Protein Family IF02953

Metagenome Isolate
110 Members
38 Samples
107 Scaffolds
243.44 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10805573|Ga0123356_108055732
Length
280 aa
Sequence
VRLFCDNSSLSILIFVKKRKNIETFISVCRIYDFNNLIKHTNMENVFHTIKVNLYENFLTDNPDDFSAKVISERTLGVREICTMAIKRGGAPSTIDAMELNAMLFLKEMAYQMMDGFAVNTGYFTANAQVRGVFNNRTEAFNPNKHSVLFRFNQGDLLRREIPNIQVQVMGVGETGIIISHVVDSKTGSVNDLLTPGGVLKIRGTGDHPDVGVYFEDEYSNVVKVEERDLLLNNPSQLMILIPVLPAGRFQLVIRNQYSVGAMLKEPRTAVYDKILTVV*

πŸ“Š Sample Types

Isolate 2.7%
Metagenome 97.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 58.3%
Kalotermitidae 36.1%
Unclassified 2.8%
Cambaridae 2.8%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
5 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
6 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
7 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
8 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
9 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
10 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
11 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
12 2904728850 Flavobacterium sp. xlx-214 Isolate
13 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
14 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
18 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
24 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
25 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
26 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
27 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
28 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
32 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 2820737921 Unclassified Bacteroidetes Th196P4bin18 Isolate Unclassified
36 2958471994 Flavobacterium sp. xlx-221 Isolate Cambaridae
37 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
38 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466728_037254 3300042620 Bacteria 1547
2 Ga0123356_10076212 3300010049 Bacteria 3160
3 Ga0123356_10127749 3300010049 Bacteria 2485
4 Ga0123356_10664745 3300010049 Bacteria 1209
5 Ga0466656_029037 3300042550 Bacteria 1883
6 Ga0466699_112321 3300042597 Bacteria 5370
7 Ga0466699_166239 3300042597 Bacteria 1571
8 Ga0466708_309098 3300042652 Bacteria 1357
9 Ga0466725_226054 3300042654 Bacteria 1172
10 Ga0466700_458990 3300042600 Bacteria 1032
11 Ga0466705_217652 3300042612 Bacteria 9322
12 Ga0466733_055799 3300042659 Bacteria 106016
13 Ga0466718_167322 3300042617 Bacteria 2043
14 Ga0123353_10095892 3300010167 Bacteria 4780
15 Ga0466656_008026 3300042550 Bacteria 1139
16 Ga0466696_022707 3300042596 Bacteria 5869
17 Ga0466731_081546 3300042622 Bacteria 1108
18 Ga0466734_046576 3300042623 Bacteria 1156
19 Ga0466703_106255 3300042636 Bacteria 3711
20 Ga0466704_141634 3300042643 Bacteria 4955
21 Ga0466708_163336 3300042652 Bacteria 14443
22 Ga0466698_214996 3300042610 Bacteria 1375
23 Ga0466698_495419 3300042610 Bacteria 1270
24 JGI24698J34947_10027104 3300002449 Bacteria 3041
25 JGI24702J35022_10110178 3300002462 Bacteria 1513
26 JGI24702J35022_10227151 3300002462 Bacteria 1078
27 JGI24702J35022_10230383 3300002462 Bacteria 1071
28 Ga0072941_1009964 3300005201 Bacteria 22169
29 Ga0072941_1644248 3300005201 Bacteria 1050
30 Ga0466732_213764 3300042656 Bacteria 1715
31 Ga0466732_266922 3300042656 Bacteria 6665
32 Ga0466704_344910 3300042643 Bacteria 1204
33 Ga0466700_464335 3300042600 Bacteria 2106
34 Ga0466717_082259 3300042604 Bacteria 1890
35 JGI24696J40584_12917605 3300002834 Bacteria 1314
36 Ga0072941_1009065 3300005201 Bacteria 22615
37 Ga0072941_1050800 3300005201 Bacteria 15870
38 Ga0466697_079174 3300042611 Bacteria 1577
39 Ga0466697_273293 3300042611 Bacteria 1180
40 Ga0466715_017700 3300042616 Bacteria 6940
41 Ga0466715_075361 3300042616 Bacteria 22255
42 Ga0466718_067130 3300042617 Bacteria 1160
43 Ga0123356_10805573 3300010049 Bacteria 1110
44 Ga0123353_11085381 3300010167 Bacteria 1065
45 Ga0466699_214912 3300042597 Bacteria 1259
46 Ga0466708_023202 3300042652 Bacteria 2456
47 Ga0466716_270567 3300042605 Bacteria 1862
48 JGI24702J35022_10169543 3300002462 Bacteria 1234
49 Ga0072941_1001552 3300005201 Bacteria 40860
50 Ga0466728_229413 3300042620 Bacteria 1155
51 Ga0466696_193625 3300042596 Bacteria 10151
52 Ga0466702_092965 3300042635 Bacteria 1088
53 Ga0466703_257170 3300042636 Bacteria 2538
54 Ga0466709_031697 3300042648 Bacteria 11634
55 Ga0466709_148701 3300042648 Bacteria 2377
56 Ga0466700_419131 3300042600 Bacteria 1111
57 Ga0466716_096421 3300042605 Bacteria 7390
58 Ga0466716_319537 3300042605 Bacteria 1345
59 Ga0466719_066380 3300042606 Bacteria 1653
60 Ga0466719_067794 3300042606 Unclassified 7078
61 Ga0466698_260130 3300042610 Bacteria 1256
62 JGI24702J35022_10001443 3300002462 Bacteria 14826
63 Ga0466715_612997 3300042616 Bacteria 1504
64 Ga0466718_075927 3300042617 Bacteria 1299
65 Ga0466723_355696 3300042618 Unclassified 1194
66 Ga0123353_10423022 3300010167 Bacteria 1973
67 Ga0123354_10261356 3300010882 Bacteria 1728
68 Ga0466690_120646 3300042590 Bacteria 1534
69 Ga0466704_034860 3300042643 Unclassified 1491
70 Ga0466716_109340 3300042605 Bacteria 13870
71 Ga0466716_313729 3300042605 Bacteria 1272
72 Ga0466719_505886 3300042606 Bacteria 1613
73 JGI24702J35022_10148898 3300002462 Bacteria 1312
74 Ga0466705_483192 3300042612 Bacteria 2993
75 Ga0466710_073297 3300042613 Bacteria 2251
76 Ga0466718_022592 3300042617 Bacteria 1096
77 Ga0123356_10465702 3300010049 Bacteria 1414
78 Ga0123353_10003748 3300010167 Bacteria 19350
79 Ga0466691_038724 3300042593 Bacteria 10060
80 Ga0466696_467424 3300042596 Bacteria 1533
81 Ga0466734_081015 3300042623 Bacteria 1066
82 Ga0466700_064959 3300042600 Bacteria 1193
83 Ga0466716_148623 3300042605 Bacteria 2113
84 Ga0466719_172989 3300042606 Bacteria 7933
85 Ga0466719_369247 3300042606 Bacteria 2135
86 Ga0072941_1045767 3300005201 Bacteria 2561
87 Ga0466718_064590 3300042617 Bacteria 1201
88 Ga0466723_006920 3300042618 Bacteria 1533
89 Ga0466723_018543 3300042618 Bacteria 7312
90 Ga0466723_050067 3300042618 Bacteria 11000
91 Ga0123356_10066788 3300010049 Bacteria 3367
92 Ga0123356_10373818 3300010049 Bacteria 1556
93 Ga0123353_11310409 3300010167 Bacteria 939
94 Ga0123354_10271905 3300010882 Bacteria 1666
95 Ga0466694_076879 3300042594 Bacteria 1222
96 Ga0466694_128665 3300042594 Bacteria 1243
97 Ga0466696_041824 3300042596 Bacteria 12703
98 Ga0466704_149839 3300042643 Bacteria 9706
99 Ga0466709_006573 3300042648 Bacteria 7264
100 Ga0466708_256395 3300042652 Bacteria 2650
101 Ga0466719_034761 3300042606 Bacteria 8225
102 Ga0466719_118025 3300042606 Bacteria 1176
103 Ga0466719_166493 3300042606 Bacteria 9985
104 Ga0466719_178211 3300042606 Bacteria 1256
105 Ga0466719_441721 3300042606 Bacteria 3788
106 Ga0466698_166522 3300042610 Bacteria 1486
107 JGI24702J35022_10020195 3300002462 Bacteria 3618

πŸ“‹ Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_256395 Ga0466708_256395_879_1523 214
2 3300042606 Ga0466719_178211 Ga0466719_178211_218_949 230
3 3300042617 Ga0466718_167322 Ga0466718_167322_61_789 232
4 3300042597 Ga0466699_166239 Ga0466699_166239_38_766 233
5 3300010167 Ga0123353_11085381 Ga0123353_110853811 234
6 3300042550 Ga0466656_008026 Ga0466656_008026_298_1029 234
7 3300042617 Ga0466718_022592 Ga0466718_022592_185_913 234
8 3300042617 Ga0466718_067130 Ga0466718_067130_177_905 234
9 3300002462 JGI24702J35022_10148898 JGI24702J35022_101488981 235
10 3300042617 Ga0466718_064590 Ga0466718_064590_207_935 235
11 3300042656 Ga0466732_266922 Ga0466732_266922_3282_4019 235
12 3300002462 JGI24702J35022_10001443 JGI24702J35022_100014434 236
13 3300010167 Ga0123353_10423022 Ga0123353_104230222 236
14 3300002462 JGI24702J35022_10169543 JGI24702J35022_101695431 237
15 3300042610 Ga0466698_166522 Ga0466698_166522_571_1284 237
16 3300042623 Ga0466734_081015 Ga0466734_081015_212_949 237
17 3300002462 JGI24702J35022_10227151 JGI24702J35022_102271511 239
18 3300010049 Ga0123356_10664745 Ga0123356_106647451 239
19 3300042600 Ga0466700_064959 Ga0466700_064959_385_1110 241
20 3300042606 Ga0466719_067794 Ga0466719_067794_355_1080 241
21 3300042652 Ga0466708_023202 Ga0466708_023202_934_1659 241
22 3300042550 Ga0466656_029037 Ga0466656_029037_180_908 242
23 3300042590 Ga0466690_120646 Ga0466690_120646_441_1169 242
24 3300042594 Ga0466694_128665 Ga0466694_128665_332_1060 242
25 3300042604 Ga0466717_082259 Ga0466717_082259_952_1680 242
26 3300042605 Ga0466716_148623 Ga0466716_148623_236_964 242
27 3300042605 Ga0466716_270567 Ga0466716_270567_809_1537 242
28 3300042606 Ga0466719_118025 Ga0466719_118025_286_1014 242
29 3300042616 Ga0466715_075361 Ga0466715_075361_8740_9468 242
30 3300042618 Ga0466723_355696 Ga0466723_355696_412_1140 242
31 3300042623 Ga0466734_046576 Ga0466734_046576_110_838 242
32 3300042635 Ga0466702_092965 Ga0466702_092965_238_966 242
33 3300042636 Ga0466703_106255 Ga0466703_106255_2465_3193 242
34 3300042648 Ga0466709_148701 Ga0466709_148701_34_762 242
35 3300042652 Ga0466708_163336 Ga0466708_163336_6016_6744 242
36 3300042652 Ga0466708_309098 Ga0466708_309098_162_890 242
37 3300042654 Ga0466725_226054 Ga0466725_226054_201_929 242
38 3300042656 Ga0466732_213764 Ga0466732_213764_52_804 242
39 3300002462 JGI24702J35022_10230383 JGI24702J35022_102303831 243
40 3300010049 Ga0123356_10066788 Ga0123356_100667881 243
41 3300010049 Ga0123356_10127749 Ga0123356_101277492 243
42 3300010167 Ga0123353_10003748 Ga0123353_100037489 243
43 3300010167 Ga0123353_10095892 Ga0123353_100958923 243
44 3300010882 Ga0123354_10261356 Ga0123354_102613562 243
45 3300042597 Ga0466699_214912 Ga0466699_214912_339_1070 243
46 3300042600 Ga0466700_464335 Ga0466700_464335_631_1362 243
47 3300042606 Ga0466719_166493 Ga0466719_166493_2552_3283 243
48 3300042606 Ga0466719_441721 Ga0466719_441721_973_1704 243
49 3300042610 Ga0466698_495419 Ga0466698_495419_365_1096 243
50 3300042612 Ga0466705_483192 Ga0466705_483192_1141_1872 243
51 3300042613 Ga0466710_073297 Ga0466710_073297_213_944 243
52 3300042617 Ga0466718_075927 Ga0466718_075927_316_1047 243
53 3300042618 Ga0466723_006920 Ga0466723_006920_162_893 243
54 3300042620 Ga0466728_037254 Ga0466728_037254_523_1254 243
55 3300042620 Ga0466728_229413 Ga0466728_229413_299_1030 243
56 3300042636 Ga0466703_257170 Ga0466703_257170_210_941 243
57 3300042643 Ga0466704_141634 Ga0466704_141634_256_987 243
58 3300042643 Ga0466704_149839 Ga0466704_149839_7434_8165 243
59 3300042648 Ga0466709_006573 Ga0466709_006573_5635_6366 243
60 3300042648 Ga0466709_031697 Ga0466709_031697_6605_7336 243
61 3300002834 JGI24696J40584_12917605 JGI24696J40584_129176052 244
62 3300005201 Ga0072941_1644248 Ga0072941_16442481 244
63 3300010049 Ga0123356_10465702 Ga0123356_104657022 244
64 3300042605 Ga0466716_096421 Ga0466716_096421_227_961 244
65 3300042605 Ga0466716_313729 Ga0466716_313729_517_1251 244
66 3300042606 Ga0466719_034761 Ga0466719_034761_5985_6719 244
67 3300042606 Ga0466719_066380 Ga0466719_066380_411_1145 244
68 3300042606 Ga0466719_505886 Ga0466719_505886_541_1275 244
69 3300042611 Ga0466697_079174 Ga0466697_079174_599_1333 244
70 3300042616 Ga0466715_612997 Ga0466715_612997_440_1174 244
71 3300042622 Ga0466731_081546 Ga0466731_081546_323_1075 244
72 3300002462 JGI24702J35022_10020195 JGI24702J35022_100201952 245
73 3300002462 JGI24702J35022_10110178 JGI24702J35022_101101782 245
74 3300005201 Ga0072941_1045767 Ga0072941_10457671 245
75 3300005201 Ga0072941_1050800 Ga0072941_105080017 245
76 3300010049 Ga0123356_10076212 Ga0123356_100762121 245
77 3300010049 Ga0123356_10373818 Ga0123356_103738181 245
78 3300010167 Ga0123353_11310409 Ga0123353_113104091 245
79 3300010882 Ga0123354_10271905 Ga0123354_102719053 245
80 3300042593 Ga0466691_038724 Ga0466691_038724_8960_9697 245
81 3300042605 Ga0466716_319537 Ga0466716_319537_175_912 245
82 3300042606 Ga0466719_172989 Ga0466719_172989_2642_3379 245
83 3300042618 Ga0466723_050067 Ga0466723_050067_10232_10969 245
84 3300042597 Ga0466699_112321 Ga0466699_112321_2300_3040 246
85 3300042600 Ga0466700_419131 Ga0466700_419131_169_909 246
86 3300042606 Ga0466719_369247 Ga0466719_369247_1171_1911 246
87 3300042612 Ga0466705_217652 Ga0466705_217652_8404_9144 246
88 3300042643 Ga0466704_034860 Ga0466704_034860_375_1115 246
89 iso_pr_bacteria 2904728850 2904731262 246
90 iso_pr_bacteria 2958471994 2958474544 246
91 3300042596 Ga0466696_193625 Ga0466696_193625_9129_9872 247
92 3300042600 Ga0466700_458990 Ga0466700_458990_226_969 247
93 3300042618 Ga0466723_018543 Ga0466723_018543_1800_2543 247
94 3300002449 JGI24698J34947_10027104 JGI24698J34947_100271044 248
95 3300005201 Ga0072941_1001552 Ga0072941_100155226 248
96 3300005201 Ga0072941_1009065 Ga0072941_100906526 248
97 3300005201 Ga0072941_1009964 Ga0072941_10099646 248
98 3300042596 Ga0466696_022707 Ga0466696_022707_380_1126 248
99 3300042596 Ga0466696_041824 Ga0466696_041824_8419_9165 248
100 3300042596 Ga0466696_467424 Ga0466696_467424_385_1131 248
101 3300042616 Ga0466715_017700 Ga0466715_017700_5967_6713 248
102 3300042643 Ga0466704_344910 Ga0466704_344910_142_888 248
103 3300042605 Ga0466716_109340 Ga0466716_109340_4672_5421 249
104 iso_pr_bacteria 2820737921 2820739199 249
105 3300042610 Ga0466698_260130 Ga0466698_260130_182_940 252
106 3300042610 Ga0466698_214996 Ga0466698_214996_296_1063 255
107 3300042659 Ga0466733_055799 Ga0466733_055799_70017_70790 257
108 3300042611 Ga0466697_273293 Ga0466697_273293_113_898 261
109 3300042594 Ga0466694_076879 Ga0466694_076879_112_900 262
110 3300010049 Ga0123356_10805573 Ga0123356_108055732 280

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF14848 HU-DNA_bdg DNA-binding domain 50 171 0.96
PF14734 DUF4469 Domain of unknown function (DUF4469) with IG-like fold 179 270 0.94

βš›οΈ Structure & Feature Viewer

pLDDTpTMQuality
0.52 0.6 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.