Protein Family IF02923

Metagenome Metatranscriptome Isolate
205 Members
82 Samples
181 Scaffolds
97.55 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_10492614|Ga0123356_104926142
Length
107 aa
Sequence
MTTNIVRSTVGKGYDIIIRPVLSEKSFSTIKQKMYTFEVHKDATKPQIKKAVEEVFKVKVEKVNTANYDGKPKRHGRSEGTRPDWKKAYVQLTKESKPIEFFESLQ*

📊 Sample Types

Isolate 11.7%
Metagenome 86.3%
MAG 0.0%
Metatranscriptome 1.9%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 32.1%
Unclassified 23.1%
Kalotermitidae 16.7%
Apidae 7.7%
Termopsidae 5.1%
Rhinotermitidae 3.8%
Passalidae 3.8%
Drosophilidae 1.3%
Hodotermitidae 1.3%
Formicidae 1.3%
Tenebrionidae 1.3%
Scarabaeidae 1.3%
Culicidae 1.3%

🌳 Taxonomy

Archaea 0
Bacteria 192
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2902668162 Lacticaseibacillus paracasei DmW_181 Isolate Drosophilidae
2 2820252425 Unclassified Firmicutes Th196P3bin6 Isolate Unclassified
3 2820468515 Unclassified Firmicutes Lab288P1bin95 Isolate Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300021244 Termite gut microbial communities from nest from French Guiana - 12-6 mRNA SA Metatranscriptome Termitidae
8 3300022820 Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA Metatranscriptome Termitidae
9 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
10 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
11 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
12 2820476618 Unclassified Firmicutes Lab288P1bin80 Isolate Unclassified
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 651324002 Acetonema longum APO-1, DSM 6540 Isolate Kalotermitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
18 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 2065487013 Fungus-growing termite worker microbial communities from South Africa - Oerleman's Farm Metagenome
25 2820651690 Unclassified Firmicutes Cu122P3bin6 Isolate Unclassified
26 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
30 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
32 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
33 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
38 2820497731 Unclassified Firmicutes Lab288P1bin55 Isolate Unclassified
39 2820572885 Unclassified Firmicutes Emb289P3bin161 Isolate Unclassified
40 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
41 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
42 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
43 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
44 3300012798 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E6 MG Metagenome
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300026175 Army ant gut microbial communities from Eciton burchelli, Monteverde, Costa Rica - colony MVEbp1 Metagenome Formicidae
47 2636416028 Pelosinus propionicus DSM 13327 Isolate Unclassified
48 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
49 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
50 2989309576 Sporomusa termitida DSM 4440 Isolate Unclassified
51 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae
52 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
53 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
54 3300021240 Termite gut microbial communities from nest from French Guiana - 11-5 mRNA SA Metatranscriptome Termitidae
55 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
56 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
57 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
58 2820669764 Unclassified Firmicutes Co191P3bin30 Isolate Unclassified
59 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
60 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
61 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
62 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
63 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
64 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
65 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
66 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
67 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
68 2820903739 Unclassified Actinobacteria Emb289P4bin49 Isolate Unclassified
69 2852337885 Paenibacillus protaetiae FW100M-2 Isolate Scarabaeidae
70 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
71 2820576413 Unclassified Firmicutes Emb289P3bin136 Isolate Unclassified
72 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
73 2225789003 Passalidae beetle gut microbial communities from Costa Rica -Larvae (2ML+2BL) Metagenome Passalidae
74 2820506701 Unclassified Firmicutes Lab288P1bin46 Isolate Unclassified
75 2820525019 Unclassified Firmicutes Lab288P1bin2 Isolate Unclassified
76 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
77 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
78 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
79 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
80 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
81 3300000062 Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) Metagenome Passalidae
82 3300012813 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E11 MG Metagenome Culicidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466735_074178 3300042624 Bacteria 1218
2 Ga0466735_135663 3300042624 Bacteria 1187
3 Ga0466704_073736 3300042643 Bacteria 9570
4 Ga0466727_034751 3300042655 Bacteria 11324
5 Ga0160470_100276 3300012813 Bacteria 34847
6 Ga0466691_209977 3300042593 Bacteria 1320
7 Ga0466699_409111 3300042597 Bacteria 2759
8 Ga0123355_10230801 3300009826 Bacteria 2643
9 Ga0123355_10270954 3300009826 Bacteria 2359
10 Ga0123355_11301774 3300009826 Bacteria 729
11 Ga0123356_11364932 3300010049 Bacteria 870
12 Ga0123356_11937522 3300010049 Bacteria 734
13 Ga0123356_12889394 3300010049 Bacteria 601
14 Ga0123353_10017331 3300010167 Bacteria 10582
15 Ga0123353_10119969 3300010167 Bacteria 4229
16 Ga0123353_10124561 3300010167 Bacteria 4142
17 Ga0123353_11293518 3300010167 Bacteria 947
18 Ga0123353_11742143 3300010167 Bacteria 778
19 Ga0123353_12337374 3300010167 Bacteria 641
20 FGTW_contig14754 2065487013 Bacteria 961
21 IMNBL1DRAFT_c0001685 3300000062 Bacteria 16309
22 JGI24698J34947_10033203 3300002449 Bacteria 2708
23 Ga0072941_1553550 3300005201 Bacteria 1132
24 Ga0466715_339223 3300042616 Bacteria 59419
25 Ga0466718_080151 3300042617 Bacteria 3259
26 Ga0466726_190545 3300042619 Bacteria 5076
27 Ga0466697_010722 3300042611 Bacteria 1023
28 Ga0466731_176795 3300042622 Bacteria 2227
29 Ga0466709_109609 3300042648 Bacteria 1941
30 Ga0466708_084964 3300042652 Bacteria 3228
31 Ga0466691_201130 3300042593 Bacteria 16704
32 Ga0466694_183507 3300042594 Bacteria 1259
33 Ga0123355_10022600 3300009826 Bacteria 10083
34 Ga0123355_10112402 3300009826 Bacteria 4251
35 Ga0123355_10725260 3300009826 Bacteria 1132
36 Ga0123355_10769257 3300009826 Bacteria 1083
37 Ga0123356_11405905 3300010049 Bacteria 858
38 Ga0123353_12000879 3300010167 Bacteria 710
39 JGI24695J34938_10000226 3300002450 Bacteria 53266
40 Ga0072941_1213393 3300005201 Bacteria 645
41 Ga0074278_142794 3300005721 Bacteria 8443
42 Ga0466711_181111 3300042615 Bacteria 1435
43 Ga0466711_189579 3300042615 Bacteria 1540
44 Ga0466715_571989 3300042616 Bacteria 2307
45 Ga0466726_207501 3300042619 Bacteria 8201
46 Ga0466726_424569 3300042619 Bacteria 1220
47 Ga0466706_155979 3300042599 Bacteria 1978
48 Ga0466707_136777 3300042601 Bacteria 2281
49 Ga0466714_121100 3300042603 Unclassified 3077
50 Ga0466697_156514 3300042611 Bacteria 1167
51 Ga0466705_115618 3300042612 Bacteria 24638
52 Ga0466705_137566 3300042612 Bacteria 2802
53 Ga0466708_094476 3300042652 Unclassified 3077
54 Ga0466708_215505 3300042652 Bacteria 16232
55 Ga0264413_134817 3300024493 Bacteria 3183
56 Ga0466696_369917 3300042596 Bacteria 1114
57 Ga0123357_10193154 3300009784 Bacteria 2339
58 Ga0123355_10290401 3300009826 Bacteria 2245
59 Ga0123355_11975833 3300009826 Bacteria 542
60 Ga0123356_10122097 3300010049 Bacteria 2536
61 Ga0123356_10492614 3300010049 Bacteria 1380
62 Ga0123356_10817814 3300010049 Bacteria 1103
63 Ga0123354_10543163 3300010882 Unclassified 881
64 2227569076 2225789004 Bacteria 14054
65 Ga0466718_148149 3300042617 Bacteria 6754
66 Ga0466726_411353 3300042619 Bacteria 1844
67 Ga0466726_452480 3300042619 Bacteria 13818
68 Ga0466728_017461 3300042620 Bacteria 2635
69 Ga0466705_271435 3300042612 Bacteria 3563
70 Ga0466735_116906 3300042624 Bacteria 1237
71 Ga0466708_207293 3300042652 Bacteria 33526
72 Ga0223684_1062946 3300021240 Bacteria 587
73 Ga0415639_051277 3300038395 Bacteria 20381
74 Ga0123355_10010726 3300009826 Bacteria 14078
75 Ga0123355_10276050 3300009826 Bacteria 2327
76 Ga0123355_10424356 3300009826 Bacteria 1697
77 Ga0123355_10632316 3300009826 Bacteria 1257
78 Ga0123355_11367303 3300009826 Bacteria 703
79 Ga0123356_10011213 3300010049 Bacteria 8751
80 Ga0123356_11042455 3300010049 Bacteria 987
81 Ga0123356_13723486 3300010049 Bacteria 527
82 Ga0123353_11069572 3300010167 Bacteria 1075
83 Ga0123353_11921284 3300010167 Bacteria 729
84 Ga0123354_10356485 3300010882 Unclassified 1296
85 JGI24702J35022_10001245 3300002462 Bacteria 15858
86 Ga0123357_10003044 3300009784 Bacteria 19002
87 Ga0466711_345094 3300042615 Bacteria 14257
88 Ga0466711_425700 3300042615 Bacteria 6307
89 Ga0466715_375631 3300042616 Bacteria 2571
90 Ga0466723_043688 3300042618 Bacteria 3654
91 Ga0466723_202062 3300042618 Bacteria 13376
92 Ga0466726_353337 3300042619 Bacteria 59989
93 Ga0466707_159504 3300042601 Bacteria 2640
94 Ga0466713_021451 3300042602 Bacteria 1707
95 Ga0466717_151415 3300042604 Unclassified 1554
96 Ga0466716_367538 3300042605 Bacteria 2860
97 Ga0415639_067653 3300038395 Unclassified 17962
98 Ga0415639_113417 3300038395 Bacteria 1347
99 Ga0466692_078337 3300042591 Bacteria 9721
100 Ga0123355_10093265 3300009826 Bacteria 4766
101 Ga0123355_10477545 3300009826 Bacteria 1553
102 Ga0123356_10364430 3300010049 Bacteria 1573
103 Ga0123356_11229873 3300010049 Bacteria 914
104 Ga0123356_12235595 3300010049 Bacteria 684
105 Ga0123353_10054303 3300010167 Bacteria 6406
106 Ga0123353_10167597 3300010167 Bacteria 3490
107 Ga0123353_10670500 3300010167 Bacteria 1463
108 JGI24696J40584_12864744 3300002834 Bacteria 1024
109 Ga0466726_449942 3300042619 Unclassified 2157
110 Ga0466728_468143 3300042620 Unclassified 1143
111 Ga0466701_089953 3300042598 Bacteria 1512
112 Ga0466706_135974 3300042599 Bacteria 1820
113 Ga0562377_0060 3300056842 Bacteria 477040
114 Ga0255572_1000024 3300026175 Bacteria 128087
115 Ga0415639_048393 3300038395 Unclassified 1986
116 Ga0415639_182586 3300038395 Bacteria 1179
117 Ga0466693_207011 3300042592 Bacteria 1213
118 Ga0466693_273731 3300042592 Unclassified 2931
119 Ga0123355_10125205 3300009826 Bacteria 3973
120 Ga0123355_10568096 3300009826 Bacteria 1362
121 Ga0123355_10771796 3300009826 Bacteria 1080
122 Ga0123356_10006092 3300010049 Bacteria 12232
123 Ga0123353_10146720 3300010167 Bacteria 3772
124 Ga0123353_10613023 3300010167 Bacteria 1552
125 Ga0123353_11103112 3300010167 Bacteria 1053
126 Ga0123353_11303630 3300010167 Bacteria 943
127 Ga0160454_100150 3300012798 Bacteria 83122
128 JGI24696J40584_12451043 3300002834 Unclassified 576
129 Ga0072941_1334393 3300005201 Bacteria 857
130 Ga0466705_411844 3300042612 Bacteria 13683
131 Ga0466715_097471 3300042616 Bacteria 21526
132 Ga0466715_586248 3300042616 Bacteria 20520
133 Ga0466726_189863 3300042619 Bacteria 7257
134 Ga0466726_408314 3300042619 Bacteria 25305
135 Ga0466726_442289 3300042619 Bacteria 1057
136 Ga0466728_008267 3300042620 Bacteria 4652
137 Ga0466728_127136 3300042620 Bacteria 23734
138 Ga0466729_028580 3300042621 Bacteria 5717
139 Ga0466700_194933 3300042600 Bacteria 1185
140 Ga0466707_151385 3300042601 Bacteria 1579
141 Ga0466722_136872 3300042609 Bacteria 1953
142 Ga0466705_095369 3300042612 Bacteria 1630
143 Ga0466732_368493 3300042656 Bacteria 1446
144 Ga0466735_073169 3300042624 Bacteria 1011
145 Ga0466694_241440 3300042594 Bacteria 37091
146 Ga0123356_10002129 3300010049 Bacteria 21360
147 Ga0123356_10688493 3300010049 Bacteria 1191
148 Ga0123356_12066937 3300010049 Bacteria 711
149 Ga0123353_10390111 3300010167 Bacteria 2078
150 Ga0123353_12987881 3300010167 Bacteria 548
151 2227022067 2225789003 Bacteria 1011
152 IMNBL1DRAFT_c0000311 3300000062 Bacteria 41422
153 Ga0068302_10006864 3300005071 Bacteria 2932
154 Ga0466711_044977 3300042615 Bacteria 1187
155 Ga0466711_184685 3300042615 Bacteria 9250
156 Ga0466707_237827 3300042601 Bacteria 1695
157 Ga0466703_240203 3300042636 Unclassified 1914
158 Ga0466708_274375 3300042652 Bacteria 21022
159 Ga0223686_1085537 3300021244 Bacteria 708
160 Ga0255809_1004751 3300022820 Bacteria 1808
161 Ga0255809_1004753 3300022820 Bacteria 745
162 Ga0415639_042410 3300038395 Bacteria 1989
163 Ga0466691_056146 3300042593 Bacteria 34897
164 Ga0123355_10000012 3300009826 Bacteria 181780
165 Ga0123355_10021485 3300009826 Bacteria 10331
166 Ga0123355_10409068 3300009826 Bacteria 1743
167 Ga0123356_10337073 3300010049 Bacteria 1627
168 Ga0123356_10582665 3300010049 Bacteria 1282
169 Ga0123356_11811019 3300010049 Bacteria 759
170 Ga0123353_10564971 3300010167 Bacteria 1637
171 Ga0123353_10916889 3300010167 Unclassified 1190
172 Ga0123354_10670078 3300010882 Bacteria 734
173 JGI24702J35022_10149150 3300002462 Bacteria 1311
174 Ga0466711_051724 3300042615 Bacteria 11431
175 Ga0466711_257614 3300042615 Bacteria 3272
176 Ga0466723_030317 3300042618 Bacteria 4106
177 Ga0466723_315712 3300042618 Bacteria 6485
178 Ga0466706_049052 3300042599 Bacteria 1424
179 Ga0466707_281543 3300042601 Bacteria 1906
180 Ga0466714_147613 3300042603 Bacteria 2504
181 Ga0466698_219164 3300042610 Bacteria 2445

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227569076 2228112744 86
2 3300000062 IMNBL1DRAFT_c0001685 IMNBL1DRAFT_00016854 87
3 3300009784 Ga0123357_10193154 Ga0123357_101931541 92
4 2225789003 2227022067 2227383896 94
5 3300042601 Ga0466707_237827 Ga0466707_237827_1165_1449 94
6 3300042624 Ga0466735_073169 Ga0466735_073169_378_662 94
7 3300042624 Ga0466735_135663 Ga0466735_135663_361_645 94
8 3300000062 IMNBL1DRAFT_c0000311 IMNBL1DRAFT_00003115 95
9 3300005201 Ga0072941_1334393 Ga0072941_13343932 95
10 3300026175 Ga0255572_1000024 Ga0255572_100002483 95
11 3300042591 Ga0466692_078337 Ga0466692_078337_4979_5266 95
12 3300042598 Ga0466701_089953 Ga0466701_089953_319_606 95
13 3300042599 Ga0466706_049052 Ga0466706_049052_90_377 95
14 3300042599 Ga0466706_155979 Ga0466706_155979_1311_1598 95
15 3300042619 Ga0466726_353337 Ga0466726_353337_11631_11918 95
16 3300056842 Ga0562377_0060 Ga0562377_0060_231649_231936 95
17 iso_pr_bacteria 2636416028 2638994541 95
18 iso_pr_bacteria 2820525019 2820525070 95
19 iso_pr_bacteria 2989309576 2989309638 95
20 iso_pr_bacteria 651324002 651577852 95
21 3300009826 Ga0123355_10010726 Ga0123355_100107261 96
22 3300009826 Ga0123355_10125205 Ga0123355_101252054 96
23 3300009826 Ga0123355_10230801 Ga0123355_102308014 96
24 3300009826 Ga0123355_10276050 Ga0123355_102760504 96
25 3300009826 Ga0123355_10409068 Ga0123355_104090682 96
26 3300009826 Ga0123355_10477545 Ga0123355_104775453 96
27 3300009826 Ga0123355_10725260 Ga0123355_107252602 96
28 3300009826 Ga0123355_11975833 Ga0123355_119758332 96
29 3300010049 Ga0123356_11405905 Ga0123356_114059052 96
30 3300010167 Ga0123353_12337374 Ga0123353_123373742 96
31 3300010882 Ga0123354_10670078 Ga0123354_106700782 96
32 3300021240 Ga0223684_1062946 Ga0223684_10629462 96
33 3300021244 Ga0223686_1085537 Ga0223686_10855372 96
34 3300038395 Ga0415639_051277 Ga0415639_051277_870_1160 96
35 3300042592 Ga0466693_273731 Ga0466693_273731_2435_2725 96
36 3300042594 Ga0466694_183507 Ga0466694_183507_232_522 96
37 3300042597 Ga0466699_409111 Ga0466699_409111_1691_1981 96
38 3300042612 Ga0466705_411844 Ga0466705_411844_8499_8789 96
39 3300042615 Ga0466711_425700 Ga0466711_425700_1964_2254 96
40 3300042619 Ga0466726_189863 Ga0466726_189863_6374_6664 96
41 3300042619 Ga0466726_190545 Ga0466726_190545_594_884 96
42 3300042620 Ga0466728_008267 Ga0466728_008267_725_1015 96
43 3300042620 Ga0466728_127136 Ga0466728_127136_3037_3327 96
44 iso_pr_bacteria 2820468515 2820468747 96
45 iso_pr_bacteria 2820476618 2820476856 96
46 iso_pr_bacteria 2820497731 2820498476 96
47 iso_pr_bacteria 2820506701 2820507221 96
48 iso_pr_bacteria 2820669764 2820669797 96
49 iso_pr_bacteria 2852337885 2852341539 96
50 3300002450 JGI24695J34938_10000226 JGI24695J34938_1000022632 97
51 3300002462 JGI24702J35022_10149150 JGI24702J35022_101491502 97
52 3300009826 Ga0123355_10000012 Ga0123355_1000001288 97
53 3300009826 Ga0123355_10021485 Ga0123355_100214855 97
54 3300009826 Ga0123355_10093265 Ga0123355_100932653 97
55 3300009826 Ga0123355_10112402 Ga0123355_101124024 97
56 3300009826 Ga0123355_10270954 Ga0123355_102709542 97
57 3300009826 Ga0123355_10424356 Ga0123355_104243563 97
58 3300009826 Ga0123355_10568096 Ga0123355_105680963 97
59 3300009826 Ga0123355_10632316 Ga0123355_106323162 97
60 3300010049 Ga0123356_10002129 Ga0123356_1000212912 97
61 3300010049 Ga0123356_10364430 Ga0123356_103644302 97
62 3300010049 Ga0123356_11042455 Ga0123356_110424551 97
63 3300010049 Ga0123356_11229873 Ga0123356_112298732 97
64 3300010049 Ga0123356_11937522 Ga0123356_119375222 97
65 3300010049 Ga0123356_12066937 Ga0123356_120669372 97
66 3300010167 Ga0123353_10017331 Ga0123353_100173312 97
67 3300010167 Ga0123353_10613023 Ga0123353_106130233 97
68 3300010167 Ga0123353_10916889 Ga0123353_109168892 97
69 3300010167 Ga0123353_11921284 Ga0123353_119212842 97
70 3300010167 Ga0123353_12000879 Ga0123353_120008792 97
71 3300010167 Ga0123353_12987881 Ga0123353_129878812 97
72 3300024493 Ga0264413_134817 Ga0264413_1348174 97
73 3300038395 Ga0415639_042410 Ga0415639_042410_1433_1726 97
74 3300038395 Ga0415639_048393 Ga0415639_048393_671_964 97
75 3300038395 Ga0415639_067653 Ga0415639_067653_50_343 97
76 3300038395 Ga0415639_113417 Ga0415639_113417_700_993 97
77 3300038395 Ga0415639_182586 Ga0415639_182586_246_539 97
78 3300042594 Ga0466694_241440 Ga0466694_241440_4924_5217 97
79 3300042601 Ga0466707_136777 Ga0466707_136777_1221_1514 97
80 3300042617 Ga0466718_080151 Ga0466718_080151_1874_2167 97
81 3300042617 Ga0466718_148149 Ga0466718_148149_28_321 97
82 3300042656 Ga0466732_368493 Ga0466732_368493_434_727 97
83 iso_pr_bacteria 2820572885 2820573063 97
84 iso_pr_bacteria 2820903739 2820904301 97
85 2065487013 FGTW_contig14754 FGTW_02212090 98
86 3300002449 JGI24698J34947_10033203 JGI24698J34947_100332035 98
87 3300009784 Ga0123357_10003044 Ga0123357_100030443 98
88 3300009826 Ga0123355_10022600 Ga0123355_100226003 98
89 3300009826 Ga0123355_10769257 Ga0123355_107692572 98
90 3300009826 Ga0123355_10771796 Ga0123355_107717962 98
91 3300009826 Ga0123355_11301774 Ga0123355_113017742 98
92 3300010049 Ga0123356_10011213 Ga0123356_1001121310 98
93 3300010049 Ga0123356_10582665 Ga0123356_105826653 98
94 3300010167 Ga0123353_10124561 Ga0123353_101245613 98
95 3300010167 Ga0123353_11742143 Ga0123353_117421432 98
96 3300012798 Ga0160454_100150 Ga0160454_10015039 98
97 3300012813 Ga0160470_100276 Ga0160470_1002762 98
98 3300022820 Ga0255809_1004751 Ga0255809_10047513 98
99 3300022820 Ga0255809_1004753 Ga0255809_10047532 98
100 3300042592 Ga0466693_207011 Ga0466693_207011_478_774 98
101 3300042593 Ga0466691_201130 Ga0466691_201130_1823_2119 98
102 3300042593 Ga0466691_209977 Ga0466691_209977_163_459 98
103 3300042596 Ga0466696_369917 Ga0466696_369917_683_979 98
104 3300042599 Ga0466706_135974 Ga0466706_135974_153_449 98
105 3300042600 Ga0466700_194933 Ga0466700_194933_450_746 98
106 3300042601 Ga0466707_151385 Ga0466707_151385_1021_1317 98
107 3300042601 Ga0466707_159504 Ga0466707_159504_576_872 98
108 3300042601 Ga0466707_281543 Ga0466707_281543_1527_1823 98
109 3300042602 Ga0466713_021451 Ga0466713_021451_880_1176 98
110 3300042603 Ga0466714_121100 Ga0466714_121100_11_307 98
111 3300042603 Ga0466714_147613 Ga0466714_147613_164_460 98
112 3300042604 Ga0466717_151415 Ga0466717_151415_1183_1479 98
113 3300042605 Ga0466716_367538 Ga0466716_367538_774_1070 98
114 3300042609 Ga0466722_136872 Ga0466722_136872_54_350 98
115 3300042611 Ga0466697_010722 Ga0466697_010722_126_422 98
116 3300042612 Ga0466705_095369 Ga0466705_095369_186_482 98
117 3300042612 Ga0466705_115618 Ga0466705_115618_21555_21851 98
118 3300042612 Ga0466705_137566 Ga0466705_137566_1834_2130 98
119 3300042612 Ga0466705_271435 Ga0466705_271435_1935_2231 98
120 3300042615 Ga0466711_044977 Ga0466711_044977_31_327 98
121 3300042615 Ga0466711_051724 Ga0466711_051724_8535_8831 98
122 3300042615 Ga0466711_181111 Ga0466711_181111_1125_1421 98
123 3300042615 Ga0466711_184685 Ga0466711_184685_1828_2124 98
124 3300042615 Ga0466711_189579 Ga0466711_189579_1016_1312 98
125 3300042615 Ga0466711_257614 Ga0466711_257614_1202_1498 98
126 3300042615 Ga0466711_345094 Ga0466711_345094_11845_12141 98
127 3300042616 Ga0466715_097471 Ga0466715_097471_19092_19388 98
128 3300042616 Ga0466715_339223 Ga0466715_339223_1762_2058 98
129 3300042616 Ga0466715_375631 Ga0466715_375631_1757_2053 98
130 3300042616 Ga0466715_571989 Ga0466715_571989_1769_2065 98
131 3300042616 Ga0466715_586248 Ga0466715_586248_19712_20008 98
132 3300042618 Ga0466723_030317 Ga0466723_030317_409_705 98
133 3300042618 Ga0466723_043688 Ga0466723_043688_2398_2694 98
134 3300042618 Ga0466723_202062 Ga0466723_202062_1803_2099 98
135 3300042618 Ga0466723_315712 Ga0466723_315712_1974_2270 98
136 3300042619 Ga0466726_207501 Ga0466726_207501_1776_2072 98
137 3300042619 Ga0466726_408314 Ga0466726_408314_1750_2046 98
138 3300042619 Ga0466726_411353 Ga0466726_411353_915_1211 98
139 3300042619 Ga0466726_424569 Ga0466726_424569_43_339 98
140 3300042619 Ga0466726_442289 Ga0466726_442289_50_346 98
141 3300042619 Ga0466726_449942 Ga0466726_449942_20_316 98
142 3300042620 Ga0466728_017461 Ga0466728_017461_1292_1588 98
143 3300042620 Ga0466728_468143 Ga0466728_468143_579_875 98
144 3300042621 Ga0466729_028580 Ga0466729_028580_4675_4971 98
145 3300042622 Ga0466731_176795 Ga0466731_176795_849_1145 98
146 3300042624 Ga0466735_074178 Ga0466735_074178_527_823 98
147 3300042624 Ga0466735_116906 Ga0466735_116906_624_920 98
148 3300042636 Ga0466703_240203 Ga0466703_240203_1147_1443 98
149 3300042643 Ga0466704_073736 Ga0466704_073736_7484_7780 98
150 3300042648 Ga0466709_109609 Ga0466709_109609_646_942 98
151 3300042652 Ga0466708_084964 Ga0466708_084964_1827_2123 98
152 3300042652 Ga0466708_094476 Ga0466708_094476_877_1173 98
153 3300042652 Ga0466708_207293 Ga0466708_207293_1757_2053 98
154 3300042652 Ga0466708_215505 Ga0466708_215505_15318_15614 98
155 3300042652 Ga0466708_274375 Ga0466708_274375_18041_18337 98
156 3300042655 Ga0466727_034751 Ga0466727_034751_1916_2212 98
157 iso_pr_bacteria 2597490239 2598798879 98
158 iso_pr_bacteria 2600255079 2600868871 98
159 iso_pr_bacteria 2645727657 2646404694 98
160 iso_pr_bacteria 2663763384 2666812636 98
161 iso_pr_bacteria 2820252425 2820253088 98
162 iso_pr_bacteria 2820576413 2820577941 98
163 iso_pr_bacteria 2824199081 2824200262 98
164 iso_pr_bacteria 2865982043 2865983477 98
165 iso_pr_bacteria 2865983822 2865985149 98
166 3300002462 JGI24702J35022_10001245 JGI24702J35022_100012453 99
167 3300002834 JGI24696J40584_12451043 JGI24696J40584_124510432 99
168 3300002834 JGI24696J40584_12864744 JGI24696J40584_128647442 99
169 3300005071 Ga0068302_10006864 Ga0068302_100068643 99
170 3300005201 Ga0072941_1213393 Ga0072941_12133932 99
171 3300005201 Ga0072941_1553550 Ga0072941_15535502 99
172 3300009826 Ga0123355_10290401 Ga0123355_102904015 99
173 3300010049 Ga0123356_10006092 Ga0123356_1000609210 99
174 3300010049 Ga0123356_10122097 Ga0123356_101220975 99
175 3300010049 Ga0123356_10817814 Ga0123356_108178142 99
176 3300010049 Ga0123356_13723486 Ga0123356_137234861 99
177 3300010167 Ga0123353_10054303 Ga0123353_100543038 99
178 3300010167 Ga0123353_10119969 Ga0123353_101199693 99
179 3300010167 Ga0123353_10146720 Ga0123353_101467205 99
180 3300010167 Ga0123353_10167597 Ga0123353_101675972 99
181 3300010167 Ga0123353_10390111 Ga0123353_103901114 99
182 3300010167 Ga0123353_11069572 Ga0123353_110695722 99
183 3300010167 Ga0123353_11103112 Ga0123353_111031122 99
184 3300010167 Ga0123353_11293518 Ga0123353_112935182 99
185 3300010167 Ga0123353_11303630 Ga0123353_113036302 99
186 3300010882 Ga0123354_10356485 Ga0123354_103564851 99
187 3300010882 Ga0123354_10543163 Ga0123354_105431632 99
188 3300042593 Ga0466691_056146 Ga0466691_056146_32750_33049 99
189 3300042610 Ga0466698_219164 Ga0466698_219164_565_864 99
190 3300042611 Ga0466697_156514 Ga0466697_156514_767_1066 99
191 3300010049 Ga0123356_11364932 Ga0123356_113649322 100
192 3300010049 Ga0123356_12235595 Ga0123356_122355952 100
193 3300010049 Ga0123356_12889394 Ga0123356_128893942 100
194 3300042619 Ga0466726_452480 Ga0466726_452480_11726_12028 100
195 iso_pr_bacteria 2902668162 2902669880 100
196 iso_pr_bacteria 8032009961 8032011110 100
197 3300005721 Ga0074278_142794 Ga0074278_14279419 101
198 3300009826 Ga0123355_11367303 Ga0123355_113673032 101
199 3300010049 Ga0123356_10337073 Ga0123356_103370733 101
200 3300010049 Ga0123356_10688493 Ga0123356_106884932 103
201 3300010049 Ga0123356_11811019 Ga0123356_118110192 103
202 3300010167 Ga0123353_10564971 Ga0123353_105649713 103
203 3300010167 Ga0123353_10670500 Ga0123353_106705002 103
204 3300010049 Ga0123356_10492614 Ga0123356_104926142 107
205 iso_pr_bacteria 2820651690 2820652932 108

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00276 Ribosomal_L23 Ribosomal protein L23 15 97 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.75 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.