Firmicutes Th196P3bin97 | Isolate | Unclassified |
| 182 | 2820729191 | Unclassified Chloroflexi Th196P4bin49 | Isolate | Unclassified |
| 183 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 184 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 185 | 3300005721 | Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 | Metagenome | Apidae |
| 186 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 187 | 3300012820 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E6 MG | Metagenome | Armadillidiidae |
| 188 | 3300012861 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG | Metagenome | Culicidae |
| 189 | 3300023282 | Termite gut microbial communities from Aparatermes sp. nest - French Guiana - 29-3 mRNA | Metatranscriptome | Termitidae |
| 190 | 2820471304 | Unclassified Firmicutes Lab288P1bin89 | Isolate | Unclassified |
| 191 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 192 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 193 | 3300060775 | Metatranscriptome of mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D15_HDPE_oats_c (Metagenome Metatranscriptome) | Metatranscriptome | Tenebrionidae |
| 194 | 643886085 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 195 | 643886091 | Bacillus thuringiensis sv. thuringiensis T01001 | Isolate | Pyralidae |
| 196 | 8002299145 | Vagococcus allomyrinae BWB3-3 | Isolate | Scarabaeidae |
| 197 | 8066797744 | Apilactobacillus timberlakei HV_26 | Isolate | Halictidae |
| 198 | 8077780672 | Enterococcus sp. PLM3 | Isolate | Formicidae |
| 199 | 2820825283 | Unclassified Actinobacteria Nt197P3bin111 | Isolate | Unclassified |
| 200 | 2864801025 | Bacillus aerius S00042 | Isolate | Elmidae |
| 201 | 2877522083 | Apilactobacillus bombintestini BHWM-4 | Isolate | Apidae |
| 202 | 2883361506 | Luteimicrobium xylanilyticum HY-24 | Isolate | Cerambycidae |
| 203 | 2940354458 | Breznakia sp. PF1-11 | Isolate | Blattidae |
| 204 | 2940393498 | Paenibacillus sp. PastF-2 | Isolate | Blattidae |
| 205 | 8112490586 | Staphylococcus muscae CCM 4175 | Isolate | |
| 206 | 2523533511 | Streptomyces sp. Sv. ACTE SirexAA-E | Isolate | Siricidae |
| 207 | 2537562000 | Bacillus cereus HD73 | Isolate | Pyralidae |
| 208 | 2551306396 | Paenibacillus sp. ICGEB2008 | Isolate | Noctuidae |
| 209 | 2574180310 | Bacillus licheniformis CG-B52 | Isolate | Unclassified |
| 210 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 211 | 2731957681 | Xylanimicrobium pachnodae JCM 13526, NBRC 107786 | Isolate | Scarabaeidae |
| 212 | 2740892556 | Enterococcus sp. JR029-101 | Isolate | Unclassified |
| 213 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 214 | 2758568509 | Lactobacillus bombicola ESL0234 | Isolate | Unclassified |
| 215 | 2758568510 | Lactobacillus bombicola ESL0233 | Isolate | Unclassified |
| 216 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 217 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 218 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 219 | 3300003097 | Cutworm gut microbial communities from Hangzhou, China | Metagenome | Noctuidae |
| 220 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 221 | 8002519755 | Planococcus sp. MSAK28401 | Isolate | Euphausiidae |
| 222 | 8061045771 | Bacillus thuringiensis sv. kurstaki BGSC 4D1 | Isolate | Bombycidae |
| 223 | 8108568626 | Enterococcus sp. DIV1094 | Isolate | |
| 224 | 8108576847 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 225 | 2820899690 | Unclassified Actinobacteria Emb289P4bin9 | Isolate | Unclassified |
| 226 | 2852016966 | Micromonospora polyrhachis DSM 45886 | Isolate | Unclassified |
| 227 | 2882334426 | Lactobacillus sp. 2-3 | Isolate | Unclassified |
| 228 | 2900804455 | Listeria sp. PSOL-1 Marseille-P4284 | Isolate | Unclassified |
| 229 | 2917496769 | Staphylococcus muscae DSM 7068 | Isolate | Unclassified |
| 230 | 2940261461 | Enterococcus sp. PFB1-1 | Isolate | Blattidae |
| 231 | 2940359323 | Breznakia sp. PFB1-12 | Isolate | Blattidae |
| 232 | 2940366561 | Breznakia sp. PFB1-4 | Isolate | Blattidae |
| 233 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 234 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 235 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 236 | 8114549044 | Enterococcus sp. 9D6_DIV0238 9D6_DIV0238 | Isolate | |
| 237 | 8118075156 | Actinosynnema pretiosum DSM 44131 | Isolate | Unclassified |
| 238 | 2524614537 | Lysinibacillus sphaericus OT4b.31 | Isolate | Unclassified |
| 239 | 2595698198 | Melissococcus plutonius L9 | Isolate | Apidae |
| 240 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 241 | 2675903377 | Apilactobacillus kunkeei AR114 | Isolate | Unclassified |
| 242 | 2751185832 | Lysinibacillus sp. AR18-8 | Isolate | Unclassified |
| 243 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 244 | 2785510748 | Lactobacillus sp. ESL0409 | Isolate | Apidae |
| 245 | 2799112229 | Lactobacillus sp. ESL0413 | Isolate | Unclassified |
| 246 | 2799112230 | Lactobacillus sp. ESL0416 | Isolate | Unclassified |
| 247 | 2971438493 | Paenibacillus apiarius NRRL B-23460 | Isolate | Apidae |
| 248 | 3006468911 | Streptomyces sp. RB17 | Isolate | Termitidae |
| 249 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 250 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 251 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 252 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 253 | 647533136 | Enterococcus faecalis Fly1 | Isolate | Drosophilidae |
| 254 | 8007220153 | Enterococcus sp. BWB1-3 | Isolate | Scarabaeidae |
| 255 | 8017440191 | Lactobacillus bombicola L5-31 | Isolate | Apidae |
| 256 | 8017462664 | Lactobacillus melliventris ESL0184 | Isolate | Apidae |
| 257 | 8030347546 | Propionimicrobium sp. PCR01-08-3 | Isolate | Tenebrionidae |
| 258 | 2820897376 | Unclassified Actinobacteria Lab288P1bin101 | Isolate | Unclassified |
| 259 | 2822232166 | Bacillus toyonensis AFS084242 | Isolate | Scarabaeidae |
| 260 | 2877513988 | Lactobacillus kullabergensis ESL0186 | Isolate | Apidae |
| 261 | 2890957088 | Psychrobacillus lasiicapitis NEAU-3TGS17 | Isolate | Formicidae |
| 262 | 2908241010 | Streptomyces sp. HF10 | Isolate | Termitidae |
| 263 | 2912817845 | Streptomyces griseus SID164 | Isolate | |
| 264 | 2923762712 | Apilactobacillus micheneri Hlig3 | Isolate | Halictidae |
| 265 | 2940386776 | Paenibacillus sp. PastF-1 | Isolate | Blattidae |
| 266 | 2961515617 | Lactobacillus sp. ESL0259 | Isolate | Apidae |
| 267 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 268 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 269 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 270 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 271 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 272 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 273 | 8114541043 | Enterococcus sp. 7F3_DIV0205 7F3_DIV0205 | Isolate | Libellulidae |
| 274 | 2515154106 | Streptomyces sp. FxanaD5 | Isolate | Unclassified |
| 275 | 2558860143 | Apilactobacillus kunkeei EFB6 | Isolate | Apidae |
| 276 | 2563367190 | Bacillus thuringiensis sv. aizawai Leapi01 | Isolate | Noctuidae |
| 277 | 2595698197 | Melissococcus plutonius H6 | Isolate | Apidae |
| 278 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 279 | 2772190761 | Rhodococcus rhodnii NRRL B-16535 | Isolate | Unclassified |
| 280 | 2791355481 | Bacillus sp. ZY-1-1 | Isolate | Scarabaeidae |
| 281 | 2820215626 | Unclassified Kiritimatiellaeota Nt197P3bin123 | Isolate | Unclassified |
| 282 | 2820217359 | Unclassified Kiritimatiellaeota Nt197P3bin101 | Isolate | Unclassified |
| 283 | 2820301196 | Unclassified Firmicutes Th196P1bin8 | Isolate | Unclassified |
| 284 | 2983866074 | Paenibacillus polymyxa A18 | Isolate | Unclassified |
| 285 | 2989426036 | Spiroplasma platyhelix PALS-1 | Isolate | Unclassified |
| 286 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 287 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 288 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 289 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 290 | 3300005317 | Drosophila gut microbial communities from New York, USA - Drosophila putrida male 2 gut | Metagenome | Drosophilidae |
| 291 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 292 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 293 | 3300007088 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 4 gut | Metagenome | Drosophilidae |
| 294 | 650716050 | Melissococcus plutonius ATCC 35311 | Isolate | Unclassified |
| 295 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 296 | 8022725327 | Bacillus sp. SN10 | Isolate | Eresidae |
| 297 | 8022781829 | Bacillus sp. VKPM B-3276 | Isolate | Culicidae |
| 298 | 8066790652 | Apilactobacillus timberlakei HV_28 | Isolate | Halictidae |
| 299 | 8066792404 | Apilactobacillus timberlakei HV_04 | Isolate | Halictidae |
| 300 | 2843246524 | Lysinibacillus sphaericus DSM 28 | Isolate | Unclassified |
| 301 | 2851412233 | Bombilactobacillus bombi BI-2.5 | Isolate | Apidae |
| 302 | 2862784999 | Streptomyces sp. M41 | Isolate | Unclassified |
| 303 | 2863397684 | Micromonospora polyrhachis DSM 45886 (Annotation) (version 2) | Isolate | Unclassified |
| 304 | 2864895409 | Bacillus aerius S00152 | Isolate | Elmidae |
| 305 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 306 | 2912324399 | Lactobacillus apis ESL0185 | Isolate | Apidae |
| 307 | 2916858470 | Heyndrickxia oleronia | Isolate | Unclassified |
| 308 | 2916873227 | Bacillus thuringiensis sv. berliner ATCC 10792 | Isolate | Pyralidae |
| 309 | 2940221333 | Paenibacillus sp. PastF-3 | Isolate | Blattidae |
| 310 | 2940425923 | Paenibacillus sp. PastH-4 | Isolate | Blattidae |
| 311 | 2963635624 | Unclassified Bacilli bacterium PM5-9 | Isolate | Blattidae |
| 312 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 313 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 314 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0562376_4501 | 3300056857 | Bacteria | 11347 |
| 2 | Ga0590799_10281 | 3300060775 | Bacteria | 807 |
| 3 | Ga0466730_086863 | 3300042625 | Bacteria | 4535 |
| 4 | Ga0160456_110753 | 3300012820 | Bacteria | 942 |
| 5 | Ga0160435_1005671 | 3300012857 | Bacteria | 2807 |
| 6 | Ga0223687_100094 | 3300021217 | Bacteria | 12922 |
| 7 | Ga0255808_1000340 | 3300023282 | Bacteria | 3082 |
| 8 | Ga0466690_302022 | 3300042590 | Bacteria | 1736 |
| 9 | Ga0123357_10108130 | 3300009784 | Bacteria | 3558 |
| 10 | Ga0123356_11787598 | 3300010049 | Unclassified | 764 |
| 11 | Ga0123354_10263339 | 3300010882 | Bacteria | 1716 |
| 12 | 2212886490 | 2209111004 | Bacteria | 17554 |
| 13 | 2227507956 | 2225789004 | Bacteria | 66298 |
| 14 | AustNasuHG_c1066938 | 3300000089 | Unclassified | 665 |
| 15 | Ga0072940_1342690 | 3300005200 | Unclassified | 525 |
| 16 | Ga0466733_006507 | 3300042659 | Bacteria | 7219 |
| 17 | Ga0530661_000008 | 3300056564 | Bacteria | 327436 |
| 18 | Ga0562379_1450 | 3300056790 | Unclassified | 26930 |
| 19 | Ga0562378_0002 | 3300056814 | Bacteria | 3519472 |
| 20 | Ga0562376_0011 | 3300056857 | Bacteria | 876793 |
| 21 | Ga0466730_055372 | 3300042625 | Unclassified | 1236 |
| 22 | Ga0466725_321089 | 3300042654 | Bacteria | 1954 |
| 23 | Ga0415639_068661 | 3300038395 | Unclassified | 3636 |
| 24 | Ga0466712_105311 | 3300042614 | Bacteria | 19617 |
| 25 | Ga0123355_10290095 | 3300009826 | Bacteria | 2246 |
| 26 | Ga0123356_10000101 | 3300010049 | Bacteria | 90121 |
| 27 | Ga0123356_10015115 | 3300010049 | Bacteria | 7402 |
| 28 | Ga0123356_10133250 | 3300010049 | Bacteria | 2438 |
| 29 | Ga0123356_10936628 | 3300010049 | Unclassified | 1037 |
| 30 | Ga0466706_140589 | 3300042599 | Bacteria | 4364 |
| 31 | Ga0466707_302603 | 3300042601 | Bacteria | 62986 |
| 32 | Ga0466713_080378 | 3300042602 | Bacteria | 107053 |
| 33 | GhopperDRAF_NODE_227854_len_5198_cov_6_873797 | 2035265001 | Unclassified | 5228 |
| 34 | JGI24702J35022_10269540 | 3300002462 | Bacteria | 996 |
| 35 | JGI24699J35502_11084317 | 3300002509 | Bacteria | 2024 |
| 36 | Ga0052191_103085 | 3300003097 | Unclassified | 2862 |
| 37 | Ga0068305_11030627 | 3300005083 | Bacteria | 1285 |
| 38 | Ga0072940_1043960 | 3300005200 | Bacteria | 547 |
| 39 | Ga0072940_1088023 | 3300005200 | Bacteria | 3651 |
| 40 | Ga0074278_150002 | 3300005721 | Unclassified | 1105 |
| 41 | Ga0104050_1208947 | 3300007153 | Bacteria | 1043 |
| 42 | Ga0104147_1065731 | 3300007224 | Bacteria | 6503 |
| 43 | Ga0466733_025245 | 3300042659 | Bacteria | 172347 |
| 44 | Ga0160436_1000497 | 3300012861 | Unclassified | 14828 |
| 45 | Ga0255808_1015762 | 3300023282 | Bacteria | 3377 |
| 46 | Ga0466692_176196 | 3300042591 | Unclassified | 1169 |
| 47 | Ga0466696_293106 | 3300042596 | Bacteria | 1036 |
| 48 | Ga0123356_10051797 | 3300010049 | Bacteria | 3819 |
| 49 | Ga0123356_12924537 | 3300010049 | Unclassified | 597 |
| 50 | Ga0123353_10172445 | 3300010167 | Unclassified | 3432 |
| 51 | Ga0160442_100131 | 3300012806 | Unclassified | 75763 |
| 52 | Ga0466707_175608 | 3300042601 | Bacteria | 13441 |
| 53 | Ga0466698_337436 | 3300042610 | Bacteria | 1590 |
| 54 | 2227524329 | 2225789004 | Unclassified | 653 |
| 55 | IMNBL1DRAFT_c0000629 | 3300000062 | Bacteria | 28167 |
| 56 | JGI24702J35022_10006179 | 3300002462 | Bacteria | 6940 |
| 57 | JGI24699J35502_11127257 | 3300002509 | Bacteria | 4115 |
| 58 | Ga0466732_127839 | 3300042656 | Bacteria | 4125 |
| 59 | Ga0530661_164822 | 3300056564 | Bacteria | 579 |
| 60 | Ga0466731_335232 | 3300042622 | Unclassified | 2726 |
| 61 | Ga0466702_228499 | 3300042635 | Unclassified | 4022 |
| 62 | Ga0466693_213355 | 3300042592 | Unclassified | 1432 |
| 63 | Ga0466691_105136 | 3300042593 | Bacteria | 11830 |
| 64 | Ga0466694_073322 | 3300042594 | Unclassified | 4664 |
| 65 | Ga0466710_042397 | 3300042613 | Unclassified | 1355 |
| 66 | Ga0466710_372862 | 3300042613 | Bacteria | 1592 |
| 67 | Ga0466718_016351 | 3300042617 | Bacteria | 1635 |
| 68 | Ga0123353_10638132 | 3300010167 | Unclassified | 1511 |
| 69 | Ga0466707_273021 | 3300042601 | Bacteria | 1834 |
| 70 | Ga0466721_203951 | 3300042608 | Bacteria | 12739 |
| 71 | AustNasuHG_c1003476 | 3300000089 | Unclassified | 5688 |
| 72 | AustNasuHG_c1020243 | 3300000089 | Bacteria | 2170 |
| 73 | JGI24699J35502_10268183 | 3300002509 | Bacteria | 507 |
| 74 | Ga0223688_1044049 | 3300021227 | Unclassified | 1312 |
| 75 | Ga0466692_180088 | 3300042591 | Bacteria | 1525 |
| 76 | Ga0466693_352601 | 3300042592 | Bacteria | 5048 |
| 77 | Ga0466710_143511 | 3300042613 | Bacteria | 1252 |
| 78 | Ga0466711_427785 | 3300042615 | Bacteria | 1564 |
| 79 | Ga0123355_11573523 | 3300009826 | Bacteria | 635 |
| 80 | Ga0160466_100074 | 3300012809 | Bacteria | 108538 |
| 81 | Ga0466700_041154 | 3300042600 | Bacteria | 59068 |
| 82 | 2227464112 | 2225789004 | Bacteria | 5265 |
| 83 | IMNBL1DRAFT_c0000035 | 3300000062 | Bacteria | 120274 |
| 84 | Ga0052191_101302 | 3300003097 | Bacteria | 4511 |
| 85 | Ga0072940_1177338 | 3300005200 | Unclassified | 823 |
| 86 | Ga0072940_1181246 | 3300005200 | Bacteria | 1763 |
| 87 | Ga0074311_1022812 | 3300005317 | Unclassified | 524 |
| 88 | Ga0466697_203293 | 3300042611 | Bacteria | 2666 |
| 89 | Ga0466724_02361 | 3300042649 | Bacteria | 34785 |
| 90 | Ga0466727_281726 | 3300042655 | Bacteria | 41168 |
| 91 | Ga0466657_181717 | 3300042582 | Bacteria | 1620 |
| 92 | Ga0466694_045907 | 3300042594 | Bacteria | 14153 |
| 93 | Ga0466728_452942 | 3300042620 | Bacteria | 39308 |
| 94 | Ga0123356_10074580 | 3300010049 | Unclassified | 3193 |
| 95 | Ga0123356_10788528 | 3300010049 | Unclassified | 1121 |
| 96 | Ga0123356_10813949 | 3300010049 | Bacteria | 1105 |
| 97 | Ga0123356_11556427 | 3300010049 | Bacteria | 817 |
| 98 | Ga0123356_13129336 | 3300010049 | Bacteria | 577 |
| 99 | Ga0123353_10000786 | 3300010167 | Bacteria | 38674 |
| 100 | Ga0123353_10488355 | 3300010167 | Unclassified | 1799 |
| 101 | Ga0123353_11877871 | 3300010167 | Bacteria | 740 |
| 102 | Ga0466706_175288 | 3300042599 | Bacteria | 3442 |
| 103 | Ga0466706_193746 | 3300042599 | Unclassified | 1984 |
| 104 | Ga0466707_080865 | 3300042601 | Bacteria | 320076 |
| 105 | Ga0466722_240797 | 3300042609 | Bacteria | 12349 |
| 106 | 2227334419 | 2225789004 | Bacteria | 1167 |
| 107 | HBC_ctgsDRAFT_1113117 | 3300000333 | Bacteria | 620 |
| 108 | JGI24702J35022_10001355 | 3300002462 | Bacteria | 15206 |
| 109 | Ga0074278_153159 | 3300005721 | Unclassified | 8715 |
| 110 | Ga0104047_1122724 | 3300007088 | Bacteria | 1031 |
| 111 | Ga0466697_085137 | 3300042611 | Bacteria | 1486 |
| 112 | Ga0466733_189005 | 3300042659 | Bacteria | 2529 |
| 113 | Ga0562378_0039 | 3300056814 | Bacteria | 444185 |
| 114 | Ga0562376_0381 | 3300056857 | Bacteria | 84233 |
| 115 | Ga0466734_119789 | 3300042623 | Bacteria | 17928 |
| 116 | Ga0466734_165799 | 3300042623 | Bacteria | 1539 |
| 117 | Ga0466730_011725 | 3300042625 | Bacteria | 8736 |
| 118 | Ga0466702_002868 | 3300042635 | Bacteria | 60427 |
| 119 | Ga0466724_29488 | 3300042649 | Bacteria | 2715 |
| 120 | Ga0160434_100001 | 3300012850 | Bacteria | 617314 |
| 121 | Ga0466657_291877 | 3300042582 | Bacteria | 2136 |
| 122 | Ga0466693_054211 | 3300042592 | Bacteria | 1506 |
| 123 | Ga0466693_110507 | 3300042592 | Bacteria | 60686 |
| 124 | Ga0466693_353530 | 3300042592 | Bacteria | 63745 |
| 125 | Ga0466694_384803 | 3300042594 | Unclassified | 3011 |
| 126 | Ga0466699_092558 | 3300042597 | Bacteria | 14678 |
| 127 | Ga0123356_11305313 | 3300010049 | Bacteria | 889 |
| 128 | Ga0160471_109349 | 3300012812 | Unclassified | 1106 |
| 129 | Ga0466707_221470 | 3300042601 | Bacteria | 71824 |
| 130 | 2227579352 | 2225789004 | Bacteria | 2526 |
| 131 | JGI24702J35022_10236341 | 3300002462 | Bacteria | 1058 |
| 132 | JGI24703J35330_11745970 | 3300002501 | Bacteria | 4893 |
| 133 | JGI24696J40584_12960731 | 3300002834 | Bacteria | 8246 |
| 134 | Ga0068302_10003269 | 3300005071 | Bacteria | 26234 |
| 135 | Ga0072941_1015007 | 3300005201 | Bacteria | 54434 |
| 136 | Ga0074278_102385 | 3300005721 | Unclassified | 1377 |
| 137 | Ga0562375_0511 | 3300056856 | Bacteria | 79486 |
| 138 | Ga0562376_2522 | 3300056857 | Bacteria | 21571 |
| 139 | Ga0466734_061199 | 3300042623 | Unclassified | 1783 |
| 140 | Ga0466735_023118 | 3300042624 | Bacteria | 12000 |
| 141 | Ga0160458_111123 | 3300012832 | Unclassified | 999 |
| 142 | Ga0160452_100013 | 3300012834 | Bacteria | 343612 |
| 143 | Ga0160447_119197 | 3300012849 | Bacteria | 1140 |
| 144 | Ga0123356_10075827 | 3300010049 | Bacteria | 3168 |
| 145 | Ga0123353_10061824 | 3300010167 | Bacteria | 6007 |
| 146 | Ga0123353_10696053 | 3300010167 | Bacteria | 1428 |
| 147 | Ga0123354_10934409 | 3300010882 | Bacteria | 565 |
| 148 | Ga0466706_026885 | 3300042599 | Bacteria | 6178 |
| 149 | Ga0466706_174853 | 3300042599 | Bacteria | 1896 |
| 150 | Ga0466707_031260 | 3300042601 | Bacteria | 71521 |
| 151 | 2227264135 | 2225789004 | Bacteria | 6971 |
| 152 | AustNasuHG_c1068534 | 3300000089 | Unclassified | 649 |
| 153 | JGI24700J35501_10649385 | 3300002508 | Unclassified | 1033 |
| 154 | JGI24700J35501_10930786 | 3300002508 | Bacteria | 23988 |
| 155 | Ga0074304_1168467 | 3300005319 | Bacteria | 693 |
| 156 | Ga0074278_145589 | 3300005721 | Bacteria | 4691 |
Family Sequences
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00253 | Ribosomal_S14 | Ribosomal protein S14p/S29e | 21 | 71 | 0.94 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.54 | 0.79 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.