Protein Family IF02984

Metagenome Metatranscriptome Isolate
139 Members
54 Samples
136 Scaffolds
121 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_11785696|Ga0123356_117856962
Length
143 aa
Sequence
VLICIIRGQKNNSGQKSMKVPENYYDEIVDFKGQWDIPSKCGLKIIHKADKVYVIVTELYQDNPGTSVTSTGKSLARQICEKKGLSLSEIVYLECTPDTNSVLSFYDEQYFEVKFNDAPQANYRKLSKEEIEYLFSKQIVVN*

📊 Sample Types

Isolate 2.2%
Metagenome 97.1%
MAG 0.0%
Metatranscriptome 0.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 58.8%
Kalotermitidae 21.6%
Termopsidae 7.8%
Unclassified 7.8%
Rhinotermitidae 3.9%

🌳 Taxonomy

Archaea 0
Bacteria 123
Eukaryota 0
Viruses 2
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
7 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
10 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
11 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
14 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
15 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
16 3300022815 Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA Metatranscriptome Termitidae
17 2820744581 Unclassified Bacteroidetes Th196P3bin138 Isolate Unclassified
18 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
21 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
26 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
29 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
33 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
34 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
41 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
42 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
43 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
44 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
45 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
46 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
47 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
48 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
49 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
50 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
51 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
52 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
53 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
54 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466697_140857 3300042611 Bacteria 2226
2 Ga0466691_048075 3300042593 Bacteria 30498
3 Ga0466691_091283 3300042593 Bacteria 7557
4 Ga0466696_185438 3300042596 Bacteria 2052
5 Ga0123356_10682730 3300010049 Unclassified 1195
6 Ga0123353_10076180 3300010167 Bacteria 5390
7 Ga0123354_10444050 3300010882 Bacteria 1057
8 Ga0466711_365823 3300042615 Bacteria 13020
9 Ga0466715_027055 3300042616 Bacteria 11928
10 Ga0466718_037319 3300042617 Bacteria 1334
11 Ga0466722_110753 3300042609 Bacteria 2101
12 Ga0466698_476265 3300042610 Bacteria 1821
13 Ga0466724_41023 3300042649 Bacteria 2640
14 Ga0466724_57967 3300042649 Bacteria 3147
15 Ga0466708_019893 3300042652 Bacteria 1021
16 Ga0466727_142648 3300042655 Bacteria 12844
17 AustNasuHG_c1010805 3300000089 Bacteria 3173
18 JGI24695J34938_10034107 3300002450 Bacteria 2337
19 JGI24702J35022_10005933 3300002462 Bacteria 7097
20 JGI24702J35022_10006606 3300002462 Bacteria 6697
21 Ga0072940_1182900 3300005200 Bacteria 901
22 Ga0264413_103494 3300024493 Bacteria 3101
23 Ga0264413_113519 3300024493 Bacteria 6821
24 Ga0415639_191766 3300038395 Unclassified 1694
25 Ga0466690_040754 3300042590 Bacteria 5499
26 Ga0466690_079774 3300042590 Bacteria 1153
27 Ga0123353_10051409 3300010167 Bacteria 6575
28 Ga0123353_10556139 3300010167 Bacteria 1653
29 Ga0466712_034896 3300042614 Bacteria 3993
30 Ga0466712_271233 3300042614 Bacteria 3175
31 Ga0466718_034661 3300042617 Bacteria 2296
32 Ga0466718_079204 3300042617 Bacteria 21805
33 Ga0466723_188937 3300042618 Bacteria 2356
34 Ga0466723_277765 3300042618 Bacteria 43175
35 Ga0466722_025054 3300042609 Bacteria 2458
36 Ga0466722_167053 3300042609 Bacteria 50948
37 Ga0466731_358898 3300042622 Bacteria 87251
38 Ga0466702_339734 3300042635 Unclassified 1062
39 AustNasuHG_c1037672 3300000089 Bacteria 1231
40 JGI24698J34947_10032574 3300002449 Bacteria 2736
41 JGI24695J34938_10026177 3300002450 Bacteria 2775
42 JGI24695J34938_10321583 3300002450 Bacteria 673
43 Ga0072941_1160353 3300005201 Bacteria 1642
44 Ga0466697_167564 3300042611 Bacteria 10903
45 Ga0466732_255026 3300042656 Bacteria 2704
46 Ga0466692_111092 3300042591 Bacteria 21683
47 Ga0466692_169104 3300042591 Bacteria 5326
48 Ga0466693_312080 3300042592 Unclassified 1762
49 Ga0123356_12980349 3300010049 Bacteria 591
50 Ga0123353_10349541 3300010167 Unclassified 2228
51 Ga0123354_10089666 3300010882 Bacteria 4265
52 Ga0123354_10161060 3300010882 Bacteria 2663
53 Ga0123354_10468165 3300010882 Bacteria 1006
54 Ga0466712_014792 3300042614 Bacteria 30692
55 Ga0466715_487890 3300042616 Bacteria 3008
56 Ga0466718_052764 3300042617 Bacteria 4738
57 Ga0466726_233939 3300042619 Bacteria 1988
58 Ga0466726_430822 3300042619 Bacteria 1936
59 Ga0466714_164296 3300042603 Bacteria 6223
60 Ga0466720_002785 3300042607 Bacteria 44479
61 Ga0466720_003238 3300042607 Bacteria 32291
62 Ga0466720_045187 3300042607 Bacteria 27687
63 Ga0466722_051355 3300042609 Bacteria 31148
64 Ga0466727_132810 3300042655 Bacteria 2753
65 AustNasuHG_c1001192 3300000089 Bacteria 9352
66 AustNasuHG_c1022822 3300000089 Bacteria 2005
67 FAAS_10846545 3300001880 Unclassified 532
68 Ga0072941_1026429 3300005201 Bacteria 1663
69 Ga0255786_1011469 3300022815 Bacteria 882
70 Ga0466693_139447 3300042592 Bacteria 1075
71 Ga0123356_11426085 3300010049 Unclassified 852
72 Ga0123353_10146796 3300010167 Bacteria 3771
73 Ga0466718_130375 3300042617 Bacteria 7703
74 Ga0466716_479449 3300042605 Bacteria 1863
75 Ga0466719_137929 3300042606 Bacteria 1052
76 Ga0466720_015079 3300042607 Bacteria 1019
77 Ga0466720_173608 3300042607 Bacteria 13917
78 Ga0466735_135181 3300042624 Bacteria 1544
79 Ga0466704_225446 3300042643 Bacteria 1382
80 Ga0466708_372318 3300042652 Bacteria 2552
81 AustNasuHG_c1008149 3300000089 Bacteria 3716
82 JGI24695J34938_10022896 3300002450 Bacteria 3022
83 JGI24702J35022_10252387 3300002462 Bacteria 1027
84 Ga0466697_259844 3300042611 Bacteria 4749
85 Ga0466705_191068 3300042612 Bacteria 8850
86 Ga0264413_107725 3300024493 Bacteria 7350
87 Ga0264413_123403 3300024493 Bacteria 4222
88 Ga0123353_10198812 3300010167 Bacteria 3156
89 Ga0123353_10671952 3300010167 Unclassified 1461
90 Ga0466712_200131 3300042614 Bacteria 1491
91 Ga0466712_277078 3300042614 Bacteria 5282
92 Ga0466723_000425 3300042618 Bacteria 10080
93 Ga0466701_031057 3300042598 Bacteria 34075
94 Ga0466727_096862 3300042655 Bacteria 1176
95 JGI24698J34947_10059894 3300002449 Bacteria 1880
96 JGI24695J34938_10021945 3300002450 Bacteria 3111
97 JGI24696J40584_12961651 3300002834 Bacteria 28246
98 Ga0072940_1578006 3300005200 Unclassified 576
99 Ga0074263_111914 3300005485 Bacteria 4532
100 Ga0466732_099575 3300042656 Bacteria 1141
101 Ga0466733_136722 3300042659 Bacteria 1043
102 Ga0466690_079237 3300042590 Bacteria 1132
103 Ga0466699_354994 3300042597 Viruses 1981
104 Ga0123356_11745452 3300010049 Bacteria 773
105 Ga0123353_10127580 3300010167 Bacteria 4085
106 Ga0466712_038346 3300042614 Bacteria 1606
107 Ga0466712_294206 3300042614 Bacteria 2167
108 Ga0466715_087695 3300042616 Bacteria 3523
109 Ga0466720_080056 3300042607 Bacteria 10125
110 Ga0466722_053818 3300042609 Bacteria 1048
111 Ga0466702_046487 3300042635 Bacteria 1130
112 Ga0466727_118522 3300042655 Bacteria 4113
113 Ga0466727_128107 3300042655 Bacteria 1908
114 AustNasuHG_c1002848 3300000089 Bacteria 6243
115 JGI24705J35276_12094736 3300002504 Bacteria 1003
116 Ga0068302_10403436 3300005071 Bacteria 632
117 Ga0072941_1005729 3300005201 Bacteria 49202
118 Ga0072941_1164836 3300005201 Bacteria 7527
119 Ga0466732_023667 3300042656 Viruses 10678
120 Ga0466694_034728 3300042594 Bacteria 25775
121 Ga0466699_248022 3300042597 Unclassified 1801
122 Ga0123356_10533781 3300010049 Bacteria 1333
123 Ga0123356_11785696 3300010049 Unclassified 764
124 Ga0123353_10959079 3300010167 Bacteria 1155
125 Ga0466705_407560 3300042612 Bacteria 2290
126 Ga0466700_008228 3300042600 Unclassified 1224
127 Ga0466713_089653 3300042602 Bacteria 17686
128 Ga0466727_210513 3300042655 Bacteria 1195
129 JGI24695J34938_10000301 3300002450 Bacteria 48723
130 Ga0466693_118798 3300042592 Bacteria 2281
131 Ga0466694_333161 3300042594 Bacteria 2068
132 Ga0466699_178162 3300042597 Bacteria 26425
133 Ga0466699_402468 3300042597 Unclassified 2467
134 Ga0466710_265251 3300042613 Bacteria 1275
135 Ga0466731_379035 3300042622 Bacteria 3170
136 JGI24705J35276_12001154 3300002504 Unclassified 849

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300001880 FAAS_10846545 FAAS_108465452 96
2 3300024493 Ga0264413_103494 Ga0264413_1034944 115
3 3300042607 Ga0466720_080056 Ga0466720_080056_7428_7775 115
4 3300042592 Ga0466693_312080 Ga0466693_312080_310_660 116
5 3300042597 Ga0466699_248022 Ga0466699_248022_1136_1486 116
6 3300042597 Ga0466699_354994 Ga0466699_354994_732_1082 116
7 3300042609 Ga0466722_053818 Ga0466722_053818_550_900 116
8 3300042614 Ga0466712_277078 Ga0466712_277078_3939_4289 116
9 3300005201 Ga0072941_1026429 Ga0072941_10264292 117
10 3300010167 Ga0123353_10671952 Ga0123353_106719522 117
11 3300010882 Ga0123354_10468165 Ga0123354_104681652 117
12 3300042597 Ga0466699_178162 Ga0466699_178162_21778_22131 117
13 3300042607 Ga0466720_045187 Ga0466720_045187_17568_17921 117
14 3300042609 Ga0466722_025054 Ga0466722_025054_1657_2010 117
15 3300042609 Ga0466722_110753 Ga0466722_110753_796_1149 117
16 3300042655 Ga0466727_118522 Ga0466727_118522_2994_3347 117
17 3300005201 Ga0072941_1005729 Ga0072941_100572939 118
18 3300042617 Ga0466718_037319 Ga0466718_037319_445_801 118
19 3300042617 Ga0466718_130375 Ga0466718_130375_3736_4092 118
20 3300000089 AustNasuHG_c1037672 AustNasuHG_10376722 119
21 3300002450 JGI24695J34938_10000301 JGI24695J34938_1000030134 119
22 3300010049 Ga0123356_10533781 Ga0123356_105337813 119
23 3300010049 Ga0123356_11426085 Ga0123356_114260851 119
24 3300010167 Ga0123353_10076180 Ga0123353_100761802 119
25 3300010167 Ga0123353_10146796 Ga0123353_101467964 119
26 3300010167 Ga0123353_10556139 Ga0123353_105561393 119
27 3300010167 Ga0123353_10959079 Ga0123353_109590792 119
28 3300024493 Ga0264413_123403 Ga0264413_1234032 119
29 3300042590 Ga0466690_079774 Ga0466690_079774_362_721 119
30 3300042592 Ga0466693_118798 Ga0466693_118798_806_1165 119
31 3300042594 Ga0466694_034728 Ga0466694_034728_3033_3392 119
32 3300042594 Ga0466694_333161 Ga0466694_333161_183_542 119
33 3300042598 Ga0466701_031057 Ga0466701_031057_13625_13984 119
34 3300042603 Ga0466714_164296 Ga0466714_164296_2223_2582 119
35 3300042607 Ga0466720_173608 Ga0466720_173608_5332_5691 119
36 3300042609 Ga0466722_167053 Ga0466722_167053_47165_47524 119
37 3300042610 Ga0466698_476265 Ga0466698_476265_1369_1728 119
38 3300042611 Ga0466697_167564 Ga0466697_167564_4180_4539 119
39 3300042611 Ga0466697_259844 Ga0466697_259844_3345_3704 119
40 3300042612 Ga0466705_407560 Ga0466705_407560_1735_2094 119
41 3300042613 Ga0466710_265251 Ga0466710_265251_166_525 119
42 3300042614 Ga0466712_038346 Ga0466712_038346_39_398 119
43 3300042616 Ga0466715_027055 Ga0466715_027055_9689_10048 119
44 3300042618 Ga0466723_000425 Ga0466723_000425_2557_2916 119
45 3300042618 Ga0466723_188937 Ga0466723_188937_862_1221 119
46 3300042622 Ga0466731_358898 Ga0466731_358898_10580_10939 119
47 3300042624 Ga0466735_135181 Ga0466735_135181_59_418 119
48 3300042649 Ga0466724_41023 Ga0466724_41023_902_1261 119
49 3300042649 Ga0466724_57967 Ga0466724_57967_381_740 119
50 3300042655 Ga0466727_132810 Ga0466727_132810_959_1318 119
51 3300042656 Ga0466732_099575 Ga0466732_099575_599_958 119
52 3300042659 Ga0466733_136722 Ga0466733_136722_596_955 119
53 iso_pr_bacteria 2781125697 2781442796 119
54 iso_pr_bacteria 2820744581 2820745194 119
55 3300002450 JGI24695J34938_10321583 JGI24695J34938_103215832 120
56 3300002462 JGI24702J35022_10005933 JGI24702J35022_100059332 120
57 3300002834 JGI24696J40584_12961651 JGI24696J40584_1296165112 120
58 3300005200 Ga0072940_1182900 Ga0072940_11829001 120
59 3300005200 Ga0072940_1578006 Ga0072940_15780061 120
60 3300005201 Ga0072941_1164836 Ga0072941_11648362 120
61 3300005485 Ga0074263_111914 Ga0074263_1119145 120
62 3300010049 Ga0123356_12980349 Ga0123356_129803492 120
63 3300010167 Ga0123353_10127580 Ga0123353_101275803 120
64 3300010167 Ga0123353_10349541 Ga0123353_103495411 120
65 3300010882 Ga0123354_10089666 Ga0123354_100896663 120
66 3300010882 Ga0123354_10161060 Ga0123354_101610603 120
67 3300010882 Ga0123354_10444050 Ga0123354_104440502 120
68 3300024493 Ga0264413_113519 Ga0264413_1135195 120
69 3300042590 Ga0466690_040754 Ga0466690_040754_1932_2294 120
70 3300042590 Ga0466690_079237 Ga0466690_079237_362_724 120
71 3300042593 Ga0466691_091283 Ga0466691_091283_3170_3532 120
72 3300042597 Ga0466699_402468 Ga0466699_402468_1277_1639 120
73 3300042605 Ga0466716_479449 Ga0466716_479449_734_1096 120
74 3300042606 Ga0466719_137929 Ga0466719_137929_449_811 120
75 3300042609 Ga0466722_051355 Ga0466722_051355_16039_16401 120
76 3300042616 Ga0466715_487890 Ga0466715_487890_1324_1686 120
77 3300042619 Ga0466726_430822 Ga0466726_430822_1227_1589 120
78 3300042635 Ga0466702_046487 Ga0466702_046487_42_404 120
79 3300042652 Ga0466708_019893 Ga0466708_019893_430_792 120
80 3300042652 Ga0466708_372318 Ga0466708_372318_1262_1624 120
81 3300002449 JGI24698J34947_10059894 JGI24698J34947_100598942 121
82 3300005071 Ga0068302_10403436 Ga0068302_104034362 121
83 3300010167 Ga0123353_10051409 Ga0123353_100514093 121
84 3300042591 Ga0466692_111092 Ga0466692_111092_20286_20651 121
85 3300042593 Ga0466691_048075 Ga0466691_048075_12126_12491 121
86 3300042600 Ga0466700_008228 Ga0466700_008228_555_920 121
87 3300042615 Ga0466711_365823 Ga0466711_365823_5499_5864 121
88 3300042616 Ga0466715_087695 Ga0466715_087695_670_1035 121
89 3300042619 Ga0466726_233939 Ga0466726_233939_1029_1394 121
90 3300042635 Ga0466702_339734 Ga0466702_339734_147_512 121
91 3300042655 Ga0466727_142648 Ga0466727_142648_4633_4998 121
92 3300000089 AustNasuHG_c1010805 AustNasuHG_10108052 122
93 3300002450 JGI24695J34938_10026177 JGI24695J34938_100261772 122
94 3300002450 JGI24695J34938_10034107 JGI24695J34938_100341072 122
95 3300010049 Ga0123356_10682730 Ga0123356_106827301 122
96 3300024493 Ga0264413_107725 Ga0264413_1077258 122
97 3300038395 Ga0415639_191766 Ga0415639_191766_18_386 122
98 3300042592 Ga0466693_139447 Ga0466693_139447_70_438 122
99 3300042611 Ga0466697_140857 Ga0466697_140857_468_836 122
100 3300002450 JGI24695J34938_10021945 JGI24695J34938_100219453 123
101 3300002450 JGI24695J34938_10022896 JGI24695J34938_100228962 123
102 3300042614 Ga0466712_294206 Ga0466712_294206_566_937 123
103 3300042655 Ga0466727_096862 Ga0466727_096862_791_1162 123
104 3300042655 Ga0466727_210513 Ga0466727_210513_186_557 123
105 3300042656 Ga0466732_023667 Ga0466732_023667_989_1360 123
106 3300000089 AustNasuHG_c1002848 AustNasuHG_10028482 124
107 3300000089 AustNasuHG_c1008149 AustNasuHG_10081493 124
108 3300000089 AustNasuHG_c1022822 AustNasuHG_10228223 124
109 3300002462 JGI24702J35022_10006606 JGI24702J35022_100066064 124
110 3300022815 Ga0255786_1011469 Ga0255786_10114692 124
111 3300042591 Ga0466692_169104 Ga0466692_169104_330_704 124
112 3300042607 Ga0466720_002785 Ga0466720_002785_19845_20219 124
113 3300042614 Ga0466712_034896 Ga0466712_034896_2295_2669 124
114 3300042614 Ga0466712_271233 Ga0466712_271233_253_627 124
115 3300042617 Ga0466718_034661 Ga0466718_034661_17_391 124
116 iso_pr_bacteria 2781125692 2781430984 124
117 3300002449 JGI24698J34947_10032574 JGI24698J34947_100325744 125
118 3300002462 JGI24702J35022_10252387 JGI24702J35022_102523872 125
119 3300010049 Ga0123356_11745452 Ga0123356_117454522 125
120 3300010167 Ga0123353_10198812 Ga0123353_101988123 125
121 3300042607 Ga0466720_003238 Ga0466720_003238_25282_25659 125
122 3300042612 Ga0466705_191068 Ga0466705_191068_5205_5582 125
123 3300042614 Ga0466712_200131 Ga0466712_200131_507_884 125
124 3300042622 Ga0466731_379035 Ga0466731_379035_63_440 125
125 3300042643 Ga0466704_225446 Ga0466704_225446_140_517 125
126 3300042656 Ga0466732_255026 Ga0466732_255026_635_1012 125
127 3300000089 AustNasuHG_c1001192 AustNasuHG_10011927 126
128 3300002504 JGI24705J35276_12001154 JGI24705J35276_120011542 126
129 3300002504 JGI24705J35276_12094736 JGI24705J35276_120947362 126
130 3300005201 Ga0072941_1160353 Ga0072941_11603532 126
131 3300042607 Ga0466720_015079 Ga0466720_015079_495_875 126
132 3300042617 Ga0466718_052764 Ga0466718_052764_3919_4299 126
133 3300042655 Ga0466727_128107 Ga0466727_128107_776_1156 126
134 3300042596 Ga0466696_185438 Ga0466696_185438_548_931 127
135 3300042614 Ga0466712_014792 Ga0466712_014792_7875_8261 128
136 3300042618 Ga0466723_277765 Ga0466723_277765_37682_38074 130
137 3300042617 Ga0466718_079204 Ga0466718_079204_5318_5713 131
138 3300042602 Ga0466713_089653 Ga0466713_089653_5336_5752 138
139 3300010049 Ga0123356_11785696 Ga0123356_117856962 143

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.