Protein Family IF02936

Metagenome Metatranscriptome Isolate
201 Members
70 Samples
183 Scaffolds
104.11 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10582477|Ga0123356_105824771
Length
99 aa
Sequence
MIIASVNEMPGKKYEVLGLAKGSVVQSKHVGKDFMAGLKTIVGGEIKGYTEMLDEARVIATDRMKGADAIVGVRYASAAVMQNAAEIVAYGTAVKFVD*

📊 Sample Types

Isolate 9.0%
Metagenome 90.0%
MAG 0.0%
Metatranscriptome 1.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 35.8%
Unclassified 28.4%
Kalotermitidae 19.4%
Rhinotermitidae 6.0%
Termopsidae 6.0%
Passalidae 3.0%
Blaberidae 1.5%

🌳 Taxonomy

Archaea 1
Bacteria 157
Eukaryota 0
Viruses 0
Unclassified 43

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820453354 Unclassified Firmicutes Lab288P3bin172 Isolate Unclassified
2 2820537337 Unclassified Firmicutes Lab288P1bin137 Isolate Unclassified
3 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 2820360414 Unclassified Firmicutes Nt197P3bin121 Isolate Unclassified
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
14 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
15 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 2820501819 Unclassified Firmicutes Lab288P1bin51 Isolate Unclassified
22 2820607737 Unclassified Firmicutes Emb289P1bin48 Isolate Unclassified
23 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
24 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
25 2820285501 Unclassified Firmicutes Th196P3bin142 Isolate Unclassified
26 2820339298 Unclassified Firmicutes Nt197P3bin68 Isolate Unclassified
27 2820495292 Unclassified Firmicutes Lab288P1bin59 Isolate Unclassified
28 2820709481 Unclassified Firmicutes Co191P1bin30 Isolate Unclassified
29 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
30 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
31 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300042550 Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 Metagenome Termitidae
37 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
38 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
39 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
40 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
41 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
42 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
43 2772190975 Treponema sp. RmG30 Isolate Blaberidae
44 2820340373 Unclassified Firmicutes Nt197P3bin67 Isolate Unclassified
45 2820483401 Unclassified Firmicutes Lab288P1bin74 Isolate Unclassified
46 2820681712 Unclassified Firmicutes Co191P1bin84 Isolate Unclassified
47 2820364642 Unclassified Firmicutes Nt197P3bin107 Isolate Unclassified
48 2820431532 Unclassified Firmicutes Lab288P3bin230 Isolate Unclassified
49 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
50 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
51 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
52 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
53 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
54 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
55 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
56 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
57 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
58 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
59 2820469612 Unclassified Firmicutes Lab288P1bin92 Isolate Unclassified
60 2820499546 Unclassified Firmicutes Lab288P1bin54 Isolate Unclassified
61 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
62 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
63 3300021245 Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA Metatranscriptome Termitidae
64 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
65 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
66 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
67 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
68 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
69 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
70 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_296150 3300042601 Bacteria 1161
2 Ga0466716_015042 3300042605 Bacteria 1247
3 Ga0123355_10451216 3300009826 Bacteria 1620
4 Ga0223683_1018493 3300021245 Bacteria 719
5 Ga0466690_430563 3300042590 Bacteria 2031
6 Ga0466692_028359 3300042591 Unclassified 1895
7 Ga0466693_113986 3300042592 Bacteria 32625
8 IMNBL1DRAFT_c0005968 3300000062 Archaea 6806
9 JGI24698J34947_10005820 3300002449 Bacteria 6759
10 JGI24698J34947_10239761 3300002449 Bacteria 684
11 JGI24702J35022_10458536 3300002462 Bacteria 777
12 Ga0072940_1002692 3300005200 Bacteria 4943
13 Ga0072941_1032198 3300005201 Bacteria 3697
14 Ga0466729_230051 3300042621 Bacteria 1274
15 Ga0466704_026742 3300042643 Bacteria 13486
16 Ga0466704_318424 3300042643 Bacteria 13590
17 Ga0466727_139333 3300042655 Bacteria 2415
18 Ga0466705_393359 3300042612 Bacteria 10401
19 Ga0466712_065816 3300042614 Bacteria 1376
20 Ga0466711_112573 3300042615 Bacteria 3197
21 Ga0466715_185144 3300042616 Bacteria 7232
22 Ga0466723_036916 3300042618 Bacteria 2250
23 Ga0466726_047709 3300042619 Bacteria 11387
24 Ga0466713_077395 3300042602 Bacteria 1900
25 Ga0466720_028370 3300042607 Bacteria 1028
26 Ga0466720_041328 3300042607 Bacteria 5422
27 Ga0466722_072985 3300042609 Bacteria 33307
28 Ga0123355_10884364 3300009826 Bacteria 975
29 Ga0466694_046914 3300042594 Bacteria 2969
30 Ga0466694_270218 3300042594 Bacteria 3002
31 2227593529 2225789004 Unclassified 2401
32 JGI24698J34947_10000512 3300002449 Unclassified 18252
33 JGI24698J34947_10002573 3300002449 Bacteria 9796
34 JGI24698J34947_10005432 3300002449 Unclassified 6991
35 JGI24705J35276_12006597 3300002504 Bacteria 855
36 Ga0466704_249026 3300042643 Unclassified 2479
37 Ga0466725_170215 3300042654 Bacteria 2316
38 Ga0466727_038545 3300042655 Unclassified 3326
39 Ga0466712_023838 3300042614 Bacteria 27673
40 Ga0466715_137770 3300042616 Bacteria 2131
41 Ga0466715_539147 3300042616 Bacteria 3720
42 Ga0466723_080143 3300042618 Bacteria 5565
43 Ga0466723_214293 3300042618 Unclassified 1027
44 Ga0466729_174382 3300042621 Bacteria 1139
45 Ga0466732_139373 3300042656 Unclassified 1972
46 Ga0466716_079232 3300042605 Unclassified 1069
47 Ga0466719_125905 3300042606 Bacteria 11099
48 Ga0466719_460211 3300042606 Bacteria 1012
49 Ga0466720_139266 3300042607 Bacteria 1157
50 Ga0466722_227896 3300042609 Bacteria 14216
51 Ga0123355_10009416 3300009826 Bacteria 14846
52 Ga0123355_10354279 3300009826 Bacteria 1941
53 Ga0123355_10818458 3300009826 Unclassified 1034
54 Ga0123355_10956357 3300009826 Unclassified 918
55 Ga0466690_252376 3300042590 Bacteria 3304
56 Ga0466696_319523 3300042596 Unclassified 1104
57 AustNasuHG_c1000838 3300000089 Bacteria 11032
58 JGI24698J34947_10187200 3300002449 Unclassified 822
59 JGI24695J34938_10228785 3300002450 Unclassified 783
60 Ga0072940_1051824 3300005200 Bacteria 1603
61 Ga0466703_321048 3300042636 Bacteria 44056
62 Ga0466723_149815 3300042618 Bacteria 17280
63 Ga0466726_063965 3300042619 Unclassified 2290
64 Ga0466726_354563 3300042619 Unclassified 1055
65 Ga0466728_348499 3300042620 Bacteria 1082
66 Ga0466729_043560 3300042621 Bacteria 1014
67 Ga0466732_109385 3300042656 Bacteria 1511
68 Ga0466716_030994 3300042605 Bacteria 8597
69 Ga0466716_053810 3300042605 Bacteria 1707
70 Ga0466716_244511 3300042605 Bacteria 11044
71 Ga0466716_444536 3300042605 Bacteria 7069
72 Ga0466722_087874 3300042609 Unclassified 1802
73 Ga0123355_10538648 3300009826 Bacteria 1418
74 Ga0123355_10985798 3300009826 Unclassified 898
75 Ga0123355_11188268 3300009826 Bacteria 780
76 Ga0123355_11686630 3300009826 Bacteria 605
77 Ga0123356_10305004 3300010049 Bacteria 1699
78 Ga0123356_10582477 3300010049 Bacteria 1282
79 Ga0123353_10097005 3300010167 Unclassified 4751
80 Ga0264413_111751 3300024493 Unclassified 3132
81 Ga0456237_0021872 3300041968 Unclassified 882
82 Ga0466690_227364 3300042590 Bacteria 1469
83 Ga0466692_163004 3300042591 Bacteria 30267
84 Ga0466696_416751 3300042596 Unclassified 1206
85 Ga0466699_421262 3300042597 Bacteria 1666
86 AustNasuHG_c1001009 3300000089 Bacteria 10139
87 JGI24698J34947_10001954 3300002449 Bacteria 10990
88 Ga0072941_1074108 3300005201 Bacteria 2181
89 Ga0466727_259984 3300042655 Bacteria 1898
90 Ga0466711_080190 3300042615 Bacteria 1537
91 Ga0466711_129317 3300042615 Bacteria 24582
92 Ga0466726_315771 3300042619 Unclassified 1356
93 Ga0466728_457296 3300042620 Bacteria 126268
94 Ga0466705_228415 3300042612 Bacteria 12286
95 Ga0123355_10727025 3300009826 Bacteria 1130
96 Ga0223677_1014900 3300021239 Unclassified 743
97 Ga0415639_044817 3300038395 Bacteria 1108
98 Ga0466656_205442 3300042550 Bacteria 1007
99 Ga0466692_036145 3300042591 Bacteria 11192
100 Ga0466696_311361 3300042596 Bacteria 2164
101 JGI24698J34947_10004689 3300002449 Bacteria 7459
102 Ga0072941_1052030 3300005201 Bacteria 5113
103 Ga0466735_106240 3300042624 Unclassified 3746
104 Ga0466730_066963 3300042625 Bacteria 3259
105 Ga0466703_025731 3300042636 Bacteria 7379
106 Ga0466704_179589 3300042643 Unclassified 4070
107 Ga0466726_031010 3300042619 Bacteria 3923
108 Ga0466726_321861 3300042619 Bacteria 1368
109 Ga0466729_028069 3300042621 Bacteria 1275
110 Ga0466733_060249 3300042659 Bacteria 2418
111 Ga0466722_035963 3300042609 Bacteria 1288
112 Ga0466722_152093 3300042609 Bacteria 2638
113 Ga0123355_10020986 3300009826 Bacteria 10445
114 Ga0123355_10074282 3300009826 Unclassified 5446
115 Ga0123355_10246168 3300009826 Bacteria 2524
116 Ga0123355_11777947 3300009826 Unclassified 583
117 Ga0123356_11349057 3300010049 Bacteria 875
118 Ga0123353_12144260 3300010167 Bacteria 678
119 Ga0264413_113639 3300024493 Bacteria 2870
120 Ga0415639_012729 3300038395 Bacteria 1886
121 Ga0466691_037123 3300042593 Bacteria 7340
122 Ga0466694_360514 3300042594 Bacteria 1071
123 Ga0466695_211384 3300042595 Bacteria 31275
124 JGI24698J34947_10014206 3300002449 Unclassified 4336
125 JGI24702J35022_10082020 3300002462 Unclassified 1748
126 JGI24703J35330_11418759 3300002501 Bacteria 985
127 Ga0072940_1025292 3300005200 Unclassified 1161
128 Ga0072940_1126586 3300005200 Bacteria 1199
129 Ga0466735_036767 3300042624 Bacteria 1148
130 Ga0466703_109925 3300042636 Bacteria 32972
131 Ga0466704_301502 3300042643 Bacteria 29784
132 Ga0466708_111835 3300042652 Bacteria 4376
133 Ga0466708_178486 3300042652 Bacteria 1850
134 Ga0466727_196877 3300042655 Bacteria 1163
135 Ga0466705_525050 3300042612 Unclassified 21069
136 Ga0466712_016115 3300042614 Bacteria 1315
137 Ga0466726_148225 3300042619 Bacteria 3872
138 Ga0466732_338466 3300042656 Bacteria 2594
139 Ga0466717_083902 3300042604 Bacteria 4745
140 Ga0466716_308397 3300042605 Bacteria 2277
141 Ga0466720_066773 3300042607 Bacteria 1817
142 Ga0123355_10074718 3300009826 Bacteria 5429
143 Ga0123355_10457825 3300009826 Bacteria 1603
144 Ga0123355_11937902 3300009826 Bacteria 549
145 Ga0415639_109609 3300038395 Bacteria 2829
146 Ga0466690_004050 3300042590 Bacteria 2854
147 Ga0466690_167092 3300042590 Unclassified 1019
148 Ga0466692_134177 3300042591 Bacteria 1651
149 Ga0466691_153929 3300042593 Unclassified 1486
150 Ga0466696_170926 3300042596 Bacteria 1866
151 Ga0466699_132677 3300042597 Bacteria 3888
152 AustNasuHG_c1005320 3300000089 Unclassified 4599
153 JGI24698J34947_10297120 3300002449 Bacteria 584
154 Ga0466735_225334 3300042624 Bacteria 1841
155 Ga0466703_250075 3300042636 Bacteria 10660
156 Ga0466727_048816 3300042655 Bacteria 1910
157 Ga0466727_253356 3300042655 Bacteria 1509
158 Ga0466727_339762 3300042655 Bacteria 2139
159 Ga0466712_061245 3300042614 Unclassified 14111
160 Ga0466712_121721 3300042614 Unclassified 5430
161 Ga0466712_173885 3300042614 Bacteria 11067
162 Ga0466711_045046 3300042615 Bacteria 8362
163 Ga0466711_182079 3300042615 Unclassified 2601
164 Ga0466723_339390 3300042618 Bacteria 1634
165 Ga0466726_149493 3300042619 Bacteria 1769
166 Ga0123355_10024101 3300009826 Bacteria 9775
167 Ga0123356_10134135 3300010049 Bacteria 2431
168 Ga0123353_10003882 3300010167 Bacteria 19089
169 Ga0456237_0006607 3300041968 Bacteria 1811
170 Ga0466690_070349 3300042590 Bacteria 2640
171 Ga0466690_192192 3300042590 Unclassified 1765
172 Ga0466690_319457 3300042590 Bacteria 1303
173 Ga0466692_022918 3300042591 Unclassified 1358
174 Ga0466696_181928 3300042596 Unclassified 1177
175 JGI24702J35022_10012799 3300002462 Bacteria 4655
176 Ga0068302_10074706 3300005071 Bacteria 2949
177 Ga0072941_1261715 3300005201 Bacteria 790
178 Ga0466704_120978 3300042643 Bacteria 4234
179 Ga0466704_228786 3300042643 Bacteria 2546
180 Ga0466712_085598 3300042614 Unclassified 2467
181 Ga0466712_130820 3300042614 Unclassified 1167
182 Ga0466726_200604 3300042619 Bacteria 1111
183 Ga0466726_364051 3300042619 Bacteria 1242

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042621 Ga0466729_174382 Ga0466729_174382_242_529 95
2 3300010049 Ga0123356_10582477 Ga0123356_105824771 99
3 iso_pr_bacteria 2820340373 2820341162 101
4 iso_pr_bacteria 2820495292 2820495610 102
5 2225789004 2227593529 2228154612 103
6 3300010049 Ga0123356_10134135 Ga0123356_101341353 103
7 3300021239 Ga0223677_1014900 Ga0223677_10149002 103
8 3300024493 Ga0264413_111751 Ga0264413_1117514 103
9 3300024493 Ga0264413_113639 Ga0264413_1136393 103
10 3300038395 Ga0415639_012729 Ga0415639_012729_523_834 103
11 3300041968 Ga0456237_0006607 Ga0456237_0006607_1041_1352 103
12 3300041968 Ga0456237_0021872 Ga0456237_0021872_300_611 103
13 3300042550 Ga0466656_205442 Ga0466656_205442_516_827 103
14 3300042590 Ga0466690_070349 Ga0466690_070349_2017_2328 103
15 3300042590 Ga0466690_192192 Ga0466690_192192_319_630 103
16 3300042590 Ga0466690_319457 Ga0466690_319457_665_976 103
17 3300042590 Ga0466690_430563 Ga0466690_430563_1187_1498 103
18 3300042591 Ga0466692_022918 Ga0466692_022918_414_725 103
19 3300042591 Ga0466692_028359 Ga0466692_028359_1536_1847 103
20 3300042591 Ga0466692_036145 Ga0466692_036145_249_560 103
21 3300042591 Ga0466692_134177 Ga0466692_134177_428_739 103
22 3300042591 Ga0466692_163004 Ga0466692_163004_17959_18270 103
23 3300042593 Ga0466691_153929 Ga0466691_153929_688_999 103
24 3300042594 Ga0466694_046914 Ga0466694_046914_1590_1901 103
25 3300042595 Ga0466695_211384 Ga0466695_211384_30513_30824 103
26 3300042596 Ga0466696_319523 Ga0466696_319523_382_693 103
27 3300042596 Ga0466696_416751 Ga0466696_416751_385_696 103
28 3300042597 Ga0466699_421262 Ga0466699_421262_867_1178 103
29 3300042601 Ga0466707_296150 Ga0466707_296150_22_333 103
30 3300042605 Ga0466716_015042 Ga0466716_015042_683_994 103
31 3300042605 Ga0466716_030994 Ga0466716_030994_378_689 103
32 3300042605 Ga0466716_053810 Ga0466716_053810_272_583 103
33 3300042605 Ga0466716_079232 Ga0466716_079232_319_630 103
34 3300042605 Ga0466716_244511 Ga0466716_244511_188_499 103
35 3300042605 Ga0466716_444536 Ga0466716_444536_4560_4871 103
36 3300042606 Ga0466719_125905 Ga0466719_125905_7144_7455 103
37 3300042607 Ga0466720_028370 Ga0466720_028370_549_860 103
38 3300042607 Ga0466720_041328 Ga0466720_041328_1787_2098 103
39 3300042607 Ga0466720_066773 Ga0466720_066773_1404_1715 103
40 3300042607 Ga0466720_139266 Ga0466720_139266_490_801 103
41 3300042609 Ga0466722_035963 Ga0466722_035963_788_1099 103
42 3300042609 Ga0466722_072985 Ga0466722_072985_19024_19335 103
43 3300042609 Ga0466722_087874 Ga0466722_087874_418_729 103
44 3300042609 Ga0466722_152093 Ga0466722_152093_720_1031 103
45 3300042609 Ga0466722_227896 Ga0466722_227896_9245_9556 103
46 3300042612 Ga0466705_393359 Ga0466705_393359_5266_5577 103
47 3300042612 Ga0466705_525050 Ga0466705_525050_15690_16001 103
48 3300042614 Ga0466712_016115 Ga0466712_016115_595_906 103
49 3300042614 Ga0466712_023838 Ga0466712_023838_24835_25146 103
50 3300042614 Ga0466712_061245 Ga0466712_061245_8709_9020 103
51 3300042614 Ga0466712_065816 Ga0466712_065816_973_1284 103
52 3300042614 Ga0466712_085598 Ga0466712_085598_1535_1846 103
53 3300042614 Ga0466712_121721 Ga0466712_121721_573_884 103
54 3300042614 Ga0466712_130820 Ga0466712_130820_742_1053 103
55 3300042614 Ga0466712_173885 Ga0466712_173885_10563_10874 103
56 3300042615 Ga0466711_045046 Ga0466711_045046_7847_8158 103
57 3300042615 Ga0466711_080190 Ga0466711_080190_1139_1450 103
58 3300042615 Ga0466711_112573 Ga0466711_112573_597_908 103
59 3300042615 Ga0466711_182079 Ga0466711_182079_1035_1346 103
60 3300042616 Ga0466715_185144 Ga0466715_185144_2013_2324 103
61 3300042618 Ga0466723_036916 Ga0466723_036916_1322_1633 103
62 3300042618 Ga0466723_080143 Ga0466723_080143_372_683 103
63 3300042618 Ga0466723_149815 Ga0466723_149815_14802_15113 103
64 3300042618 Ga0466723_214293 Ga0466723_214293_529_840 103
65 3300042619 Ga0466726_031010 Ga0466726_031010_895_1206 103
66 3300042619 Ga0466726_063965 Ga0466726_063965_165_476 103
67 3300042619 Ga0466726_148225 Ga0466726_148225_677_988 103
68 3300042619 Ga0466726_149493 Ga0466726_149493_811_1122 103
69 3300042619 Ga0466726_200604 Ga0466726_200604_532_843 103
70 3300042619 Ga0466726_315771 Ga0466726_315771_527_838 103
71 3300042619 Ga0466726_321861 Ga0466726_321861_838_1149 103
72 3300042619 Ga0466726_354563 Ga0466726_354563_553_864 103
73 3300042620 Ga0466728_348499 Ga0466728_348499_623_934 103
74 3300042621 Ga0466729_028069 Ga0466729_028069_416_727 103
75 3300042621 Ga0466729_230051 Ga0466729_230051_201_512 103
76 3300042624 Ga0466735_225334 Ga0466735_225334_660_971 103
77 3300042636 Ga0466703_025731 Ga0466703_025731_3342_3653 103
78 3300042636 Ga0466703_250075 Ga0466703_250075_3903_4214 103
79 3300042636 Ga0466703_321048 Ga0466703_321048_31040_31351 103
80 3300042643 Ga0466704_026742 Ga0466704_026742_7173_7484 103
81 3300042643 Ga0466704_120978 Ga0466704_120978_1441_1752 103
82 3300042643 Ga0466704_179589 Ga0466704_179589_796_1107 103
83 3300042643 Ga0466704_249026 Ga0466704_249026_1166_1477 103
84 3300042643 Ga0466704_318424 Ga0466704_318424_9197_9508 103
85 3300042652 Ga0466708_111835 Ga0466708_111835_1252_1563 103
86 3300042652 Ga0466708_178486 Ga0466708_178486_1494_1805 103
87 3300042654 Ga0466725_170215 Ga0466725_170215_1994_2305 103
88 3300042655 Ga0466727_038545 Ga0466727_038545_1814_2125 103
89 3300042655 Ga0466727_139333 Ga0466727_139333_1714_2025 103
90 3300042655 Ga0466727_259984 Ga0466727_259984_14_325 103
91 3300042655 Ga0466727_339762 Ga0466727_339762_169_480 103
92 3300042656 Ga0466732_109385 Ga0466732_109385_572_883 103
93 3300042656 Ga0466732_139373 Ga0466732_139373_1340_1651 103
94 3300042659 Ga0466733_060249 Ga0466733_060249_220_531 103
95 iso_pr_bacteria 2781125682 2781409418 103
96 iso_pr_bacteria 2820285501 2820285772 103
97 iso_pr_bacteria 2820339298 2820339528 103
98 iso_pr_bacteria 2820360414 2820360502 103
99 iso_pr_bacteria 2820431532 2820432369 103
100 iso_pr_bacteria 2820453354 2820455247 103
101 iso_pr_bacteria 2820469612 2820471116 103
102 iso_pr_bacteria 2820483401 2820485851 103
103 iso_pr_bacteria 2820499546 2820499962 103
104 iso_pr_bacteria 2820537337 2820538792 103
105 iso_pr_bacteria 2820607737 2820609424 103
106 iso_pr_bacteria 2820681712 2820682407 103
107 iso_pr_bacteria 2820709481 2820710050 103
108 3300000062 IMNBL1DRAFT_c0005968 IMNBL1DRAFT_00059683 104
109 3300000089 AustNasuHG_c1000838 AustNasuHG_100083810 104
110 3300000089 AustNasuHG_c1001009 AustNasuHG_10010099 104
111 3300000089 AustNasuHG_c1005320 AustNasuHG_10053208 104
112 3300002449 JGI24698J34947_10000512 JGI24698J34947_100005121 104
113 3300002449 JGI24698J34947_10002573 JGI24698J34947_100025739 104
114 3300002449 JGI24698J34947_10004689 JGI24698J34947_100046897 104
115 3300002449 JGI24698J34947_10005432 JGI24698J34947_100054326 104
116 3300002449 JGI24698J34947_10005820 JGI24698J34947_100058207 104
117 3300002449 JGI24698J34947_10014206 JGI24698J34947_100142063 104
118 3300002449 JGI24698J34947_10187200 JGI24698J34947_101872002 104
119 3300002449 JGI24698J34947_10239761 JGI24698J34947_102397612 104
120 3300002449 JGI24698J34947_10297120 JGI24698J34947_102971202 104
121 3300002450 JGI24695J34938_10228785 JGI24695J34938_102287852 104
122 3300002462 JGI24702J35022_10012799 JGI24702J35022_100127996 104
123 3300002462 JGI24702J35022_10082020 JGI24702J35022_100820203 104
124 3300002462 JGI24702J35022_10458536 JGI24702J35022_104585361 104
125 3300002501 JGI24703J35330_11418759 JGI24703J35330_114187592 104
126 3300005071 Ga0068302_10074706 Ga0068302_100747062 104
127 3300005200 Ga0072940_1002692 Ga0072940_10026923 104
128 3300005200 Ga0072940_1025292 Ga0072940_10252922 104
129 3300005200 Ga0072940_1051824 Ga0072940_10518244 104
130 3300005200 Ga0072940_1126586 Ga0072940_11265861 104
131 3300005201 Ga0072941_1032198 Ga0072941_10321984 104
132 3300005201 Ga0072941_1052030 Ga0072941_10520302 104
133 3300005201 Ga0072941_1074108 Ga0072941_10741083 104
134 3300009826 Ga0123355_10020986 Ga0123355_1002098612 104
135 3300009826 Ga0123355_10024101 Ga0123355_100241012 104
136 3300009826 Ga0123355_10074282 Ga0123355_100742827 104
137 3300009826 Ga0123355_10074718 Ga0123355_100747185 104
138 3300009826 Ga0123355_10354279 Ga0123355_103542794 104
139 3300009826 Ga0123355_10538648 Ga0123355_105386482 104
140 3300009826 Ga0123355_10727025 Ga0123355_107270252 104
141 3300009826 Ga0123355_10818458 Ga0123355_108184582 104
142 3300009826 Ga0123355_10884364 Ga0123355_108843641 104
143 3300009826 Ga0123355_10956357 Ga0123355_109563572 104
144 3300009826 Ga0123355_10985798 Ga0123355_109857982 104
145 3300009826 Ga0123355_11937902 Ga0123355_119379022 104
146 3300010049 Ga0123356_10305004 Ga0123356_103050042 104
147 3300010049 Ga0123356_11349057 Ga0123356_113490572 104
148 3300010167 Ga0123353_10003882 Ga0123353_1000388216 104
149 3300010167 Ga0123353_10097005 Ga0123353_100970052 104
150 3300010167 Ga0123353_12144260 Ga0123353_121442603 104
151 3300021245 Ga0223683_1018493 Ga0223683_10184932 104
152 3300038395 Ga0415639_044817 Ga0415639_044817_207_521 104
153 3300038395 Ga0415639_109609 Ga0415639_109609_789_1103 104
154 3300042594 Ga0466694_270218 Ga0466694_270218_2374_2688 104
155 3300042604 Ga0466717_083902 Ga0466717_083902_3776_4090 104
156 3300042605 Ga0466716_308397 Ga0466716_308397_1613_1927 104
157 3300042612 Ga0466705_228415 Ga0466705_228415_7310_7624 104
158 3300042620 Ga0466728_457296 Ga0466728_457296_102875_103189 104
159 3300042655 Ga0466727_253356 Ga0466727_253356_1183_1497 104
160 iso_pr_bacteria 2820364642 2820366608 104
161 iso_pr_bacteria 2820501819 2820504572 104
162 3300002449 JGI24698J34947_10001954 JGI24698J34947_1000195411 105
163 3300002504 JGI24705J35276_12006597 JGI24705J35276_120065971 105
164 3300009826 Ga0123355_10451216 Ga0123355_104512162 105
165 3300009826 Ga0123355_10457825 Ga0123355_104578253 105
166 3300009826 Ga0123355_11686630 Ga0123355_116866302 105
167 3300009826 Ga0123355_11777947 Ga0123355_117779472 105
168 3300042592 Ga0466693_113986 Ga0466693_113986_9447_9764 105
169 3300042597 Ga0466699_132677 Ga0466699_132677_3364_3681 105
170 3300042602 Ga0466713_077395 Ga0466713_077395_1184_1501 105
171 3300042618 Ga0466723_339390 Ga0466723_339390_685_1002 105
172 3300042619 Ga0466726_047709 Ga0466726_047709_7747_8064 105
173 3300042625 Ga0466730_066963 Ga0466730_066963_1742_2059 105
174 3300042655 Ga0466727_196877 Ga0466727_196877_660_977 105
175 3300005201 Ga0072941_1261715 Ga0072941_12617151 106
176 3300009826 Ga0123355_11188268 Ga0123355_111882683 106
177 3300042594 Ga0466694_360514 Ga0466694_360514_592_912 106
178 3300042596 Ga0466696_181928 Ga0466696_181928_598_918 106
179 3300042615 Ga0466711_129317 Ga0466711_129317_1178_1498 106
180 3300042619 Ga0466726_364051 Ga0466726_364051_444_764 106
181 3300042621 Ga0466729_043560 Ga0466729_043560_59_379 106
182 iso_pr_bacteria 2772190975 2773722018 106
183 3300042590 Ga0466690_004050 Ga0466690_004050_454_780 108
184 3300042590 Ga0466690_167092 Ga0466690_167092_379_705 108
185 3300042590 Ga0466690_227364 Ga0466690_227364_434_760 108
186 3300042590 Ga0466690_252376 Ga0466690_252376_2959_3285 108
187 3300042596 Ga0466696_170926 Ga0466696_170926_1164_1490 108
188 3300042596 Ga0466696_311361 Ga0466696_311361_860_1186 108
189 3300042616 Ga0466715_137770 Ga0466715_137770_428_754 108
190 3300042616 Ga0466715_539147 Ga0466715_539147_1198_1524 108
191 3300042624 Ga0466735_036767 Ga0466735_036767_810_1136 108
192 3300042624 Ga0466735_106240 Ga0466735_106240_1661_1987 108
193 3300042636 Ga0466703_109925 Ga0466703_109925_10971_11297 108
194 3300042655 Ga0466727_048816 Ga0466727_048816_817_1143 108
195 3300042656 Ga0466732_338466 Ga0466732_338466_1836_2162 108
196 3300009826 Ga0123355_10246168 Ga0123355_102461684 109
197 3300042643 Ga0466704_301502 Ga0466704_301502_26129_26464 111
198 3300042593 Ga0466691_037123 Ga0466691_037123_2644_2991 115
199 3300042606 Ga0466719_460211 Ga0466719_460211_380_727 115
200 3300042643 Ga0466704_228786 Ga0466704_228786_552_899 115
201 3300009826 Ga0123355_10009416 Ga0123355_100094163 123

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01906 YbjQ_1 Putative heavy-metal-binding 1 95 0.98

🏗️ Structural Annotation – Top 5 Hits

IDDescriptionScoreStartEnd
2o26-assembly2.cif.gz_W Structure of a class III RTK signaling assembly 0.744 73 95
8dfm-assembly1.cif.gz_A Ectodomain of full-length wild-type KIT-SCF dimers 0.703 73 92
1vr4-assembly1.cif.gz_B Crystal Structure of MCSG TArget APC22750 from Bacillus cereus 0.702 1 95
8dfp-assembly1.cif.gz_B Ectodomain of full-length KIT(DupA502,Y503)-SCF dimers 0.663 73 92
5k59-assembly2.cif.gz_L Crystal structure of LukGH from Staphylococcus aureus in complex with a neutralising antibody 0.651 73 95
IDDescriptionScoreStartEndSuperfamily
af_Q9DBK0_304_553_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.7608 70 92 3.30.530.20
af_Q8BJ95_36_136_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6858 73 92 2.60.40.10
af_U4PBJ9_1658_1748_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6701 73 96 2.60.40.10
af_A0A0R4IFS1_141_237_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6509 73 98 2.60.40.10
4ztpL02 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6304 72 94 2.60.40.10
IDDescriptionScoreStartEndGO Terms
AF-F8AJK1-F1-model_v4 Uncharacterized/unreviewed 0.7537 2 98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.54 0.67 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.