Protein Family IF02952

Metagenome Metatranscriptome Isolate
176 Members
85 Samples
135 Scaffolds
146.02 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10804629|Ga0123356_108046293
Length
173 aa
Sequence
MRGMEQETGQFEWSRRQGISFGGMFIMKTFMAKPESYVNKRKWYVVDAEGLPLGRLASEVARVLHGKNKPDYTPHVDTGDHVIVVNAEKVLLTGKKLDQKMYRRHSGYAGGMKEIKYRHLMERMPERAIELAVKGMLPKNSLGRQIYRKLIVYKGAEHKNQAQKPEPLALNI*

📊 Sample Types

Isolate 23.3%
Metagenome 75.0%
MAG 0.0%
Metatranscriptome 1.7%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 41.0%
Termitidae 28.9%
Kalotermitidae 10.8%
Elmidae 2.4%
Rhinotermitidae 2.4%
Passalidae 2.4%
Drosophilidae 2.4%
Tenebrionidae 2.4%
Termopsidae 2.4%
Scarabaeidae 1.2%
Stratiomyidae 1.2%
Nephropidae 1.2%
Hodotermitidae 1.2%

🌳 Taxonomy

Archaea 1
Bacteria 160
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2843246524 Lysinibacillus sphaericus DSM 28 Isolate Unclassified
2 2864895409 Bacillus aerius S00152 Isolate Elmidae
3 2916858470 Heyndrickxia oleronia Isolate Unclassified
4 2791355481 Bacillus sp. ZY-1-1 Isolate Scarabaeidae
5 2820294436 Unclassified Firmicutes Th196P3bin104 Isolate Unclassified
6 2820321184 Unclassified Firmicutes Nt197P3bin86 Isolate Unclassified
7 2820387566 Unclassified Firmicutes Nt197P1bin1 Isolate Unclassified
8 2820679524 Unclassified Firmicutes Co191P1bin94 Isolate Unclassified
9 8030343600 Proteiniborus sp. MB09-C3 Isolate Stratiomyidae
10 8064531044 Terrisporobacter mayombei DSM 6539 Isolate Unclassified
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
13 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
14 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
15 2820272499 Unclassified Firmicutes Th196P3bin18 Isolate Unclassified
16 2820463629 Unclassified Firmicutes Lab288P3bin124 Isolate Unclassified
17 2820535361 Unclassified Firmicutes Lab288P1bin14 Isolate Unclassified
18 8064008355 Heyndrickxia oleronia Isolate Unclassified
19 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
20 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
21 2820353569 Unclassified Firmicutes Nt197P3bin28 Isolate Unclassified
22 2820539610 Unclassified Firmicutes Lab288P1bin136 Isolate Unclassified
23 2820613375 Unclassified Firmicutes Emb289P1bin134 Isolate Unclassified
24 2820636287 Unclassified Firmicutes Emb289P1bin112 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 8043041867 Bacillus pumilus Ha06YP001 Isolate Nephropidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
33 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
34 3300021227 Termite gut microbial communities from nest from French Guiana - 18-5 mRNA SA Metatranscriptome Termitidae
35 2820244222 Unclassified Firmicutes Th196P3bin75 Isolate Unclassified
36 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
37 2524614537 Lysinibacillus sphaericus OT4b.31 Isolate Unclassified
38 2751185832 Lysinibacillus sp. AR18-8 Isolate Unclassified
39 2820267566 Unclassified Firmicutes Th196P3bin33 Isolate Unclassified
40 2820460928 Unclassified Firmicutes Lab288P3bin140 Isolate Unclassified
41 2820570671 Unclassified Firmicutes Emb289P3bin19 Isolate Unclassified
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
46 3300022232 Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA Metatranscriptome Termitidae
47 2852123468 Lysinibacillus sphaericus KCCM 35418 Isolate Unclassified
48 2820935937 Unclassified Actinobacteria Emb289P1bin40 Isolate Unclassified
49 2820254385 Unclassified Firmicutes Th196P3bin54 Isolate Unclassified
50 2820004052 Unclassified Synergistetes Nt197P3bin25 Isolate Unclassified
51 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
52 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
53 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
54 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
55 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
56 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
57 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
58 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
59 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
60 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
61 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
62 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
63 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
64 2820231849 Unclassified Firmicutes Th196P4bin1 Isolate Unclassified
65 2820255904 Unclassified Firmicutes Th196P3bin48 Isolate Unclassified
66 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
67 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
68 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
69 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
70 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
71 2855361764 Lysinibacillus fusiformis Juneja Isolate Drosophilidae
72 2864909992 Bacillus velezensis S00166 Isolate Elmidae
73 2529293168 Ruminiclostridium cellobioparum termitidis CT1112 Isolate Termitidae
74 2820441105 Unclassified Firmicutes Lab288P3bin202 Isolate Unclassified
75 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
76 2820560510 Unclassified Firmicutes Emb289P3bin72 Isolate Unclassified
77 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
78 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
79 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
80 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
81 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
82 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
83 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
84 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
85 3300021217 Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA Metatranscriptome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_128083 3300042659 Bacteria 1743
2 Ga0466723_362088 3300042618 Unclassified 11561
3 Ga0466730_006343 3300042625 Bacteria 1215
4 Ga0233288_1044405 3300022232 Bacteria 958
5 Ga0415639_011643 3300038395 Bacteria 11792
6 Ga0415639_076410 3300038395 Bacteria 1411
7 Ga0123355_10020833 3300009826 Bacteria 10480
8 Ga0123356_10195991 3300010049 Bacteria 2055
9 Ga0123356_10581596 3300010049 Bacteria 1283
10 Ga0123356_10649935 3300010049 Bacteria 1222
11 Ga0123356_11951892 3300010049 Bacteria 731
12 Ga0123353_10188175 3300010167 Bacteria 3262
13 Ga0123353_10296026 3300010167 Bacteria 2474
14 Ga0466707_264425 3300042601 Bacteria 1038
15 Ga0466713_154533 3300042602 Bacteria 1102
16 Ga0466714_162086 3300042603 Bacteria 2775
17 Ga0466717_002756 3300042604 Bacteria 10812
18 Ga0072941_1650047 3300005201 Bacteria 908
19 Ga0466726_232487 3300042619 Bacteria 4543
20 Ga0466730_043167 3300042625 Bacteria 1128
21 Ga0466704_411261 3300042643 Bacteria 5218
22 Ga0415639_019907 3300038395 Bacteria 4906
23 Ga0466696_127352 3300042596 Bacteria 8928
24 Ga0123355_10258170 3300009826 Bacteria 2441
25 Ga0123356_12695488 3300010049 Bacteria 622
26 Ga0123353_10001891 3300010167 Bacteria 25727
27 Ga0123353_10892376 3300010167 Bacteria 1212
28 Ga0123353_12081199 3300010167 Bacteria 692
29 Ga0466706_092023 3300042599 Bacteria 5495
30 Ga0466698_115873 3300042610 Bacteria 1408
31 Ga0466697_048616 3300042611 Bacteria 1671
32 Ga0466726_496577 3300042619 Bacteria 1793
33 Ga0466729_043603 3300042621 Bacteria 7258
34 Ga0223687_116288 3300021217 Bacteria 646
35 Ga0415639_004593 3300038395 Bacteria 20307
36 Ga0123355_11110855 3300009826 Bacteria 821
37 Ga0123356_10000056 3300010049 Bacteria 120275
38 Ga0123356_10031337 3300010049 Unclassified 4976
39 Ga0123356_10574351 3300010049 Unclassified 1290
40 Ga0123356_13707140 3300010049 Bacteria 528
41 Ga0123353_10022046 3300010167 Bacteria 9583
42 Ga0123353_10595858 3300010167 Bacteria 1581
43 Ga0123354_10016320 3300010882 Bacteria 11635
44 Ga0466706_068968 3300042599 Unclassified 1478
45 Ga0466707_286231 3300042601 Bacteria 8108
46 IMNBL1DRAFT_c0001421 3300000062 Bacteria 17911
47 Ga0466697_115774 3300042611 Bacteria 2516
48 Ga0562376_0237 3300056857 Unclassified 108978
49 Ga0466731_152057 3300042622 Bacteria 1376
50 Ga0466731_211049 3300042622 Bacteria 2863
51 Ga0466703_381067 3300042636 Bacteria 8392
52 Ga0223688_1010942 3300021227 Bacteria 909
53 Ga0415639_096300 3300038395 Bacteria 6538
54 Ga0123355_10854640 3300009826 Bacteria 1000
55 Ga0123355_11189157 3300009826 Bacteria 780
56 Ga0123353_10129114 3300010167 Bacteria 4058
57 Ga0466706_037264 3300042599 Bacteria 1358
58 Ga0466719_533541 3300042606 Unclassified 1297
59 Ga0466721_007284 3300042608 Bacteria 1859
60 Ga0466721_090497 3300042608 Bacteria 167057
61 Ga0466722_022549 3300042609 Bacteria 126509
62 Ga0466722_065812 3300042609 Bacteria 1304
63 JGI24695J34938_10005204 3300002450 Unclassified 8215
64 JGI24702J35022_10001097 3300002462 Bacteria 16825
65 JGI24702J35022_10054506 3300002462 Bacteria 2133
66 Ga0466705_282480 3300042612 Bacteria 27901
67 Ga0466733_104376 3300042659 Bacteria 1514
68 Ga0466703_326192 3300042636 Bacteria 5797
69 Ga0415639_004899 3300038395 Bacteria 12664
70 Ga0415639_019906 3300038395 Bacteria 27443
71 Ga0123355_10002723 3300009826 Bacteria 25034
72 Ga0123356_10373326 3300010049 Bacteria 1557
73 Ga0123356_13730702 3300010049 Bacteria 526
74 Ga0123353_10010437 3300010167 Bacteria 12950
75 Ga0123353_10079670 3300010167 Archaea 5267
76 Ga0123353_10102632 3300010167 Bacteria 4610
77 Ga0123353_10172924 3300010167 Bacteria 3427
78 Ga0123353_10248603 3300010167 Bacteria 2756
79 Ga0123353_12379068 3300010167 Unclassified 634
80 Ga0466717_302256 3300042604 Bacteria 1891
81 Ga0466719_188481 3300042606 Bacteria 1105
82 2227641581 2225789004 Bacteria 2057
83 Ga0068302_10001008 3300005071 Bacteria 1452
84 Ga0466705_096912 3300042612 Bacteria 15671
85 Ga0562378_0002 3300056814 Bacteria 3519472
86 Ga0466715_374244 3300042616 Bacteria 19262
87 Ga0466729_305099 3300042621 Bacteria 3302
88 Ga0466656_177353 3300042550 Bacteria 2907
89 Ga0123355_11063672 3300009826 Bacteria 848
90 Ga0123356_10618912 3300010049 Bacteria 1248
91 Ga0123353_10115406 3300010167 Bacteria 4322
92 Ga0123353_10289876 3300010167 Unclassified 2507
93 Ga0123353_10605129 3300010167 Bacteria 1565
94 Ga0123354_10423069 3300010882 Bacteria 1105
95 Ga0466719_412175 3300042606 Unclassified 2626
96 Ga0466721_154685 3300042608 Bacteria 7172
97 Ga0466722_035400 3300042609 Bacteria 82053
98 Ga0466722_058780 3300042609 Bacteria 1458
99 Ga0466733_069873 3300042659 Bacteria 1638
100 Ga0466723_216956 3300042618 Bacteria 3856
101 Ga0466728_286808 3300042620 Bacteria 1958
102 Ga0466704_426592 3300042643 Unclassified 4034
103 Ga0466708_081554 3300042652 Bacteria 30455
104 Ga0123357_10098115 3300009784 Bacteria 3788
105 Ga0123357_10316077 3300009784 Bacteria 1551
106 Ga0123355_10314037 3300009826 Bacteria 2120
107 Ga0123355_10896610 3300009826 Bacteria 964
108 Ga0123356_10142644 3300010049 Bacteria 2365
109 Ga0123353_10603589 3300010167 Bacteria 1568
110 Ga0466714_098364 3300042603 Bacteria 5951
111 Ga0466714_168598 3300042603 Bacteria 1084
112 Ga0466722_201424 3300042609 Bacteria 1313
113 JGI24702J35022_10262372 3300002462 Bacteria 1008
114 Ga0466705_292187 3300042612 Bacteria 13639
115 Ga0466723_172529 3300042618 Bacteria 3515
116 Ga0466703_374310 3300042636 Bacteria 2253
117 Ga0466724_00380 3300042649 Unclassified 1160
118 Ga0264413_131734 3300024493 Bacteria 12949
119 Ga0415639_051883 3300038395 Unclassified 6549
120 Ga0123355_10030595 3300009826 Bacteria 8726
121 Ga0123355_10092529 3300009826 Bacteria 4789
122 Ga0123355_10095225 3300009826 Bacteria 4707
123 Ga0123356_10000196 3300010049 Bacteria 69725
124 Ga0123356_10804629 3300010049 Bacteria 1111
125 Ga0123353_10066104 3300010167 Bacteria 5804
126 Ga0123353_10103439 3300010167 Bacteria 4590
127 Ga0123353_10544911 3300010167 Bacteria 1675
128 Ga0123353_11676253 3300010167 Bacteria 798
129 Ga0466701_097433 3300042598 Bacteria 1646
130 Ga0466706_283625 3300042599 Bacteria 2281
131 Ga0466707_406938 3300042601 Bacteria 47814
132 Ga0466713_126608 3300042602 Bacteria 2610
133 Ga0466719_125541 3300042606 Unclassified 17631
134 IMNBL1DRAFT_c0008274 3300000062 Bacteria 5321
135 JGI24705J35276_12232236 3300002504 Unclassified 4239

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042608 Ga0466721_090497 Ga0466721_090497_91646_92062 138
2 3300042609 Ga0466722_065812 Ga0466722_065812_32_448 138
3 3300042609 Ga0466722_201424 Ga0466722_201424_582_998 138
4 3300010049 Ga0123356_10574351 Ga0123356_105743512 139
5 3300042603 Ga0466714_168598 Ga0466714_168598_423_842 139
6 3300042604 Ga0466717_002756 Ga0466717_002756_3972_4391 139
7 3300009826 Ga0123355_10002723 Ga0123355_1000272336 140
8 3300009826 Ga0123355_11189157 Ga0123355_111891571 140
9 3300010049 Ga0123356_10649935 Ga0123356_106499352 140
10 3300010167 Ga0123353_10296026 Ga0123353_102960263 140
11 3300042599 Ga0466706_092023 Ga0466706_092023_3313_3735 140
12 3300042601 Ga0466707_264425 Ga0466707_264425_84_506 140
13 3300042601 Ga0466707_286231 Ga0466707_286231_564_986 140
14 3300042603 Ga0466714_098364 Ga0466714_098364_157_579 140
15 3300042603 Ga0466714_162086 Ga0466714_162086_1689_2111 140
16 3300042606 Ga0466719_533541 Ga0466719_533541_445_867 140
17 3300042609 Ga0466722_022549 Ga0466722_022549_10835_11257 140
18 3300042612 Ga0466705_282480 Ga0466705_282480_22312_22734 140
19 3300042618 Ga0466723_172529 Ga0466723_172529_1935_2357 140
20 3300042618 Ga0466723_216956 Ga0466723_216956_2135_2557 140
21 3300042620 Ga0466728_286808 Ga0466728_286808_1427_1849 140
22 3300042621 Ga0466729_305099 Ga0466729_305099_1376_1798 140
23 3300042643 Ga0466704_426592 Ga0466704_426592_1577_1999 140
24 3300042649 Ga0466724_00380 Ga0466724_00380_232_654 140
25 3300042659 Ga0466733_104376 Ga0466733_104376_348_770 140
26 3300009826 Ga0123355_11110855 Ga0123355_111108551 141
27 3300010049 Ga0123356_10000056 Ga0123356_1000005610 141
28 2225789004 2227641581 2228231522 142
29 3300009784 Ga0123357_10098115 Ga0123357_100981155 142
30 3300009784 Ga0123357_10316077 Ga0123357_103160772 142
31 3300010167 Ga0123353_11676253 Ga0123353_116762531 142
32 3300010882 Ga0123354_10016320 Ga0123354_100163207 142
33 3300022232 Ga0233288_1044405 Ga0233288_10444051 142
34 3300038395 Ga0415639_004899 Ga0415639_004899_9542_9970 142
35 3300042599 Ga0466706_068968 Ga0466706_068968_904_1332 142
36 3300042599 Ga0466706_283625 Ga0466706_283625_54_482 142
37 3300042606 Ga0466719_125541 Ga0466719_125541_17108_17536 142
38 3300042606 Ga0466719_412175 Ga0466719_412175_2103_2531 142
39 3300042612 Ga0466705_096912 Ga0466705_096912_1023_1451 142
40 3300042612 Ga0466705_292187 Ga0466705_292187_3785_4213 142
41 3300042636 Ga0466703_326192 Ga0466703_326192_4012_4440 142
42 3300042636 Ga0466703_381067 Ga0466703_381067_2070_2498 142
43 3300042643 Ga0466704_411261 Ga0466704_411261_3048_3476 142
44 iso_pr_bacteria 2820254385 2820254395 142
45 iso_pr_bacteria 2820272499 2820275155 142
46 iso_pr_bacteria 2820460928 2820461695 142
47 iso_pr_bacteria 8030343600 8030344778 142
48 iso_pr_bacteria 8064531044 8064531067 142
49 3300002462 JGI24702J35022_10054506 JGI24702J35022_100545062 143
50 3300009826 Ga0123355_11063672 Ga0123355_110636722 143
51 3300010049 Ga0123356_10000196 Ga0123356_1000019648 143
52 3300010049 Ga0123356_10031337 Ga0123356_100313374 143
53 3300010049 Ga0123356_10195991 Ga0123356_101959913 143
54 3300010049 Ga0123356_10373326 Ga0123356_103733262 143
55 3300010049 Ga0123356_10581596 Ga0123356_105815962 143
56 3300010049 Ga0123356_13707140 Ga0123356_137071401 143
57 3300010167 Ga0123353_10079670 Ga0123353_100796707 143
58 3300010167 Ga0123353_10103439 Ga0123353_101034394 143
59 3300010167 Ga0123353_10129114 Ga0123353_101291143 143
60 3300010167 Ga0123353_10603589 Ga0123353_106035892 143
61 3300021227 Ga0223688_1010942 Ga0223688_10109421 143
62 3300024493 Ga0264413_131734 Ga0264413_13173413 143
63 3300042606 Ga0466719_188481 Ga0466719_188481_54_485 143
64 3300042619 Ga0466726_232487 Ga0466726_232487_3443_3874 143
65 3300042619 Ga0466726_496577 Ga0466726_496577_691_1122 143
66 3300042622 Ga0466731_152057 Ga0466731_152057_642_1073 143
67 iso_pr_bacteria 2820231849 2820233232 143
68 iso_pr_bacteria 2820255904 2820256327 143
69 3300002462 JGI24702J35022_10001097 JGI24702J35022_100010973 144
70 3300002504 JGI24705J35276_12232236 JGI24705J35276_122322364 144
71 3300009826 Ga0123355_10030595 Ga0123355_100305954 144
72 3300010049 Ga0123356_10142644 Ga0123356_101426441 144
73 3300038395 Ga0415639_096300 Ga0415639_096300_1256_1690 144
74 3300042596 Ga0466696_127352 Ga0466696_127352_4428_4862 144
75 3300042610 Ga0466698_115873 Ga0466698_115873_385_819 144
76 3300042611 Ga0466697_048616 Ga0466697_048616_637_1071 144
77 3300042616 Ga0466715_374244 Ga0466715_374244_2108_2542 144
78 iso_pr_bacteria 2529293168 2531451791 144
79 iso_pr_bacteria 2820570671 2820572036 144
80 iso_pr_bacteria 2916858470 2916863554 144
81 iso_pr_bacteria 8064008355 8064008531 144
82 3300009826 Ga0123355_10314037 Ga0123355_103140372 145
83 3300010049 Ga0123356_10618912 Ga0123356_106189121 145
84 3300010049 Ga0123356_12695488 Ga0123356_126954881 145
85 3300021217 Ga0223687_116288 Ga0223687_1162881 145
86 3300038395 Ga0415639_019906 Ga0415639_019906_14863_15300 145
87 3300038395 Ga0415639_019907 Ga0415639_019907_4132_4569 145
88 3300042608 Ga0466721_154685 Ga0466721_154685_2722_3159 145
89 3300042618 Ga0466723_362088 Ga0466723_362088_4235_4672 145
90 3300042636 Ga0466703_374310 Ga0466703_374310_310_747 145
91 iso_pr_bacteria 2524614537 2524835932 145
92 iso_pr_bacteria 2751185832 2753512123 145
93 iso_pr_bacteria 2767802234 2769328248 145
94 iso_pr_bacteria 2791355481 2794422430 145
95 iso_pr_bacteria 2820244222 2820244748 145
96 iso_pr_bacteria 2820387566 2820388118 145
97 iso_pr_bacteria 2820535361 2820536596 145
98 iso_pr_bacteria 2820613375 2820615097 145
99 iso_pr_bacteria 2843246524 2843246796 145
100 iso_pr_bacteria 2852123468 2852127049 145
101 iso_pr_bacteria 2855361764 2855365670 145
102 iso_pr_bacteria 2864895409 2864899324 145
103 iso_pr_bacteria 2864909992 2864914010 145
104 iso_pr_bacteria 8043041867 8043045516 145
105 3300000062 IMNBL1DRAFT_c0001421 IMNBL1DRAFT_000142114 146
106 3300000062 IMNBL1DRAFT_c0008274 IMNBL1DRAFT_00082744 146
107 3300005071 Ga0068302_10001008 Ga0068302_100010083 146
108 3300009826 Ga0123355_10095225 Ga0123355_100952256 146
109 3300010167 Ga0123353_10115406 Ga0123353_101154063 146
110 3300010167 Ga0123353_10188175 Ga0123353_101881751 146
111 3300010167 Ga0123353_10248603 Ga0123353_102486034 146
112 3300010167 Ga0123353_10544911 Ga0123353_105449111 146
113 3300042602 Ga0466713_154533 Ga0466713_154533_15_455 146
114 3300042621 Ga0466729_043603 Ga0466729_043603_1254_1694 146
115 3300042659 Ga0466733_069873 Ga0466733_069873_434_874 146
116 3300042659 Ga0466733_128083 Ga0466733_128083_729_1169 146
117 iso_pr_bacteria 2820004052 2820005422 146
118 iso_pr_bacteria 2820453354 2820455020 146
119 iso_pr_bacteria 2820463629 2820464172 146
120 iso_pr_bacteria 2820560510 2820561385 146
121 3300002462 JGI24702J35022_10262372 JGI24702J35022_102623722 147
122 3300010167 Ga0123353_10172924 Ga0123353_101729243 147
123 3300010167 Ga0123353_12081199 Ga0123353_120811991 147
124 3300010882 Ga0123354_10423069 Ga0123354_104230692 147
125 3300042609 Ga0466722_058780 Ga0466722_058780_890_1333 147
126 3300042622 Ga0466731_211049 Ga0466731_211049_1285_1728 147
127 3300056814 Ga0562378_0002 Ga0562378_0002_1099646_1100089 147
128 3300056857 Ga0562376_0237 Ga0562376_0237_26278_26721 147
129 iso_pr_bacteria 2820294436 2820296050 147
130 iso_pr_bacteria 2820321184 2820323030 147
131 3300009826 Ga0123355_10896610 Ga0123355_108966101 148
132 3300010167 Ga0123353_10102632 Ga0123353_101026322 148
133 3300042652 Ga0466708_081554 Ga0466708_081554_25639_26085 148
134 iso_pr_bacteria 2820441105 2820441868 148
135 iso_pr_bacteria 2820497731 2820497807 148
136 iso_pr_bacteria 2820669764 2820670567 148
137 iso_pr_bacteria 2820679524 2820679817 148
138 3300002450 JGI24695J34938_10005204 JGI24695J34938_100052043 149
139 3300009826 Ga0123355_10258170 Ga0123355_102581702 149
140 3300010167 Ga0123353_10010437 Ga0123353_100104376 149
141 3300010167 Ga0123353_10595858 Ga0123353_105958581 149
142 3300010167 Ga0123353_12379068 Ga0123353_123790682 149
143 3300038395 Ga0415639_011643 Ga0415639_011643_2630_3079 149
144 3300038395 Ga0415639_051883 Ga0415639_051883_4705_5154 149
145 3300038395 Ga0415639_076410 Ga0415639_076410_543_992 149
146 3300042550 Ga0466656_177353 Ga0466656_177353_1611_2060 149
147 iso_pr_bacteria 2820267566 2820269251 149
148 iso_pr_bacteria 2820463629 2820464670 149
149 iso_pr_bacteria 2820539610 2820540801 149
150 3300042604 Ga0466717_302256 Ga0466717_302256_651_1103 150
151 iso_pr_bacteria 2820636287 2820636798 150
152 3300009826 Ga0123355_10854640 Ga0123355_108546401 151
153 3300010167 Ga0123353_10022046 Ga0123353_100220467 151
154 3300010167 Ga0123353_10289876 Ga0123353_102898762 151
155 3300042609 Ga0466722_035400 Ga0466722_035400_41355_41810 151
156 iso_pr_bacteria 2820935937 2820936555 151
157 3300009826 Ga0123355_10020833 Ga0123355_100208336 152
158 3300010167 Ga0123353_10066104 Ga0123353_100661042 152
159 3300010167 Ga0123353_10892376 Ga0123353_108923762 152
160 3300038395 Ga0415639_004593 Ga0415639_004593_15030_15488 152
161 3300005201 Ga0072941_1650047 Ga0072941_16500472 153
162 3300010049 Ga0123356_13730702 Ga0123356_137307021 153
163 3300042608 Ga0466721_007284 Ga0466721_007284_45_506 153
164 3300042611 Ga0466697_115774 Ga0466697_115774_1318_1785 155
165 iso_pr_bacteria 2820353569 2820355803 155
166 3300042625 Ga0466730_006343 Ga0466730_006343_650_1120 156
167 3300042625 Ga0466730_043167 Ga0466730_043167_400_870 156
168 3300010049 Ga0123356_11951892 Ga0123356_119518921 157
169 3300010167 Ga0123353_10605129 Ga0123353_106051291 161
170 3300042599 Ga0466706_037264 Ga0466706_037264_767_1252 161
171 3300009826 Ga0123355_10092529 Ga0123355_100925292 165
172 3300010167 Ga0123353_10001891 Ga0123353_1000189115 168
173 3300042601 Ga0466707_406938 Ga0466707_406938_44488_44994 168
174 3300010049 Ga0123356_10804629 Ga0123356_108046293 173
175 3300042598 Ga0466701_097433 Ga0466701_097433_174_695 173
176 3300042602 Ga0466713_126608 Ga0466713_126608_1419_1952 177

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00572 Ribosomal_L13 Ribosomal protein L13 41 159 0.99

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.87 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.