Protein Family IF02957

Metagenome Isolate
219 Members
75 Samples
199 Scaffolds
60.79 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10909872|Ga0123356_109098722
Length
63 aa
Sequence
MPNPKRRHSKQRRDKRRTHDSAVIPTVVKCSNCSSSVLYHRVCPSCGYYRGKLAIEKEGAVA*

πŸ“Š Sample Types

Isolate 9.1%
Metagenome 90.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 37.8%
Kalotermitidae 18.9%
Unclassified 13.5%
Blattidae 12.2%
Rhinotermitidae 5.4%
Termopsidae 5.4%
Passalidae 2.7%
Hydrophilidae 2.7%
Hodotermitidae 1.4%

🌳 Taxonomy

Archaea 0
Bacteria 181
Eukaryota 0
Viruses 0
Unclassified 38

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
3 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
4 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
5 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
9 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
10 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
11 2920168565 Paludibacter sp. 221 Isolate Blattidae
12 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
13 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
14 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 8100157865 Dysgonomonas sp. GY617 Isolate Rhinotermitidae
17 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
18 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
19 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
20 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
21 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
22 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
25 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 2820778767 Unclassified Bacteroidetes Emb289P4bin10 Isolate Unclassified
29 2910942425 Dysgonomonas sp. 521 Isolate Blattidae
30 2940244548 Dysgonomonas sp. PF1-14 Isolate Blattidae
31 8100166142 Dysgonomonas sp. GY75 Isolate Rhinotermitidae
32 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
33 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
34 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
35 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
36 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2820792843 Unclassified Bacteroidetes Cu122P3bin1 Isolate Unclassified
41 2873600114 Dysgonomonas sp. HDW5A Isolate Hydrophilidae
42 2940193328 Dysgonomonas sp. PH5-45 Isolate Blattidae
43 2940248789 Dysgonomonas sp. PF1-16 Isolate Blattidae
44 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
45 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
46 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
47 2820795054 Unclassified Bacteroidetes Cu122P1bin21 Isolate Unclassified
48 2940253009 Dysgonomonas sp. PF1-23 Isolate Blattidae
49 2940257232 Dysgonomonas sp. PFB1-18 Isolate Blattidae
50 2695420317 Dysgonomonas sp. HGC4 Isolate Unclassified
51 2820755292 Unclassified Bacteroidetes Nc150P3bin3 Isolate Unclassified
52 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
53 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
54 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
55 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
56 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
57 2873610414 Dysgonomonas sp. HDW5B Isolate Hydrophilidae
58 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
59 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
60 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
61 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
62 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
63 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
64 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
65 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
66 2820797595 Unclassified Bacteroidetes Co191P3bin3 Isolate Unclassified
67 2940209341 Parabacteroides sp. PFB2-10 Isolate Blattidae
68 2940336608 Dysgonomonas sp. PH5-37 Isolate Blattidae
69 2820753519 Unclassified Bacteroidetes Nc150P4bin20 Isolate Unclassified
70 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
71 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
72 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
73 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
74 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
75 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_322943 3300042612 Unclassified 6310
2 Ga0466710_050506 3300042613 Unclassified 1372
3 Ga0466710_143824 3300042613 Bacteria 11181
4 Ga0466711_025258 3300042615 Bacteria 45468
5 Ga0466723_074387 3300042618 Bacteria 21544
6 Ga0466723_240845 3300042618 Bacteria 2745
7 Ga0466690_264179 3300042590 Bacteria 3774
8 Ga0466693_103770 3300042592 Bacteria 1458
9 Ga0466694_199464 3300042594 Unclassified 1650
10 Ga0466696_451325 3300042596 Bacteria 7890
11 Ga0466735_212860 3300042624 Bacteria 1437
12 Ga0466703_202151 3300042636 Bacteria 10760
13 Ga0466708_396410 3300042652 Bacteria 17245
14 Ga0466727_045002 3300042655 Unclassified 2065
15 Ga0466727_056289 3300042655 Bacteria 29084
16 Ga0123356_10118770 3300010049 Bacteria 2568
17 Ga0123353_11200078 3300010167 Bacteria 996
18 Ga0466701_022511 3300042598 Bacteria 4162
19 Ga0466706_022851 3300042599 Bacteria 16146
20 Ga0466700_255845 3300042600 Unclassified 2067
21 Ga0466713_037701 3300042602 Bacteria 30244
22 Ga0466719_033141 3300042606 Bacteria 1361
23 IMNBL1DRAFT_c0001840 3300000062 Bacteria 15463
24 IMNBL1DRAFT_c0146322 3300000062 Bacteria 608
25 Ga0072941_1187559 3300005201 Bacteria 534
26 Ga0466705_318819 3300042612 Bacteria 8925
27 Ga0466715_232391 3300042616 Bacteria 3818
28 Ga0466726_179518 3300042619 Bacteria 7175
29 Ga0466726_240570 3300042619 Bacteria 7507
30 Ga0466692_128376 3300042591 Bacteria 43265
31 Ga0466693_029400 3300042592 Unclassified 1026
32 Ga0466693_135438 3300042592 Bacteria 2525
33 Ga0466691_217743 3300042593 Bacteria 16754
34 Ga0466696_347081 3300042596 Bacteria 14959
35 Ga0466734_083974 3300042623 Bacteria 1105
36 Ga0466735_076253 3300042624 Bacteria 2161
37 Ga0466730_081443 3300042625 Bacteria 1030
38 Ga0466703_006789 3300042636 Bacteria 4471
39 Ga0466708_064449 3300042652 Unclassified 1306
40 Ga0466708_254328 3300042652 Bacteria 25412
41 Ga0466708_334466 3300042652 Bacteria 26460
42 Ga0466727_050390 3300042655 Bacteria 11699
43 Ga0123356_10053433 3300010049 Unclassified 3760
44 Ga0123356_10862341 3300010049 Bacteria 1077
45 Ga0123353_10016092 3300010167 Unclassified 10911
46 Ga0123353_11504243 3300010167 Bacteria 857
47 Ga0123353_12645451 3300010167 Bacteria 592
48 Ga0123354_10173229 3300010882 Unclassified 2500
49 Ga0466706_108763 3300042599 Bacteria 15518
50 Ga0466707_264391 3300042601 Bacteria 1507
51 Ga0466707_286444 3300042601 Bacteria 9962
52 Ga0466713_105312 3300042602 Bacteria 60870
53 Ga0466713_141379 3300042602 Bacteria 226907
54 Ga0466714_090461 3300042603 Bacteria 2082
55 Ga0466716_459747 3300042605 Bacteria 8036
56 2227234973 2225789004 Bacteria 1355
57 IMNBL1DRAFT_c0028202 3300000062 Bacteria 2098
58 JGI24696J40584_12955332 3300002834 Bacteria 2813
59 Ga0466697_182716 3300042611 Bacteria 1171
60 Ga0466733_074569 3300042659 Bacteria 12665
61 Ga0466715_385280 3300042616 Bacteria 24407
62 Ga0466728_133449 3300042620 Bacteria 2932
63 Ga0466728_390946 3300042620 Bacteria 4191
64 Ga0466656_371873 3300042550 Bacteria 1545
65 Ga0466692_090361 3300042591 Bacteria 3200
66 Ga0466696_082686 3300042596 Bacteria 2569
67 Ga0466735_098429 3300042624 Unclassified 6174
68 Ga0466735_126954 3300042624 Bacteria 4521
69 Ga0466730_089850 3300042625 Unclassified 1167
70 Ga0466709_133538 3300042648 Bacteria 9074
71 Ga0466709_253893 3300042648 Unclassified 4282
72 Ga0123357_10464674 3300009784 Unclassified 1084
73 Ga0123356_11290158 3300010049 Bacteria 894
74 Ga0466707_420035 3300042601 Bacteria 14009
75 Ga0466716_356608 3300042605 Bacteria 21145
76 IMNBL1DRAFT_c0039991 3300000062 Bacteria 1592
77 JGI24702J35022_10001519 3300002462 Bacteria 14409
78 Ga0466733_136322 3300042659 Bacteria 3351
79 Ga0466710_267627 3300042613 Bacteria 1638
80 Ga0466712_029102 3300042614 Bacteria 2721
81 Ga0466711_027006 3300042615 Bacteria 33406
82 Ga0466715_284476 3300042616 Bacteria 35153
83 Ga0466726_168827 3300042619 Bacteria 10185
84 Ga0466728_302977 3300042620 Bacteria 25242
85 Ga0466657_063134 3300042582 Bacteria 3479
86 Ga0466690_065709 3300042590 Bacteria 9325
87 Ga0466694_003823 3300042594 Bacteria 3788
88 Ga0466696_145313 3300042596 Bacteria 2850
89 Ga0466735_141602 3300042624 Unclassified 6646
90 Ga0123357_10156287 3300009784 Bacteria 2749
91 Ga0123356_10175863 3300010049 Unclassified 2157
92 Ga0466700_056523 3300042600 Bacteria 3932
93 Ga0466713_120509 3300042602 Bacteria 47742
94 Ga0466717_101219 3300042604 Bacteria 2675
95 Ga0466698_053535 3300042610 Bacteria 1123
96 Ga0466698_411117 3300042610 Bacteria 2054
97 JGI24702J35022_10084234 3300002462 Bacteria 1725
98 Ga0466697_089493 3300042611 Bacteria 5838
99 Ga0466727_349678 3300042655 Unclassified 1044
100 Ga0466732_368088 3300042656 Bacteria 6529
101 Ga0466710_262167 3300042613 Bacteria 1533
102 Ga0466710_405233 3300042613 Bacteria 1953
103 Ga0466735_004889 3300042624 Bacteria 1524
104 Ga0466704_193450 3300042643 Bacteria 17342
105 Ga0466709_340948 3300042648 Bacteria 51915
106 Ga0466709_398108 3300042648 Bacteria 1114
107 Ga0466708_088711 3300042652 Bacteria 35515
108 Ga0123353_13017135 3300010167 Bacteria 545
109 Ga0466701_039482 3300042598 Bacteria 104864
110 Ga0466707_061110 3300042601 Bacteria 2201
111 Ga0466707_086343 3300042601 Unclassified 4690
112 Ga0466716_029281 3300042605 Unclassified 4584
113 Ga0466716_166394 3300042605 Unclassified 1123
114 Ga0466716_168812 3300042605 Bacteria 3215
115 Ga0466716_266299 3300042605 Bacteria 3380
116 Ga0466719_134057 3300042606 Bacteria 8096
117 Ga0466719_261143 3300042606 Bacteria 8679
118 2227303006 2225789004 Bacteria 29397
119 IMNBL1DRAFT_c0017754 3300000062 Bacteria 2980
120 IMNBL1DRAFT_c0053890 3300000062 Unclassified 1250
121 IMNBL1DRAFT_c0159376 3300000062 Bacteria 576
122 JGI24705J35276_12236663 3300002504 Bacteria 8560
123 Ga0072941_1636923 3300005201 Bacteria 1272
124 Ga0466705_004941 3300042612 Bacteria 2822
125 Ga0466705_342178 3300042612 Bacteria 42153
126 Ga0466733_006860 3300042659 Bacteria 2588
127 Ga0466733_092757 3300042659 Bacteria 8349
128 Ga0466733_159716 3300042659 Unclassified 3600
129 Ga0466710_396264 3300042613 Bacteria 4130
130 Ga0466711_223730 3300042615 Unclassified 4293
131 Ga0466657_288391 3300042582 Bacteria 2387
132 Ga0466691_095165 3300042593 Bacteria 6239
133 Ga0466694_093952 3300042594 Bacteria 1577
134 Ga0466695_039550 3300042595 Bacteria 3924
135 Ga0466735_139015 3300042624 Unclassified 3230
136 Ga0466704_294162 3300042643 Unclassified 2101
137 Ga0466709_240717 3300042648 Bacteria 4276
138 Ga0123356_10027493 3300010049 Bacteria 5330
139 Ga0123353_10234069 3300010167 Unclassified 2861
140 Ga0123353_10685597 3300010167 Bacteria 1442
141 Ga0123354_10101988 3300010882 Unclassified 3871
142 Ga0123354_10104809 3300010882 Bacteria 3789
143 Ga0123354_10238065 3300010882 Bacteria 1881
144 Ga0466714_001728 3300042603 Bacteria 35313
145 Ga0466719_228278 3300042606 Bacteria 3349
146 2227566015 2225789004 Bacteria 2670
147 JGI24695J34938_10002757 3300002450 Unclassified 12910
148 JGI24702J35022_10156801 3300002462 Bacteria 1280
149 Ga0068302_10107899 3300005071 Unclassified 3538
150 Ga0068302_10447324 3300005071 Bacteria 1049
151 Ga0072940_1223199 3300005200 Bacteria 1931
152 Ga0072941_1299637 3300005201 Unclassified 936
153 Ga0466715_042591 3300042616 Bacteria 14628
154 Ga0466715_087509 3300042616 Bacteria 4947
155 Ga0466715_585069 3300042616 Bacteria 6298
156 Ga0466726_000689 3300042619 Bacteria 3324
157 Ga0466726_040362 3300042619 Unclassified 1091
158 Ga0466696_132913 3300042596 Bacteria 52155
159 Ga0466735_108380 3300042624 Bacteria 3390
160 Ga0466735_145025 3300042624 Unclassified 8253
161 Ga0466730_080010 3300042625 Bacteria 1521
162 Ga0466703_197762 3300042636 Unclassified 1645
163 Ga0123356_10139359 3300010049 Bacteria 2391
164 Ga0123356_10909872 3300010049 Bacteria 1051
165 Ga0123353_10897635 3300010167 Unclassified 1207
166 Ga0466707_104778 3300042601 Bacteria 1894
167 Ga0466722_180718 3300042609 Bacteria 10903
168 2227478256 2225789004 Bacteria 4545
169 IMNBL1DRAFT_c0088199 3300000062 Bacteria 855
170 JGI24695J34938_10621214 3300002450 Bacteria 505
171 JGI24702J35022_10008594 3300002462 Bacteria 5777
172 JGI24702J35022_10199479 3300002462 Bacteria 1144
173 Ga0123357_10000044 3300009784 Bacteria 100721
174 Ga0466705_034194 3300042612 Bacteria 7757
175 Ga0466705_470782 3300042612 Bacteria 13035
176 Ga0466715_134136 3300042616 Bacteria 3939
177 Ga0466715_544350 3300042616 Bacteria 12412
178 Ga0466718_083554 3300042617 Bacteria 3634
179 Ga0466726_096971 3300042619 Bacteria 2179
180 Ga0466728_152542 3300042620 Unclassified 1597
181 Ga0466690_146432 3300042590 Bacteria 4159
182 Ga0466691_179116 3300042593 Bacteria 10445
183 Ga0466694_270538 3300042594 Bacteria 1544
184 Ga0466696_396874 3300042596 Bacteria 1827
185 Ga0466735_147677 3300042624 Unclassified 3101
186 Ga0123356_10486746 3300010049 Bacteria 1388
187 Ga0123353_10061158 3300010167 Unclassified 6039
188 Ga0123353_10498070 3300010167 Bacteria 1776
189 Ga0466706_048730 3300042599 Bacteria 101759
190 Ga0466713_132020 3300042602 Bacteria 30911
191 Ga0466719_057372 3300042606 Bacteria 1185
192 Ga0466721_360199 3300042608 Bacteria 26778
193 Ga0466698_315435 3300042610 Bacteria 7223
194 Ga0466698_426591 3300042610 Unclassified 2200
195 2227464603 2225789004 Bacteria 982
196 IMNBL1DRAFT_c0037129 3300000062 Bacteria 1692
197 JGI24702J35022_10004274 3300002462 Bacteria 8519
198 Ga0068305_10069913 3300005083 Bacteria 6748
199 Ga0072941_1210290 3300005201 Bacteria 1266

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042648 Ga0466709_340948 Ga0466709_340948_10820_11008 53
2 3300042603 Ga0466714_001728 Ga0466714_001728_22404_22589 55
3 3300042598 Ga0466701_022511 Ga0466701_022511_3671_3844 57
4 3300042610 Ga0466698_315435 Ga0466698_315435_5955_6128 57
5 3300042613 Ga0466710_050506 Ga0466710_050506_16_189 57
6 3300042613 Ga0466710_396264 Ga0466710_396264_3456_3629 57
7 3300042613 Ga0466710_405233 Ga0466710_405233_1378_1551 57
8 iso_pr_bacteria 2820753519 2820755154 57
9 iso_pr_bacteria 2820755292 2820755479 57
10 iso_pr_bacteria 2820792843 2820794615 57
11 iso_pr_bacteria 2820795054 2820796312 57
12 iso_pr_bacteria 2820797595 2820798175 57
13 3300002450 JGI24695J34938_10002757 JGI24695J34938_100027577 58
14 3300010049 Ga0123356_10175863 Ga0123356_101758632 58
15 3300010167 Ga0123353_10016092 Ga0123353_100160923 58
16 3300010167 Ga0123353_10061158 Ga0123353_100611585 58
17 3300042590 Ga0466690_065709 Ga0466690_065709_6373_6552 59
18 3300042599 Ga0466706_022851 Ga0466706_022851_349_528 59
19 3300042600 Ga0466700_255845 Ga0466700_255845_540_719 59
20 3300042605 Ga0466716_029281 Ga0466716_029281_859_1038 59
21 3300042606 Ga0466719_033141 Ga0466719_033141_58_237 59
22 3300042615 Ga0466711_223730 Ga0466711_223730_1717_1896 59
23 3300042616 Ga0466715_087509 Ga0466715_087509_1000_1179 59
24 3300042619 Ga0466726_000689 Ga0466726_000689_986_1165 59
25 3300042620 Ga0466728_133449 Ga0466728_133449_1102_1281 59
26 3300042620 Ga0466728_390946 Ga0466728_390946_3228_3407 59
27 3300042624 Ga0466735_139015 Ga0466735_139015_2760_2939 59
28 3300042652 Ga0466708_254328 Ga0466708_254328_9881_10060 59
29 2225789004 2227464603 2227901605 60
30 3300042591 Ga0466692_090361 Ga0466692_090361_2060_2242 60
31 3300042596 Ga0466696_347081 Ga0466696_347081_12668_12850 60
32 3300042605 Ga0466716_166394 Ga0466716_166394_885_1067 60
33 3300042608 Ga0466721_360199 Ga0466721_360199_7107_7289 60
34 3300042610 Ga0466698_053535 Ga0466698_053535_420_602 60
35 3300042611 Ga0466697_089493 Ga0466697_089493_3893_4075 60
36 3300042612 Ga0466705_004941 Ga0466705_004941_2051_2233 60
37 3300042612 Ga0466705_034194 Ga0466705_034194_6200_6382 60
38 3300042613 Ga0466710_262167 Ga0466710_262167_702_884 60
39 3300042616 Ga0466715_232391 Ga0466715_232391_2380_2562 60
40 3300042618 Ga0466723_074387 Ga0466723_074387_7154_7336 60
41 3300042619 Ga0466726_040362 Ga0466726_040362_614_796 60
42 3300042623 Ga0466734_083974 Ga0466734_083974_895_1077 60
43 3300042624 Ga0466735_126954 Ga0466735_126954_2689_2871 60
44 3300042625 Ga0466730_081443 Ga0466730_081443_27_209 60
45 3300042648 Ga0466709_253893 Ga0466709_253893_2274_2456 60
46 3300042655 Ga0466727_045002 Ga0466727_045002_1382_1564 60
47 3300042655 Ga0466727_056289 Ga0466727_056289_15591_15773 60
48 3300042659 Ga0466733_092757 Ga0466733_092757_5360_5542 60
49 2225789004 2227234973 2227672403 61
50 2225789004 2227303006 2227753090 61
51 2225789004 2227478256 2227933385 61
52 2225789004 2227566015 2228107446 61
53 3300002462 JGI24702J35022_10084234 JGI24702J35022_100842341 61
54 3300005071 Ga0068302_10107899 Ga0068302_101078996 61
55 3300005201 Ga0072941_1187559 Ga0072941_11875592 61
56 3300005201 Ga0072941_1210290 Ga0072941_12102902 61
57 3300009784 Ga0123357_10464674 Ga0123357_104646743 61
58 3300010049 Ga0123356_10053433 Ga0123356_100534336 61
59 3300010049 Ga0123356_10486746 Ga0123356_104867463 61
60 3300010882 Ga0123354_10101988 Ga0123354_101019883 61
61 3300010882 Ga0123354_10104809 Ga0123354_101048092 61
62 3300042550 Ga0466656_371873 Ga0466656_371873_1033_1218 61
63 3300042582 Ga0466657_063134 Ga0466657_063134_1604_1789 61
64 3300042582 Ga0466657_288391 Ga0466657_288391_502_687 61
65 3300042590 Ga0466690_146432 Ga0466690_146432_635_820 61
66 3300042591 Ga0466692_128376 Ga0466692_128376_33049_33234 61
67 3300042592 Ga0466693_029400 Ga0466693_029400_439_624 61
68 3300042592 Ga0466693_103770 Ga0466693_103770_473_658 61
69 3300042592 Ga0466693_135438 Ga0466693_135438_763_948 61
70 3300042593 Ga0466691_095165 Ga0466691_095165_2336_2521 61
71 3300042593 Ga0466691_179116 Ga0466691_179116_3618_3803 61
72 3300042593 Ga0466691_217743 Ga0466691_217743_6670_6855 61
73 3300042594 Ga0466694_003823 Ga0466694_003823_2134_2319 61
74 3300042594 Ga0466694_093952 Ga0466694_093952_1023_1208 61
75 3300042594 Ga0466694_199464 Ga0466694_199464_900_1085 61
76 3300042594 Ga0466694_270538 Ga0466694_270538_702_887 61
77 3300042596 Ga0466696_082686 Ga0466696_082686_655_840 61
78 3300042596 Ga0466696_132913 Ga0466696_132913_32464_32649 61
79 3300042596 Ga0466696_145313 Ga0466696_145313_1961_2146 61
80 3300042596 Ga0466696_396874 Ga0466696_396874_1142_1327 61
81 3300042596 Ga0466696_451325 Ga0466696_451325_2486_2671 61
82 3300042598 Ga0466701_039482 Ga0466701_039482_55907_56092 61
83 3300042599 Ga0466706_048730 Ga0466706_048730_66278_66463 61
84 3300042599 Ga0466706_108763 Ga0466706_108763_10052_10237 61
85 3300042600 Ga0466700_056523 Ga0466700_056523_1196_1381 61
86 3300042601 Ga0466707_061110 Ga0466707_061110_608_793 61
87 3300042601 Ga0466707_104778 Ga0466707_104778_719_904 61
88 3300042601 Ga0466707_286444 Ga0466707_286444_5393_5578 61
89 3300042601 Ga0466707_420035 Ga0466707_420035_10869_11054 61
90 3300042602 Ga0466713_037701 Ga0466713_037701_15937_16122 61
91 3300042602 Ga0466713_105312 Ga0466713_105312_222_407 61
92 3300042602 Ga0466713_120509 Ga0466713_120509_43741_43926 61
93 3300042602 Ga0466713_132020 Ga0466713_132020_30596_30781 61
94 3300042602 Ga0466713_141379 Ga0466713_141379_90825_91010 61
95 3300042603 Ga0466714_090461 Ga0466714_090461_1119_1304 61
96 3300042604 Ga0466717_101219 Ga0466717_101219_265_450 61
97 3300042605 Ga0466716_168812 Ga0466716_168812_843_1028 61
98 3300042605 Ga0466716_266299 Ga0466716_266299_2658_2843 61
99 3300042605 Ga0466716_356608 Ga0466716_356608_12624_12809 61
100 3300042605 Ga0466716_459747 Ga0466716_459747_2475_2660 61
101 3300042606 Ga0466719_134057 Ga0466719_134057_4834_5019 61
102 3300042606 Ga0466719_228278 Ga0466719_228278_617_802 61
103 3300042606 Ga0466719_261143 Ga0466719_261143_5939_6124 61
104 3300042610 Ga0466698_426591 Ga0466698_426591_1289_1474 61
105 3300042611 Ga0466697_182716 Ga0466697_182716_171_356 61
106 3300042612 Ga0466705_318819 Ga0466705_318819_7634_7819 61
107 3300042612 Ga0466705_342178 Ga0466705_342178_5851_6036 61
108 3300042612 Ga0466705_470782 Ga0466705_470782_3884_4069 61
109 3300042613 Ga0466710_143824 Ga0466710_143824_3480_3665 61
110 3300042613 Ga0466710_267627 Ga0466710_267627_505_690 61
111 3300042614 Ga0466712_029102 Ga0466712_029102_1980_2165 61
112 3300042615 Ga0466711_025258 Ga0466711_025258_15018_15203 61
113 3300042615 Ga0466711_027006 Ga0466711_027006_25268_25453 61
114 3300042616 Ga0466715_042591 Ga0466715_042591_11859_12044 61
115 3300042616 Ga0466715_134136 Ga0466715_134136_174_359 61
116 3300042616 Ga0466715_284476 Ga0466715_284476_7378_7563 61
117 3300042616 Ga0466715_385280 Ga0466715_385280_721_906 61
118 3300042616 Ga0466715_544350 Ga0466715_544350_8637_8822 61
119 3300042616 Ga0466715_585069 Ga0466715_585069_5852_6037 61
120 3300042617 Ga0466718_083554 Ga0466718_083554_2235_2420 61
121 3300042618 Ga0466723_240845 Ga0466723_240845_1068_1253 61
122 3300042619 Ga0466726_096971 Ga0466726_096971_928_1113 61
123 3300042619 Ga0466726_179518 Ga0466726_179518_226_411 61
124 3300042619 Ga0466726_240570 Ga0466726_240570_1145_1330 61
125 3300042620 Ga0466728_152542 Ga0466728_152542_976_1161 61
126 3300042620 Ga0466728_302977 Ga0466728_302977_9440_9625 61
127 3300042624 Ga0466735_004889 Ga0466735_004889_1063_1248 61
128 3300042624 Ga0466735_076253 Ga0466735_076253_1932_2117 61
129 3300042624 Ga0466735_108380 Ga0466735_108380_75_260 61
130 3300042624 Ga0466735_141602 Ga0466735_141602_967_1152 61
131 3300042624 Ga0466735_145025 Ga0466735_145025_7846_8031 61
132 3300042624 Ga0466735_147677 Ga0466735_147677_2052_2237 61
133 3300042624 Ga0466735_212860 Ga0466735_212860_579_764 61
134 3300042625 Ga0466730_080010 Ga0466730_080010_1108_1293 61
135 3300042625 Ga0466730_089850 Ga0466730_089850_931_1116 61
136 3300042636 Ga0466703_006789 Ga0466703_006789_1684_1869 61
137 3300042636 Ga0466703_197762 Ga0466703_197762_27_212 61
138 3300042636 Ga0466703_202151 Ga0466703_202151_6742_6927 61
139 3300042643 Ga0466704_193450 Ga0466704_193450_10445_10630 61
140 3300042643 Ga0466704_294162 Ga0466704_294162_1038_1223 61
141 3300042648 Ga0466709_133538 Ga0466709_133538_8219_8404 61
142 3300042648 Ga0466709_240717 Ga0466709_240717_2499_2684 61
143 3300042648 Ga0466709_398108 Ga0466709_398108_98_283 61
144 3300042652 Ga0466708_064449 Ga0466708_064449_789_974 61
145 3300042652 Ga0466708_088711 Ga0466708_088711_27257_27442 61
146 3300042652 Ga0466708_334466 Ga0466708_334466_24385_24570 61
147 3300042652 Ga0466708_396410 Ga0466708_396410_8938_9123 61
148 3300042655 Ga0466727_050390 Ga0466727_050390_3864_4049 61
149 3300042655 Ga0466727_349678 Ga0466727_349678_526_711 61
150 3300042656 Ga0466732_368088 Ga0466732_368088_6087_6272 61
151 3300042659 Ga0466733_006860 Ga0466733_006860_1648_1833 61
152 3300042659 Ga0466733_136322 Ga0466733_136322_1136_1321 61
153 3300042659 Ga0466733_159716 Ga0466733_159716_2241_2426 61
154 iso_pr_bacteria 2695420317 2695483817 61
155 iso_pr_bacteria 2820778767 2820778816 61
156 iso_pr_bacteria 2873600114 2873600320 61
157 iso_pr_bacteria 2873610414 2873610694 61
158 iso_pr_bacteria 2910942425 2910947015 61
159 iso_pr_bacteria 2920168565 2920169089 61
160 iso_pr_bacteria 2940193328 2940194897 61
161 iso_pr_bacteria 2940209341 2940209475 61
162 iso_pr_bacteria 2940244548 2940245382 61
163 iso_pr_bacteria 2940248789 2940249622 61
164 iso_pr_bacteria 2940253009 2940253732 61
165 iso_pr_bacteria 2940257232 2940257587 61
166 iso_pr_bacteria 2940336608 2940338208 61
167 iso_pr_bacteria 8100157865 8100159886 61
168 iso_pr_bacteria 8100166142 8100166648 61
169 3300000062 IMNBL1DRAFT_c0001840 IMNBL1DRAFT_000184014 62
170 3300000062 IMNBL1DRAFT_c0017754 IMNBL1DRAFT_00177543 62
171 3300000062 IMNBL1DRAFT_c0028202 IMNBL1DRAFT_00282023 62
172 3300000062 IMNBL1DRAFT_c0037129 IMNBL1DRAFT_00371292 62
173 3300000062 IMNBL1DRAFT_c0039991 IMNBL1DRAFT_00399913 62
174 3300000062 IMNBL1DRAFT_c0053890 IMNBL1DRAFT_00538902 62
175 3300000062 IMNBL1DRAFT_c0088199 IMNBL1DRAFT_00881992 62
176 3300000062 IMNBL1DRAFT_c0146322 IMNBL1DRAFT_01463222 62
177 3300000062 IMNBL1DRAFT_c0159376 IMNBL1DRAFT_01593762 62
178 3300002450 JGI24695J34938_10621214 JGI24695J34938_106212142 62
179 3300002462 JGI24702J35022_10001519 JGI24702J35022_100015199 62
180 3300002462 JGI24702J35022_10004274 JGI24702J35022_100042748 62
181 3300002462 JGI24702J35022_10008594 JGI24702J35022_100085946 62
182 3300002462 JGI24702J35022_10156801 JGI24702J35022_101568012 62
183 3300002462 JGI24702J35022_10199479 JGI24702J35022_101994792 62
184 3300002504 JGI24705J35276_12236663 JGI24705J35276_122366634 62
185 3300002834 JGI24696J40584_12955332 JGI24696J40584_129553322 62
186 3300005071 Ga0068302_10447324 Ga0068302_104473242 62
187 3300005083 Ga0068305_10069913 Ga0068305_1006991310 62
188 3300005200 Ga0072940_1223199 Ga0072940_12231991 62
189 3300005201 Ga0072941_1299637 Ga0072941_12996372 62
190 3300009784 Ga0123357_10000044 Ga0123357_1000004449 62
191 3300009784 Ga0123357_10156287 Ga0123357_101562871 62
192 3300010049 Ga0123356_10118770 Ga0123356_101187702 62
193 3300010049 Ga0123356_10862341 Ga0123356_108623412 62
194 3300010049 Ga0123356_11290158 Ga0123356_112901582 62
195 3300010167 Ga0123353_10498070 Ga0123353_104980703 62
196 3300010167 Ga0123353_10685597 Ga0123353_106855972 62
197 3300010167 Ga0123353_10897635 Ga0123353_108976352 62
198 3300010167 Ga0123353_12645451 Ga0123353_126454512 62
199 3300010167 Ga0123353_13017135 Ga0123353_130171352 62
200 3300042590 Ga0466690_264179 Ga0466690_264179_2619_2807 62
201 3300042595 Ga0466695_039550 Ga0466695_039550_2255_2443 62
202 3300042601 Ga0466707_086343 Ga0466707_086343_3614_3802 62
203 3300042601 Ga0466707_264391 Ga0466707_264391_1112_1300 62
204 3300042609 Ga0466722_180718 Ga0466722_180718_4143_4331 62
205 3300042610 Ga0466698_411117 Ga0466698_411117_1147_1335 62
206 3300042612 Ga0466705_322943 Ga0466705_322943_572_760 62
207 3300042619 Ga0466726_168827 Ga0466726_168827_5805_5993 62
208 3300042624 Ga0466735_098429 Ga0466735_098429_1907_2095 62
209 3300042659 Ga0466733_074569 Ga0466733_074569_2290_2478 62
210 3300005201 Ga0072941_1636923 Ga0072941_16369232 63
211 3300010049 Ga0123356_10027493 Ga0123356_100274936 63
212 3300010049 Ga0123356_10139359 Ga0123356_101393593 63
213 3300010049 Ga0123356_10909872 Ga0123356_109098722 63
214 3300010167 Ga0123353_10234069 Ga0123353_102340693 63
215 3300010167 Ga0123353_11200078 Ga0123353_112000782 63
216 3300010167 Ga0123353_11504243 Ga0123353_115042431 63
217 3300010882 Ga0123354_10173229 Ga0123354_101732294 63
218 3300010882 Ga0123354_10238065 Ga0123354_102380653 63
219 3300042606 Ga0466719_057372 Ga0466719_057372_515_736 67

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01783 Ribosomal_L32p Ribosomal L32p protein family 3 56 0.96

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.48 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.